Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5834
Gene name
LocationContig_6:62813..63341
Strand+
Gene length (bp)528
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20174 DUF6540 Family of unknown function (DUF6540) 4.4E-06 24 140

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup842
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6267
Ophiocordyceps camponoti-floridani Ophcf2|05332
Ophiocordyceps camponoti-rufipedis Ophun1|5834 (this protein)
Ophiocordyceps kimflemingae Ophio5|1491
Ophiocordyceps kimflemingae Ophio5|4909
Ophiocordyceps subramaniannii Hirsu2|4527
Ophiocordyceps subramaniannii Hirsu2|8822

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5834
MARLIAIALHHRDHFSHGKARQTFGHEAYHWAINITPEANQSLGCSFEATDATTIDPVTFRMTNPTMDWWLRYEE
DVNLAAGPKLLGSVVIGQVAADMSSAQLHDFFGRVRLPVKNTHPQQSCVTWVADAIGALQERGWVNRFDIDQFKG
WALSYADERMKGLASTEPSVKYYSF*
Coding >Ophun1|5834
ATGGCCAGGCTCATTGCCATTGCTCTCCACCATAGAGACCATTTCTCACACGGCAAGGCCCGGCAGACGTTCGGC
CACGAGGCCTATCACTGGGCCATAAACATCACACCTGAAGCCAATCAAAGCCTTGGCTGCTCCTTCGAAGCCACC
GACGCAACCACCATCGACCCCGTCACGTTCCGCATGACCAACCCGACCATGGACTGGTGGCTCCGTTACGAAGAG
GACGTAAATCTCGCCGCCGGTCCCAAGCTTCTCGGCTCCGTCGTTATCGGACAGGTAGCAGCCGACATGTCGAGT
GCCCAGCTTCACGACTTTTTTGGTCGAGTGCGTCTGCCGGTCAAGAACACTCATCCACAGCAGAGCTGTGTGACG
TGGGTTGCGGATGCCATCGGTGCCCTTCAGGAACGAGGATGGGTAAACAGGTTTGACATTGACCAGTTCAAGGGT
TGGGCGCTTTCGTATGCCGACGAGAGGATGAAAGGATTGGCTTCGACGGAGCCGAGTGTCAAGTACTATTCTTTC
TGA
Transcript >Ophun1|5834
ATGGCCAGGCTCATTGCCATTGCTCTCCACCATAGAGACCATTTCTCACACGGCAAGGCCCGGCAGACGTTCGGC
CACGAGGCCTATCACTGGGCCATAAACATCACACCTGAAGCCAATCAAAGCCTTGGCTGCTCCTTCGAAGCCACC
GACGCAACCACCATCGACCCCGTCACGTTCCGCATGACCAACCCGACCATGGACTGGTGGCTCCGTTACGAAGAG
GACGTAAATCTCGCCGCCGGTCCCAAGCTTCTCGGCTCCGTCGTTATCGGACAGGTAGCAGCCGACATGTCGAGT
GCCCAGCTTCACGACTTTTTTGGTCGAGTGCGTCTGCCGGTCAAGAACACTCATCCACAGCAGAGCTGTGTGACG
TGGGTTGCGGATGCCATCGGTGCCCTTCAGGAACGAGGATGGGTAAACAGGTTTGACATTGACCAGTTCAAGGGT
TGGGCGCTTTCGTATGCCGACGAGAGGATGAAAGGATTGGCTTCGACGGAGCCGAGTGTCAAGTACTATTCTTTC
TGA
Gene >Ophun1|5834
ATGGCCAGGCTCATTGCCATTGCTCTCCACCATAGAGACCATTTCTCACACGGCAAGGCCCGGCAGACGTTCGGC
CACGAGGCCTATCACTGGGCCATAAACATCACACCTGAAGCCAATCAAAGCCTTGGCTGCTCCTTCGAAGCCACC
GACGCAACCACCATCGACCCCGTCACGTTCCGCATGACCAACCCGACCATGGACTGGTGGCTCCGTTACGAAGAG
GACGTAAATCTCGCCGCCGGTCCCAAGCTTCTCGGCTCCGTCGTTATCGGACAGGTAGCAGCCGACATGTCGAGT
GCCCAGCTTCACGACTTTTTTGGTCGAGTGCGTCTGCCGGTCAAGAACACTCATCCACAGCAGAGCTGTGTGACG
TGGGTTGCGGATGCCATCGGTGCCCTTCAGGAACGAGGATGGGTAAACAGGTTTGACATTGACCAGTTCAAGGGT
TGGGCGCTTTCGTATGCCGACGAGAGGATGAAAGGATTGGCTTCGACGGAGCCGAGTGTCAAGTACTATTCTTTC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail