Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|583
Gene name
LocationContig_118:30345..33280
Strand-
Gene length (bp)2935
Transcript length (bp)2868
Coding sequence length (bp)2868
Protein length (aa) 956

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01411 tRNA-synt_2c tRNA synthetases class II (A) 7.6E-206 12 591
PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain 1.5E-16 691 750
PF02272 DHHA1 DHHA1 domain 4.4E-09 825 949

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AQL1|SYA_EMENI Alanine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ala1 PE=3 SV=2 1 955 0.0E+00
sp|Q5A8K2|SYA_CANAL Alanine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALA1 PE=1 SV=1 7 953 0.0E+00
sp|P40825|SYA_YEAST Alanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALA1 PE=1 SV=3 6 955 0.0E+00
sp|O13914|SYA_SCHPO Alanine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ala1 PE=1 SV=1 7 955 0.0E+00
sp|P49588|SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=AARS PE=1 SV=2 9 953 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AQL1|SYA_EMENI Alanine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ala1 PE=3 SV=2 1 955 0.0E+00
sp|Q5A8K2|SYA_CANAL Alanine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALA1 PE=1 SV=1 7 953 0.0E+00
sp|P40825|SYA_YEAST Alanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALA1 PE=1 SV=3 6 955 0.0E+00
sp|O13914|SYA_SCHPO Alanine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ala1 PE=1 SV=1 7 955 0.0E+00
sp|P49588|SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=AARS PE=1 SV=2 9 953 0.0E+00
sp|P36428|SYA_ARATH Alanine--tRNA ligase OS=Arabidopsis thaliana GN=ALATS PE=1 SV=3 4 953 0.0E+00
sp|Q5RC02|SYAC_PONAB Alanine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=AARS PE=2 SV=1 9 953 0.0E+00
sp|O01541|SYAC_CAEEL Alanine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=aars-2 PE=2 SV=1 9 948 0.0E+00
sp|Q9VLM8|SYAC_DROME Alanine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster GN=Aats-ala PE=2 SV=1 9 953 0.0E+00
sp|Q8BGQ7|SYAC_MOUSE Alanine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Aars PE=1 SV=1 9 953 0.0E+00
sp|P50475|SYAC_RAT Alanine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Aars PE=1 SV=3 9 953 0.0E+00
sp|Q8CFX8|SYAC_MESAU Alanine--tRNA ligase, cytoplasmic OS=Mesocricetus auratus GN=Aars PE=2 SV=1 9 953 0.0E+00
sp|P21894|SYAC_BOMMO Alanine--tRNA ligase, cytoplasmic OS=Bombyx mori PE=1 SV=1 10 953 0.0E+00
sp|Q54Y20|SYAC_DICDI Alanine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=alaS PE=2 SV=1 9 948 0.0E+00
sp|Q5JTZ9|SYAM_HUMAN Alanine--tRNA ligase, mitochondrial OS=Homo sapiens GN=AARS2 PE=1 SV=1 16 953 0.0E+00
sp|Q14CH7|SYAM_MOUSE Alanine--tRNA ligase, mitochondrial OS=Mus musculus GN=Aars2 PE=1 SV=1 1 932 0.0E+00
sp|Q11V49|SYA_CYTH3 Alanine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=alaS PE=3 SV=1 9 924 0.0E+00
sp|D3ZX08|SYAM_RAT Alanine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Aars2 PE=3 SV=1 1 932 0.0E+00
sp|Q7MV54|SYA_PORGI Alanine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=alaS PE=3 SV=1 9 754 0.0E+00
sp|A8ANQ1|SYA_CITK8 Alanine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|B0TK15|SYA_SHEHH Alanine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|A4WDQ6|SYA_ENT38 Alanine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A8FSV6|SYA_SHESH Alanine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q5LHE6|SYA_BACFN Alanine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=alaS PE=3 SV=1 9 943 0.0E+00
sp|Q64YB4|SYA_BACFR Alanine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=alaS PE=3 SV=1 9 777 0.0E+00
sp|B1KPS5|SYA_SHEWM Alanine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q31X62|SYA_SHIBS Alanine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|P00957|SYA_ECOLI Alanine--tRNA ligase OS=Escherichia coli (strain K12) GN=alaS PE=1 SV=2 10 954 0.0E+00
sp|B1XCM5|SYA_ECODH Alanine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A8A3H4|SYA_ECOHS Alanine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|B1LQ15|SYA_ECOSM Alanine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q0TEI3|SYA_ECOL5 Alanine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|B1IUY2|SYA_ECOLC Alanine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q32CN1|SYA_SHIDS Alanine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A3QC89|SYA_SHELP Alanine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q1R804|SYA_ECOUT Alanine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A1AEN7|SYA_ECOK1 Alanine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q3YYG6|SYA_SHISS Alanine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A7ZQC5|SYA_ECO24 Alanine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|B2U049|SYA_SHIB3 Alanine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q8X3W8|SYA_ECO57 Alanine--tRNA ligase OS=Escherichia coli O157:H7 GN=alaS PE=3 SV=2 10 954 0.0E+00
sp|Q15RG5|SYA_PSEA6 Alanine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|A9N0C1|SYA_SALPB Alanine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q8ZMK6|SYA_SALTY Alanine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q7UBU3|SYA_SHIFL Alanine--tRNA ligase OS=Shigella flexneri GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q0T1C3|SYA_SHIF8 Alanine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q8Z4D5|SYA_SALTI Alanine--tRNA ligase OS=Salmonella typhi GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q57KU6|SYA_SALCH Alanine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q8A0M6|SYA_BACTN Alanine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=alaS PE=3 SV=1 9 777 0.0E+00
sp|A6L1L8|SYA_BACV8 Alanine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=alaS PE=3 SV=1 9 777 0.0E+00
sp|B2UKT4|SYA_AKKM8 Alanine--tRNA ligase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=alaS PE=3 SV=1 9 763 0.0E+00
sp|Q5PF17|SYA_SALPA Alanine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A1S4E9|SYA_SHEAM Alanine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=alaS PE=3 SV=2 12 757 0.0E+00
sp|A9MFZ1|SYA_SALAR Alanine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=alaS PE=3 SV=2 10 954 0.0E+00
sp|Q3ILF3|SYA_PSEHT Alanine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A8H1T6|SYA_SHEPA Alanine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q6LMU3|SYA_PHOPR Alanine--tRNA ligase OS=Photobacterium profundum GN=alaS PE=3 SV=2 12 953 0.0E+00
sp|A7MJ41|SYA_CROS8 Alanine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A6LEZ8|SYA_PARD8 Alanine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=alaS PE=3 SV=1 9 759 0.0E+00
sp|A0KPG1|SYA_AERHH Alanine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A8GA09|SYA_SERP5 Alanine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=alaS PE=3 SV=2 9 953 0.0E+00
sp|Q7N7A5|SYA_PHOLL Alanine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|A3N018|SYA_ACTP2 Alanine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q8DC49|SYA_VIBVU Alanine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q7MHR6|SYA_VIBVY Alanine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|A6TCV9|SYA_KLEP7 Alanine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A9KYF8|SYA_SHEB9 Alanine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=alaS PE=3 SV=1 10 757 0.0E+00
sp|B0BNS8|SYA_ACTPJ Alanine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q65VQ5|SYA_MANSM Alanine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q5ZUJ9|SYA_LEGPH Alanine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=alaS PE=3 SV=1 9 886 0.0E+00
sp|A5ICV6|SYA_LEGPC Alanine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=alaS PE=3 SV=1 9 886 0.0E+00
sp|Q8EBS1|SYA_SHEON Alanine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|A0KU94|SYA_SHESA Alanine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q7VLK0|SYA_HAEDU Alanine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|A1RHG5|SYA_SHESW Alanine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=alaS PE=3 SV=2 10 953 0.0E+00
sp|A4Y931|SYA_SHEPC Alanine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=alaS PE=3 SV=2 10 953 0.0E+00
sp|Q0HXF8|SYA_SHESR Alanine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q0HL60|SYA_SHESM Alanine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|B3H177|SYA_ACTP7 Alanine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q87LR3|SYA_VIBPA Alanine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q02I63|SYA_PSEAB Alanine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|A6WR16|SYA_SHEB8 Alanine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=alaS PE=3 SV=1 10 757 0.0E+00
sp|Q9I553|SYA_PSEAE Alanine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q085Z9|SYA_SHEFN Alanine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A4SS99|SYA_AERS4 Alanine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|Q31F91|SYA_THICR Alanine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=alaS PE=3 SV=1 9 949 0.0E+00
sp|A3D783|SYA_SHEB5 Alanine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=alaS PE=3 SV=1 10 757 0.0E+00
sp|Q1LQ59|SYA_CUPMC Alanine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=alaS PE=3 SV=2 10 953 1.0E-180
sp|A1T001|SYA_PSYIN Alanine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=alaS PE=3 SV=1 9 763 2.0E-180
sp|A0LXX3|SYA_GRAFK Alanine--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=alaS PE=3 SV=1 12 832 3.0E-180
sp|A6VA71|SYA_PSEA7 Alanine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=alaS PE=3 SV=1 9 953 5.0E-180
sp|Q5E7G5|SYA_VIBF1 Alanine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=alaS PE=3 SV=1 12 953 7.0E-180
sp|Q12PX7|SYA_SHEDO Alanine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=alaS PE=3 SV=1 10 797 7.0E-180
sp|A4XWE2|SYA_PSEMY Alanine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=alaS PE=3 SV=2 9 797 9.0E-180
sp|Q5X4B7|SYA_LEGPA Alanine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=alaS PE=3 SV=1 9 877 1.0E-179
sp|B1YNJ6|SYA_BURA4 Alanine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=alaS PE=3 SV=1 9 953 1.0E-179
sp|A7MYT5|SYA_VIBCB Alanine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=alaS PE=3 SV=1 12 953 3.0E-179
sp|Q39HB7|SYA_BURL3 Alanine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=alaS PE=3 SV=2 9 953 3.0E-179
sp|Q0BG79|SYA_BURCM Alanine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=alaS PE=3 SV=1 9 953 4.0E-179
sp|Q8KG04|SYA_CHLTE Alanine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=alaS PE=3 SV=1 12 757 4.0E-179
sp|Q5WVQ2|SYA_LEGPL Alanine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=alaS PE=3 SV=1 9 877 4.0E-179
sp|Q474F4|SYA_CUPPJ Alanine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=alaS PE=3 SV=1 10 953 4.0E-179
sp|A6VKD6|SYA_ACTSZ Alanine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=alaS PE=3 SV=1 9 953 4.0E-179
sp|Q885J0|SYA_PSESM Alanine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=alaS PE=3 SV=1 9 945 9.0E-179
sp|A0K6N4|SYA_BURCH Alanine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=alaS PE=3 SV=2 9 953 1.0E-178
sp|B1K026|SYA_BURCC Alanine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=alaS PE=3 SV=1 9 953 3.0E-178
sp|Q1BX19|SYA_BURCA Alanine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=alaS PE=3 SV=2 9 953 7.0E-178
sp|A1WXK5|SYA_HALHL Alanine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=alaS PE=3 SV=1 9 953 8.0E-178
sp|Q56648|SYA_VIBCH Alanine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=alaS PE=3 SV=2 12 953 1.0E-177
sp|Q5GYM8|SYA_XANOR Alanine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=alaS PE=3 SV=1 1 953 2.0E-177
sp|B2SUD0|SYA_XANOP Alanine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=alaS PE=3 SV=1 1 953 2.0E-177
sp|Q2P1N1|SYA_XANOM Alanine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=alaS PE=3 SV=1 1 953 2.0E-177
sp|Q4ZQI4|SYA_PSEU2 Alanine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=alaS PE=3 SV=2 9 757 2.0E-177
sp|A5F9B7|SYA_VIBC3 Alanine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=alaS PE=3 SV=1 12 953 2.0E-177
sp|Q5QUV7|SYA_IDILO Alanine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=alaS PE=3 SV=1 9 953 3.0E-177
sp|Q88EI8|SYA_PSEPK Alanine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=alaS PE=3 SV=1 9 754 5.0E-177
sp|P61698|SYA_BDEBA Alanine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=alaS PE=3 SV=1 9 767 5.0E-177
sp|Q1I6Z8|SYA_PSEE4 Alanine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=alaS PE=3 SV=1 9 754 6.0E-177
sp|A5UDR0|SYA_HAEIE Alanine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=alaS PE=3 SV=1 9 953 7.0E-177
sp|A5FIP9|SYA_FLAJ1 Alanine--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=alaS PE=3 SV=1 12 774 7.0E-177
sp|B2SZN0|SYA_BURPP Alanine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=alaS PE=3 SV=1 9 953 7.0E-177
sp|Q2KY72|SYA_BORA1 Alanine--tRNA ligase OS=Bordetella avium (strain 197N) GN=alaS PE=3 SV=1 9 953 8.0E-177
sp|P57933|SYA_PASMU Alanine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=alaS PE=3 SV=1 10 953 1.0E-176
sp|A4VJB3|SYA_PSEU5 Alanine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=alaS PE=3 SV=2 9 797 2.0E-176
sp|Q13W97|SYA_BURXL Alanine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=alaS PE=3 SV=1 9 953 2.0E-176
sp|B1M0N0|SYA_METRJ Alanine--tRNA ligase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=alaS PE=3 SV=1 10 788 2.0E-176
sp|Q4QM86|SYA_HAEI8 Alanine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=alaS PE=3 SV=1 9 953 2.0E-176
sp|Q3K892|SYA_PSEPF Alanine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=alaS PE=3 SV=1 9 754 3.0E-176
sp|Q1D084|SYA_MYXXD Alanine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=alaS PE=3 SV=1 9 799 3.0E-176
sp|A4JDM9|SYA_BURVG Alanine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=alaS PE=3 SV=1 9 953 3.0E-176
sp|B0KR43|SYA_PSEPG Alanine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=alaS PE=3 SV=2 9 754 4.0E-176
sp|A5W0D9|SYA_PSEP1 Alanine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=alaS PE=3 SV=2 9 754 4.0E-176
sp|Q4K843|SYA_PSEF5 Alanine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=alaS PE=3 SV=1 9 754 6.0E-176
sp|B2JK72|SYA_BURP8 Alanine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=alaS PE=3 SV=1 9 953 7.0E-176
sp|Q48G25|SYA_PSE14 Alanine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=alaS PE=3 SV=1 9 754 9.0E-176
sp|A5UHW6|SYA_HAEIG Alanine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=alaS PE=3 SV=1 9 953 1.0E-175
sp|A4SGJ6|SYA_CHLPM Alanine--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=alaS PE=3 SV=2 9 802 1.0E-175
sp|Q39Z77|SYA_GEOMG Alanine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=alaS PE=3 SV=1 9 942 2.0E-175
sp|Q8PLQ0|SYA_XANAC Alanine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=alaS PE=3 SV=1 1 953 4.0E-175
sp|B1JCG9|SYA_PSEPW Alanine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=alaS PE=3 SV=2 9 754 5.0E-175
sp|A6H0Y3|SYA_FLAPJ Alanine--tRNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=alaS PE=3 SV=1 9 815 6.0E-175
sp|Q1GHA1|SYA_RUEST Alanine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=alaS PE=3 SV=2 12 804 6.0E-175
sp|A1JK09|SYA_YERE8 Alanine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=alaS PE=3 SV=1 10 953 9.0E-175
sp|A1BD33|SYA_CHLPD Alanine--tRNA ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=alaS PE=3 SV=1 12 757 1.0E-174
sp|Q0I426|SYA_HAES1 Alanine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=alaS PE=3 SV=1 9 953 1.0E-174
sp|A1W7D0|SYA_ACISJ Alanine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=alaS PE=3 SV=1 5 953 2.0E-174
sp|Q3BUQ7|SYA_XANC5 Alanine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=alaS PE=3 SV=1 1 953 2.0E-174
sp|B0VAI3|SYA_ACIBY Alanine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=alaS PE=3 SV=1 9 952 3.0E-174
sp|A3M3W2|SYA_ACIBT Alanine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=alaS PE=3 SV=2 9 952 3.0E-174
sp|B2HWK7|SYA_ACIBC Alanine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=alaS PE=3 SV=2 9 952 3.0E-174
sp|P43815|SYA_HAEIN Alanine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=alaS PE=3 SV=1 9 953 3.0E-174
sp|Q487H5|SYA_COLP3 Alanine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=alaS PE=3 SV=1 9 953 6.0E-174
sp|Q21L68|SYA_SACD2 Alanine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=alaS PE=3 SV=1 9 760 8.0E-174
sp|Q3JCK8|SYA_NITOC Alanine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=alaS PE=3 SV=1 9 953 9.0E-174
sp|Q7WHL6|SYA_BORBR Alanine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=alaS PE=3 SV=1 9 797 1.0E-173
sp|Q7VXE1|SYA_BORPE Alanine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=alaS PE=3 SV=1 9 797 1.0E-173
sp|Q1QA88|SYA_PSYCK Alanine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=alaS PE=3 SV=1 12 953 2.0E-173
sp|Q82TF8|SYA_NITEU Alanine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=alaS PE=3 SV=1 9 953 2.0E-173
sp|B0RTY1|SYA_XANCB Alanine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=alaS PE=3 SV=1 1 953 2.0E-173
sp|Q4UTR6|SYA_XANC8 Alanine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=alaS PE=3 SV=1 1 953 2.0E-173
sp|A1ATU9|SYA_PELPD Alanine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=alaS PE=3 SV=1 10 935 3.0E-173
sp|Q6MB06|SYA_PARUW Alanine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=alaS PE=3 SV=1 12 955 3.0E-173
sp|A1TZ92|SYA_MARHV Alanine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=alaS PE=3 SV=1 9 953 4.0E-173
sp|A9AC16|SYA_BURM1 Alanine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=alaS PE=3 SV=1 9 953 4.0E-173
sp|Q6D1T0|SYA_PECAS Alanine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=alaS PE=3 SV=1 9 953 4.0E-173
sp|Q8P9X0|SYA_XANCP Alanine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=alaS PE=3 SV=1 1 953 4.0E-173
sp|Q56273|SYA_ACIFR Alanine--tRNA ligase OS=Acidithiobacillus ferrooxidans GN=alaS PE=3 SV=1 9 953 4.0E-173
sp|Q7W6N4|SYA_BORPA Alanine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=alaS PE=3 SV=1 9 797 7.0E-173
sp|Q1QMV7|SYA_NITHX Alanine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=alaS PE=3 SV=2 12 779 1.0E-172
sp|Q28QV8|SYA_JANSC Alanine--tRNA ligase OS=Jannaschia sp. (strain CCS1) GN=alaS PE=3 SV=1 12 825 1.0E-172
sp|A5WFW1|SYA_PSYWF Alanine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=alaS PE=3 SV=1 12 771 2.0E-172
sp|A9C0B9|SYA_DELAS Alanine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=alaS PE=3 SV=1 5 953 2.0E-172
sp|B0UTE1|SYA_HISS2 Alanine--tRNA ligase OS=Histophilus somni (strain 2336) GN=alaS PE=3 SV=1 9 953 3.0E-172
sp|A6W1F1|SYA_MARMS Alanine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=alaS PE=3 SV=1 9 953 4.0E-172
sp|B0TFY7|SYA_HELMI Alanine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=alaS PE=3 SV=1 6 803 4.0E-172
sp|Q3ST43|SYA_NITWN Alanine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=alaS PE=3 SV=1 12 799 8.0E-172
sp|B2FL33|SYA_STRMK Alanine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=alaS PE=3 SV=1 1 757 1.0E-171
sp|A7FLR7|SYA_YERP3 Alanine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=alaS PE=3 SV=1 9 757 1.0E-171
sp|B1JJA0|SYA_YERPY Alanine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=alaS PE=3 SV=1 9 757 1.0E-171
sp|Q66E68|SYA_YERPS Alanine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=alaS PE=3 SV=1 9 757 1.0E-171
sp|B2K5X9|SYA_YERPB Alanine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=alaS PE=3 SV=1 9 757 1.0E-171
sp|A6U9N4|SYA_SINMW Alanine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=alaS PE=3 SV=1 10 757 1.0E-171
sp|Q3ATN3|SYA_CHLCH Alanine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=alaS PE=3 SV=1 12 760 1.0E-171
sp|B2IHX3|SYA_BEII9 Alanine--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=alaS PE=3 SV=2 10 798 2.0E-171
sp|B1ZZ40|SYA_OPITP Alanine--tRNA ligase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=alaS PE=3 SV=1 9 828 2.0E-171
sp|A4TQ52|SYA_YERPP Alanine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=alaS PE=3 SV=1 9 757 3.0E-171
sp|Q1CLK9|SYA_YERPN Alanine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=alaS PE=3 SV=1 9 757 3.0E-171
sp|A9R0V7|SYA_YERPG Alanine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=alaS PE=3 SV=1 9 757 3.0E-171
sp|Q8ZBT8|SYA_YERPE Alanine--tRNA ligase OS=Yersinia pestis GN=alaS PE=3 SV=1 9 757 3.0E-171
sp|Q2S2B6|SYA_SALRD Alanine--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=alaS PE=3 SV=1 2 763 3.0E-171
sp|Q6FCT2|SYA_ACIAD Alanine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=alaS PE=3 SV=1 9 951 7.0E-171
sp|P61701|SYA_GEOSL Alanine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=alaS PE=3 SV=1 12 942 8.0E-171
sp|Q218Q3|SYA_RHOPB Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=alaS PE=3 SV=1 10 776 8.0E-171
sp|A5GD98|SYA_GEOUR Alanine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=alaS PE=3 SV=1 12 949 1.0E-170
sp|Q4FRQ0|SYA_PSYA2 Alanine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=alaS PE=3 SV=1 12 757 2.0E-170
sp|Q2SV73|SYA_BURTA Alanine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=alaS PE=3 SV=1 9 953 2.0E-170
sp|B0SZN4|SYA_CAUSK Alanine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=alaS PE=3 SV=1 10 757 2.0E-170
sp|Q0K823|SYA_CUPNH Alanine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=alaS PE=3 SV=1 10 953 2.0E-170
sp|Q2NVL2|SYA_SODGM Alanine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=alaS PE=3 SV=1 10 797 4.0E-170
sp|Q07R87|SYA_RHOP5 Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=alaS PE=3 SV=2 10 759 4.0E-170
sp|Q2ITM9|SYA_RHOP2 Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain HaA2) GN=alaS PE=3 SV=1 12 799 5.0E-170
sp|A5EML9|SYA_BRASB Alanine--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=alaS PE=3 SV=1 10 776 6.0E-170
sp|Q2SBT9|SYA_HAHCH Alanine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=alaS PE=3 SV=1 9 953 9.0E-170
sp|Q13AB9|SYA_RHOPS Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=alaS PE=3 SV=1 10 759 1.0E-169
sp|B1ZC90|SYA_METPB Alanine--tRNA ligase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=alaS PE=3 SV=1 10 798 2.0E-169
sp|A4SZL8|SYA_POLSQ Alanine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=alaS PE=3 SV=1 10 759 5.0E-169
sp|Q1H3U9|SYA_METFK Alanine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=alaS PE=3 SV=1 9 954 5.0E-169
sp|Q7NXM2|SYA_CHRVO Alanine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=alaS PE=3 SV=1 10 953 7.0E-169
sp|A4YXQ6|SYA_BRASO Alanine--tRNA ligase OS=Bradyrhizobium sp. (strain ORS278) GN=alaS PE=3 SV=1 10 799 1.0E-168
sp|Q9A5C1|SYA_CAUCR Alanine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=alaS PE=3 SV=1 10 757 2.0E-168
sp|Q0VNK2|SYA_ALCBS Alanine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=alaS PE=3 SV=2 9 951 2.0E-168
sp|P61706|SYA_RHOPA Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=alaS PE=3 SV=1 10 799 5.0E-168
sp|Q2YD40|SYA_NITMU Alanine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=alaS PE=3 SV=1 9 953 5.0E-168
sp|A0L3J9|SYA_MAGMM Alanine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=alaS PE=3 SV=1 10 953 6.0E-168
sp|A5VQX4|SYA_BRUO2 Alanine--tRNA ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|P67009|SYA_BRUSU Alanine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|B0CGZ9|SYA_BRUSI Alanine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|P67008|SYA_BRUME Alanine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|A9M5L7|SYA_BRUC2 Alanine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|Q57CU0|SYA_BRUAB Alanine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|Q2YRU8|SYA_BRUA2 Alanine--tRNA ligase OS=Brucella abortus (strain 2308) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|A3N8K7|SYA_BURP6 Alanine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=alaS PE=3 SV=1 9 953 1.0E-167
sp|P27866|SYA_RHIME Alanine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=alaS PE=3 SV=2 10 779 1.0E-167
sp|Q62KZ3|SYA_BURMA Alanine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=alaS PE=3 SV=1 9 953 2.0E-167
sp|Q165U5|SYA_ROSDO Alanine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=alaS PE=3 SV=1 12 797 3.0E-167
sp|Q63TF9|SYA_BURPS Alanine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|Q3JT87|SYA_BURP1 Alanine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A3NUB0|SYA_BURP0 Alanine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A1V3F2|SYA_BURMS Alanine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A2S3D4|SYA_BURM9 Alanine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A3MJ36|SYA_BURM7 Alanine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A9FRF5|SYA_SORC5 Alanine--tRNA ligase OS=Sorangium cellulosum (strain So ce56) GN=alaS PE=3 SV=1 8 942 4.0E-167
sp|Q9PH22|SYA_XYLFA Alanine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=alaS PE=3 SV=2 1 954 4.0E-167
sp|A9IVY8|SYA_BART1 Alanine--tRNA ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=alaS PE=3 SV=1 10 757 1.0E-166
sp|A9W5Y4|SYA_METEP Alanine--tRNA ligase OS=Methylobacterium extorquens (strain PA1) GN=alaS PE=3 SV=1 10 798 1.0E-166
sp|A7HWA5|SYA_PARL1 Alanine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=alaS PE=3 SV=2 10 766 1.0E-166
sp|Q3B1I7|SYA_CHLL7 Alanine--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=alaS PE=3 SV=1 12 757 1.0E-166
sp|A9IK31|SYA_BORPD Alanine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=alaS PE=3 SV=1 9 757 2.0E-166
sp|Q0AHX2|SYA_NITEC Alanine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=alaS PE=3 SV=1 9 953 3.0E-166
sp|Q6AQ16|SYA_DESPS Alanine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=alaS PE=3 SV=1 10 830 5.0E-166
sp|Q0AQY6|SYA_MARMM Alanine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=alaS PE=3 SV=1 12 778 8.0E-166
sp|A9B660|SYA_HERA2 Alanine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=alaS PE=3 SV=1 10 867 9.0E-166
sp|A9NCN7|SYA_COXBR Alanine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=alaS PE=3 SV=1 9 954 1.0E-165
sp|B0UGC4|SYA_METS4 Alanine--tRNA ligase OS=Methylobacterium sp. (strain 4-46) GN=alaS PE=3 SV=1 12 796 1.0E-165
sp|A7HH87|SYA_ANADF Alanine--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=alaS PE=3 SV=1 9 942 1.0E-165
sp|Q83CQ6|SYA_COXBU Alanine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=alaS PE=3 SV=1 9 954 1.0E-165
sp|A9KG28|SYA_COXBN Alanine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=alaS PE=3 SV=1 9 954 1.0E-165
sp|A6X0E9|SYA_OCHA4 Alanine--tRNA ligase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=alaS PE=3 SV=1 10 757 2.0E-165
sp|Q0AZQ1|SYA_SYNWW Alanine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=alaS PE=3 SV=1 7 822 2.0E-165
sp|Q8UE87|SYA_AGRFC Alanine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=alaS PE=3 SV=2 10 757 2.0E-165
sp|Q1C420|SYA_YERPA Alanine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=alaS PE=3 SV=1 9 757 6.0E-165
sp|B0TZY8|SYA_FRAP2 Alanine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=alaS PE=3 SV=1 11 954 6.0E-165
sp|A5EW88|SYA_DICNV Alanine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=alaS PE=3 SV=1 10 798 8.0E-165
sp|Q221G2|SYA_RHOFT Alanine--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=alaS PE=3 SV=1 8 953 8.0E-165
sp|Q89I89|SYA_BRADU Alanine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=alaS PE=3 SV=2 10 774 2.0E-164
sp|Q87F43|SYA_XYLFT Alanine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=alaS PE=3 SV=1 1 763 2.0E-164
sp|B2I6K2|SYA_XYLF2 Alanine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=alaS PE=3 SV=1 1 763 2.0E-164
sp|A8LL20|SYA_DINSH Alanine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=alaS PE=3 SV=1 10 757 3.0E-164
sp|Q0A8K7|SYA_ALKEH Alanine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=alaS PE=3 SV=1 9 955 3.0E-164
sp|Q60BS6|SYA_METCA Alanine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=alaS PE=3 SV=1 9 954 4.0E-164
sp|Q01XA0|SYA_SOLUE Alanine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=alaS PE=3 SV=1 12 942 4.0E-164
sp|A8ICW8|SYA_AZOC5 Alanine--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=alaS PE=3 SV=1 10 774 4.0E-164
sp|Q129G8|SYA_POLSJ Alanine--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=alaS PE=3 SV=1 2 952 8.0E-164
sp|A1AXE0|SYA_RUTMC Alanine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=alaS PE=3 SV=1 9 938 1.0E-163
sp|B0U1K9|SYA_XYLFM Alanine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=alaS PE=3 SV=1 1 953 1.0E-163
sp|Q11IW3|SYA_CHESB Alanine--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=alaS PE=3 SV=2 12 796 2.0E-163
sp|A4G2S9|SYA_HERAR Alanine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=alaS PE=3 SV=1 9 952 2.0E-163
sp|A5UY81|SYA_ROSS1 Alanine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=alaS PE=3 SV=2 6 943 3.0E-163
sp|Q8Y193|SYA_RALSO Alanine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=alaS PE=3 SV=1 9 953 7.0E-163
sp|Q2W1D9|SYA_MAGSA Alanine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=alaS PE=3 SV=1 9 754 8.0E-163
sp|Q4FMX6|SYA_PELUB Alanine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=alaS PE=3 SV=1 10 827 1.0E-162
sp|Q30YS5|SYA_DESAG Alanine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=alaS PE=3 SV=1 9 951 1.0E-162
sp|A0LLA3|SYA_SYNFM Alanine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=alaS PE=3 SV=1 9 953 2.0E-162
sp|A4WV47|SYA_RHOS5 Alanine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=alaS PE=3 SV=1 12 797 3.0E-162
sp|Q1MFZ9|SYA_RHIL3 Alanine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=alaS PE=3 SV=1 12 780 3.0E-162
sp|Q2IG40|SYA_ANADE Alanine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=alaS PE=3 SV=1 9 946 3.0E-162
sp|Q5F7C4|SYA_NEIG1 Alanine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=alaS PE=3 SV=1 10 953 3.0E-162
sp|A9M198|SYA_NEIM0 Alanine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=alaS PE=3 SV=2 10 953 4.0E-162
sp|Q9JTG4|SYA_NEIMA Alanine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=alaS PE=3 SV=1 10 953 6.0E-162
sp|Q1LTQ4|SYA_BAUCH Alanine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=alaS PE=3 SV=1 8 757 6.0E-162
sp|B3E044|SYA_METI4 Alanine--tRNA ligase OS=Methylacidiphilum infernorum (isolate V4) GN=alaS PE=3 SV=1 9 930 1.0E-161
sp|A1WIG8|SYA_VEREI Alanine--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=alaS PE=3 SV=1 5 953 2.0E-161
sp|A1KV20|SYA_NEIMF Alanine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=alaS PE=3 SV=1 10 953 2.0E-161
sp|A6SVH6|SYA_JANMA Alanine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=alaS PE=3 SV=1 9 757 3.0E-161
sp|Q3A1W0|SYA_PELCD Alanine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=alaS PE=3 SV=2 10 953 3.0E-161
sp|A0Q604|SYA_FRATN Alanine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=alaS PE=3 SV=1 12 954 4.0E-161
sp|A1AZL6|SYA_PARDP Alanine--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=alaS PE=3 SV=1 12 952 6.0E-161
sp|Q1QZX1|SYA_CHRSD Alanine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=alaS PE=3 SV=1 12 953 2.0E-160
sp|Q2LPL7|SYA_SYNAS Alanine--tRNA ligase OS=Syntrophus aciditrophicus (strain SB) GN=alaS PE=3 SV=1 10 949 3.0E-160
sp|Q65GS5|SYA_BACLD Alanine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=alaS PE=3 SV=1 9 953 3.0E-160
sp|A2SI90|SYA_METPP Alanine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=alaS PE=3 SV=1 9 757 3.0E-160
sp|A7NQA5|SYA_ROSCS Alanine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=alaS PE=3 SV=1 6 943 4.0E-160
sp|Q98NQ5|SYA_RHILO Alanine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=alaS PE=3 SV=1 10 757 4.0E-160
sp|Q6G2Z4|SYA_BARHE Alanine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=alaS PE=3 SV=1 12 774 4.0E-160
sp|A1VQK2|SYA_POLNA Alanine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=alaS PE=3 SV=1 5 778 6.0E-160
sp|O67323|SYA_AQUAE Alanine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=alaS PE=1 SV=1 9 813 9.0E-160
sp|Q5FQ21|SYA_GLUOX Alanine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=alaS PE=3 SV=1 12 778 2.0E-159
sp|Q3SLA9|SYA_THIDA Alanine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=alaS PE=3 SV=2 9 953 2.0E-159
sp|Q2N9K5|SYA_ERYLH Alanine--tRNA ligase OS=Erythrobacter litoralis (strain HTCC2594) GN=alaS PE=3 SV=1 12 765 2.0E-159
sp|Q2G8V0|SYA_NOVAD Alanine--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=alaS PE=3 SV=1 10 769 3.0E-159
sp|A4IZ01|SYA_FRATW Alanine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=alaS PE=3 SV=1 12 954 4.0E-159
sp|Q0BYM3|SYA_HYPNA Alanine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=alaS PE=3 SV=1 12 757 6.0E-159
sp|Q47AU8|SYA_DECAR Alanine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=alaS PE=3 SV=1 9 953 7.0E-159
sp|Q5NFW7|SYA_FRATT Alanine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=alaS PE=3 SV=1 12 954 8.0E-159
sp|Q14HB9|SYA_FRAT1 Alanine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=alaS PE=3 SV=1 12 954 8.0E-159
sp|Q0BLS9|SYA_FRATO Alanine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=alaS PE=3 SV=1 12 954 1.0E-158
sp|Q2A3A9|SYA_FRATH Alanine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=alaS PE=3 SV=1 12 954 1.0E-158
sp|A7NCD9|SYA_FRATF Alanine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=alaS PE=3 SV=1 12 954 1.0E-158
sp|Q5LRU1|SYA_RUEPO Alanine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=alaS PE=3 SV=1 12 805 1.0E-158
sp|Q2K7T4|SYA_RHIEC Alanine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=alaS PE=3 SV=2 12 779 1.0E-158
sp|A3PLJ1|SYA_RHOS1 Alanine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=alaS PE=3 SV=1 12 757 1.0E-158
sp|Q3J0R1|SYA_RHOS4 Alanine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=alaS PE=3 SV=1 12 757 2.0E-158
sp|A9WCR2|SYA_CHLAA Alanine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=alaS PE=3 SV=1 6 803 2.0E-158
sp|Q67MV8|SYA_SYMTH Alanine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=alaS PE=3 SV=1 9 814 4.0E-158
sp|Q9JYG6|SYA_NEIMB Alanine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=alaS PE=3 SV=1 10 953 5.0E-158
sp|Q92BK9|SYA_LISIN Alanine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=alaS PE=3 SV=1 9 952 6.0E-158
sp|Q0BSD5|SYA_GRABC Alanine--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=alaS PE=3 SV=2 12 867 7.0E-158
sp|B2SH99|SYA_FRATM Alanine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=alaS PE=3 SV=1 12 954 7.0E-158
sp|A5FXC2|SYA_ACICJ Alanine--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=alaS PE=3 SV=1 12 754 8.0E-158
sp|A7IMR0|SYA_XANP2 Alanine--tRNA ligase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=alaS PE=3 SV=1 10 757 2.0E-157
sp|Q9XDM3|SYA_AQUPY Alanine--tRNA ligase OS=Aquifex pyrophilus GN=alaS PE=3 SV=1 7 757 4.0E-157
sp|Q5P7Q3|SYA_AROAE Alanine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=alaS PE=3 SV=1 9 953 4.0E-157
sp|B1Y1G9|SYA_LEPCP Alanine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=alaS PE=3 SV=1 9 797 6.0E-157
sp|A1USS4|SYA_BARBK Alanine--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=alaS PE=3 SV=1 10 757 8.0E-157
sp|B2V709|SYA_SULSY Alanine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=alaS PE=3 SV=1 9 920 1.0E-156
sp|A1K991|SYA_AZOSB Alanine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=alaS PE=3 SV=1 9 953 1.0E-156
sp|Q493M6|SYA_BLOPB Alanine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=alaS PE=3 SV=1 12 757 1.0E-156
sp|P70865|SYA_BARBA Alanine--tRNA ligase OS=Bartonella bacilliformis GN=alaS PE=3 SV=1 10 757 7.0E-156
sp|Q6FZF1|SYA_BARQU Alanine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=alaS PE=3 SV=1 12 757 8.0E-156
sp|Q9RNN8|SYA_ZYMMO Alanine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=alaS PE=3 SV=2 10 757 1.0E-155
sp|A7GT67|SYA_BACCN Alanine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=alaS PE=3 SV=1 10 950 6.0E-155
sp|Q81LK0|SYA_BACAN Alanine--tRNA ligase OS=Bacillus anthracis GN=alaS PE=3 SV=1 10 817 9.0E-155
sp|A5CVU0|SYA_VESOH Alanine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=alaS PE=3 SV=1 9 938 1.0E-154
sp|Q817Z0|SYA_BACCR Alanine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=alaS PE=3 SV=1 10 817 3.0E-154
sp|Q634F6|SYA_BACCZ Alanine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=alaS PE=3 SV=1 10 817 4.0E-154
sp|A0RJ00|SYA_BACAH Alanine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=alaS PE=3 SV=1 10 817 5.0E-154
sp|P61697|SYA_BACC1 Alanine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=alaS PE=3 SV=1 10 817 6.0E-154
sp|A9VI09|SYA_BACWK Alanine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=alaS PE=3 SV=1 10 817 7.0E-154
sp|Q2GJ36|SYA_ANAPZ Alanine--tRNA ligase OS=Anaplasma phagocytophilum (strain HZ) GN=alaS PE=3 SV=1 10 806 7.0E-154
sp|Q6HDD7|SYA_BACHK Alanine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=alaS PE=3 SV=1 10 817 1.0E-153
sp|Q2RQI0|SYA_RHORT Alanine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=alaS PE=3 SV=1 10 761 1.0E-153
sp|A1VEQ6|SYA_DESVV Alanine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=alaS PE=3 SV=1 9 939 4.0E-153
sp|Q255X6|SYA_CHLFF Alanine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=alaS PE=3 SV=1 9 953 4.0E-153
sp|A8GQ73|SYA_RICAH Alanine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=alaS PE=3 SV=1 5 803 4.0E-153
sp|O84754|SYA_CHLTR Alanine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=alaS PE=3 SV=2 9 953 6.0E-153
sp|Q3KKU4|SYA_CHLTA Alanine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=alaS PE=3 SV=1 9 953 6.0E-153
sp|A0AIV3|SYA_LISW6 Alanine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=alaS PE=3 SV=1 9 798 1.0E-152
sp|Q9KDE6|SYA_BACHD Alanine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=alaS PE=3 SV=1 9 757 1.0E-152
sp|Q2RHZ3|SYA_MOOTA Alanine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=alaS PE=3 SV=1 10 942 1.0E-152
sp|P61700|SYA_DESVH Alanine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=alaS PE=3 SV=1 9 939 1.0E-152
sp|A7Z735|SYA_BACMF Alanine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=alaS PE=3 SV=1 9 953 1.0E-152
sp|Q02XE9|SYA_LACLS Alanine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=alaS PE=3 SV=1 9 807 3.0E-152
sp|Q9Z714|SYA_CHLPN Alanine--tRNA ligase OS=Chlamydia pneumoniae GN=alaS PE=3 SV=1 9 953 3.0E-152
sp|Q8K9E7|SYA_BUCAP Alanine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=alaS PE=3 SV=1 6 757 5.0E-152
sp|Q4UJT5|SYA_RICFE Alanine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=alaS PE=3 SV=1 6 803 5.0E-152
sp|P67011|SYA_STAAN Alanine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=alaS PE=1 SV=1 6 950 9.0E-152
sp|P67010|SYA_STAAM Alanine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=alaS PE=3 SV=1 6 950 9.0E-152
sp|A5ITE3|SYA_STAA9 Alanine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=alaS PE=3 SV=1 6 950 9.0E-152
sp|A6U287|SYA_STAA2 Alanine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=alaS PE=3 SV=1 6 950 9.0E-152
sp|A7X328|SYA_STAA1 Alanine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=alaS PE=3 SV=1 6 950 9.0E-152
sp|B0BAK4|SYA_CHLTB Alanine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=alaS PE=3 SV=1 9 953 1.0E-151
sp|B0B8X5|SYA_CHLT2 Alanine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=alaS PE=3 SV=1 9 953 1.0E-151
sp|Q5GSS5|SYA_WOLTR Alanine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=alaS PE=3 SV=1 10 922 1.0E-151
sp|Q8NW87|SYA_STAAW Alanine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=alaS PE=3 SV=1 6 950 2.0E-151
sp|Q6G8V1|SYA_STAAS Alanine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=alaS PE=3 SV=1 6 950 2.0E-151
sp|Q5L512|SYA_CHLAB Alanine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=alaS PE=3 SV=1 9 953 2.0E-151
sp|P61709|SYA_WOLPM Alanine--tRNA ligase OS=Wolbachia pipientis wMel GN=alaS PE=3 SV=1 10 793 2.0E-151
sp|A8F323|SYA_RICM5 Alanine--tRNA ligase OS=Rickettsia massiliae (strain Mtu5) GN=alaS PE=3 SV=2 5 803 2.0E-151
sp|Q1GSD9|SYA_SPHAL Alanine--tRNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=alaS PE=3 SV=1 12 757 2.0E-151
sp|Q6GG85|SYA_STAAR Alanine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=alaS PE=3 SV=1 6 950 2.0E-151
sp|A4J2K4|SYA_DESRM Alanine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=alaS PE=3 SV=1 12 954 2.0E-151
sp|A5V3L0|SYA_SPHWW Alanine--tRNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=alaS PE=3 SV=1 12 776 3.0E-151
sp|Q71ZG6|SYA_LISMF Alanine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=alaS PE=3 SV=1 9 952 3.0E-151
sp|A6QHF9|SYA_STAAE Alanine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=alaS PE=3 SV=1 6 950 3.0E-151
sp|Q5HFE4|SYA_STAAC Alanine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=alaS PE=3 SV=1 6 950 3.0E-151
sp|Q2FXV9|SYA_STAA8 Alanine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=alaS PE=3 SV=1 6 950 3.0E-151
sp|Q2FGA8|SYA_STAA3 Alanine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=alaS PE=3 SV=1 6 950 3.0E-151
sp|A2RME6|SYA_LACLM Alanine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=alaS PE=3 SV=1 9 807 4.0E-151
sp|Q821R2|SYA_CHLCV Alanine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=alaS PE=3 SV=1 9 953 4.0E-151
sp|A8Z4F6|SYA_STAAT Alanine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=alaS PE=3 SV=1 6 950 4.0E-151
sp|Q8Y722|SYA_LISMO Alanine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=alaS PE=3 SV=1 9 952 6.0E-151
sp|A8GU16|SYA_RICRS Alanine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=alaS PE=3 SV=1 5 803 6.0E-151
sp|B0BVK9|SYA_RICRO Alanine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=alaS PE=3 SV=1 5 803 6.0E-151
sp|Q835J8|SYA_ENTFA Alanine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=alaS PE=3 SV=1 9 763 6.0E-151
sp|O34526|SYA_BACSU Alanine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=alaS PE=3 SV=1 9 953 9.0E-151
sp|Q92G00|SYA_RICCN Alanine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=alaS PE=3 SV=1 5 803 1.0E-150
sp|Q9CEW0|SYA_LACLA Alanine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=alaS PE=3 SV=1 9 807 1.0E-150
sp|A6Q576|SYA_NITSB Alanine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=alaS PE=3 SV=1 12 757 1.0E-150
sp|Q2YT60|SYA_STAAB Alanine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=alaS PE=3 SV=1 6 950 2.0E-150
sp|Q5PBJ0|SYA_ANAMM Alanine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=alaS PE=3 SV=1 10 756 3.0E-150
sp|A5D3F4|SYA_PELTS Alanine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=alaS PE=3 SV=2 10 757 3.0E-150
sp|A6Q747|SYA_SULNB Alanine--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=alaS PE=3 SV=1 12 757 4.0E-150
sp|A0RPR0|SYA_CAMFF Alanine--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=alaS PE=3 SV=1 12 763 8.0E-150
sp|Q2JTG8|SYA_SYNJA Alanine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=alaS PE=3 SV=1 5 953 2.0E-149
sp|Q8RFJ8|SYA_FUSNN Alanine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=alaS PE=3 SV=1 9 932 2.0E-149
sp|A8F078|SYA_RICCK Alanine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=alaS PE=3 SV=1 5 814 3.0E-149
sp|Q8CSA7|SYA_STAES Alanine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=alaS PE=3 SV=1 6 950 3.0E-149
sp|Q5HNT2|SYA_STAEQ Alanine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=alaS PE=3 SV=1 6 950 3.0E-149
sp|Q7VQG3|SYA_BLOFL Alanine--tRNA ligase OS=Blochmannia floridanus GN=alaS PE=3 SV=1 12 760 3.0E-149
sp|Q827S4|SYA_STRAW Alanine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=alaS PE=3 SV=1 9 954 6.0E-149
sp|Q03ER8|SYA_PEDPA Alanine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=alaS PE=3 SV=1 9 952 1.0E-148
sp|Q9ZCA4|SYA_RICPR Alanine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=alaS PE=3 SV=1 5 803 2.0E-148
sp|A8FFM9|SYA_BACP2 Alanine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=alaS PE=3 SV=1 9 758 4.0E-148
sp|Q9PLH5|SYA_CHLMU Alanine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=alaS PE=3 SV=1 9 953 1.0E-147
sp|Q1MP42|SYA_LAWIP Alanine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=alaS PE=3 SV=1 12 952 2.0E-147
sp|Q4L6W5|SYA_STAHJ Alanine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=alaS PE=3 SV=1 9 951 4.0E-147
sp|A4IR80|SYA_GEOTN Alanine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=alaS PE=3 SV=2 6 829 4.0E-147
sp|Q03R43|SYA_LACBA Alanine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=alaS PE=3 SV=1 9 952 4.0E-147
sp|B1W3I1|SYA_STRGG Alanine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=alaS PE=3 SV=1 9 951 6.0E-147
sp|A8ZY67|SYA_DESOH Alanine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=alaS PE=3 SV=1 10 757 9.0E-147
sp|Q7VHV4|SYA_HELHP Alanine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=alaS PE=3 SV=1 12 904 3.0E-146
sp|Q49Y56|SYA_STAS1 Alanine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=alaS PE=3 SV=1 9 950 5.0E-146
sp|Q68VQ7|SYA_RICTY Alanine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=alaS PE=3 SV=1 5 803 1.0E-145
sp|Q2JLC4|SYA_SYNJB Alanine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=alaS PE=3 SV=1 5 953 2.0E-145
sp|Q7V3N0|SYA_PROMP Alanine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=alaS PE=3 SV=1 12 953 4.0E-145
sp|Q045P6|SYA_LACGA Alanine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=alaS PE=3 SV=1 9 797 8.0E-145
sp|B1I370|SYA_DESAP Alanine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=alaS PE=3 SV=1 9 835 9.0E-145
sp|Q1RKG2|SYA_RICBR Alanine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=alaS PE=3 SV=1 6 803 9.0E-145
sp|Q5KWU5|SYA_GEOKA Alanine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=alaS PE=3 SV=1 6 815 2.0E-144
sp|A3DKB6|SYA_CLOTH Alanine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=alaS PE=3 SV=1 6 803 3.0E-144
sp|B1HUK4|SYA_LYSSC Alanine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=alaS PE=3 SV=2 9 763 4.0E-144
sp|P61702|SYA_LACJO Alanine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=alaS PE=3 SV=1 9 797 5.0E-144
sp|Q9KXP9|SYA_STRCO Alanine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=alaS PE=3 SV=1 9 954 9.0E-144
sp|A9BJE0|SYA_PETMO Alanine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=alaS PE=3 SV=1 7 806 1.0E-143
sp|A5FSU1|SYA_DEHMB Alanine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=alaS PE=3 SV=1 7 808 1.0E-143
sp|Q30PA9|SYA_SULDN Alanine--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=alaS PE=3 SV=2 12 794 1.0E-143
sp|A5N7T5|SYA_CLOK5 Alanine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=alaS PE=3 SV=1 6 767 2.0E-143
sp|A7GZA4|SYA_CAMC5 Alanine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=alaS PE=3 SV=1 12 797 2.0E-143
sp|B1YJE5|SYA_EXIS2 Alanine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=alaS PE=3 SV=1 10 760 2.0E-143
sp|Q5WHM8|SYA_BACSK Alanine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=alaS PE=3 SV=1 6 797 3.0E-143
sp|Q9FFC7|SYAP_ARATH Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=EMB86 PE=1 SV=2 12 756 4.0E-143
sp|Q1CS22|SYA_HELPH Alanine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=alaS PE=3 SV=1 12 884 5.0E-143
sp|A8EWI6|SYA_ARCB4 Alanine--tRNA ligase OS=Arcobacter butzleri (strain RM4018) GN=alaS PE=3 SV=1 12 773 5.0E-143
sp|Q3ZWC3|SYA_DEHMC Alanine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=alaS PE=3 SV=1 7 808 7.0E-143
sp|Q88V10|SYA_LACPL Alanine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=alaS PE=3 SV=1 6 819 1.0E-142
sp|B0SPT4|SYA_LEPBP Alanine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=alaS PE=3 SV=1 12 953 1.0E-142
sp|B0SGD3|SYA_LEPBA Alanine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=alaS PE=3 SV=1 12 953 1.0E-142
sp|Q23122|SYAM_CAEEL Alanine--tRNA ligase, mitochondrial OS=Caenorhabditis elegans GN=aars-1 PE=1 SV=2 10 787 2.0E-142
sp|Q97Q48|SYA_STRPN Alanine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=alaS PE=3 SV=1 9 797 2.0E-142
sp|Q8DPC7|SYA_STRR6 Alanine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=alaS PE=3 SV=1 9 797 3.0E-142
sp|Q04JW5|SYA_STRP2 Alanine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=alaS PE=3 SV=1 9 797 3.0E-142
sp|A8F866|SYA_PSELT Alanine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=alaS PE=3 SV=1 12 884 3.0E-142
sp|Q9ZJY5|SYA_HELPJ Alanine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=alaS PE=3 SV=1 12 884 1.0E-141
sp|Q8DH56|SYA_THEEB Alanine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=alaS PE=3 SV=2 11 954 1.0E-141
sp|B1ICI3|SYA_STRPI Alanine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=alaS PE=3 SV=1 9 797 1.0E-141
sp|Q5M5L5|SYA_STRT2 Alanine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=alaS PE=3 SV=1 9 933 2.0E-141
sp|Q5M126|SYA_STRT1 Alanine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=alaS PE=3 SV=1 9 933 2.0E-141
sp|P57483|SYA_BUCAI Alanine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=alaS PE=3 SV=1 6 767 2.0E-141
sp|Q03LZ8|SYA_STRTD Alanine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=alaS PE=3 SV=1 9 933 2.0E-141
sp|Q7NI36|SYA_GLOVI Alanine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=alaS PE=3 SV=1 12 754 2.0E-141
sp|Q896F2|SYA_CLOTE Alanine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=alaS PE=3 SV=1 10 776 2.0E-141
sp|A0Q151|SYA_CLONN Alanine--tRNA ligase OS=Clostridium novyi (strain NT) GN=alaS PE=3 SV=1 6 757 2.0E-141
sp|Q8E600|SYA_STRA3 Alanine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=alaS PE=3 SV=1 9 795 3.0E-141
sp|B2KAQ0|SYA_ELUMP Alanine--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=alaS PE=3 SV=1 9 776 3.0E-141
sp|Q7MAD3|SYA_WOLSU Alanine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=alaS PE=3 SV=1 12 800 3.0E-141
sp|B2IQK0|SYA_STRPS Alanine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=alaS PE=3 SV=1 9 797 4.0E-141
sp|B9HQZ6|SYAP_POPTR Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Populus trichocarpa GN=POPTRDRAFT_821063 PE=3 SV=1 12 756 6.0E-141
sp|A4VVR3|SYA_STRSY Alanine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=alaS PE=3 SV=1 9 797 7.0E-141
sp|A4W221|SYA_STRS2 Alanine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=alaS PE=3 SV=2 9 797 7.0E-141
sp|Q99Z57|SYA_STRP1 Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=alaS PE=3 SV=1 9 940 8.0E-141
sp|Q9PI05|SYA_CAMJE Alanine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=alaS PE=3 SV=1 12 757 1.0E-140
sp|Q5HVQ7|SYA_CAMJR Alanine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=alaS PE=3 SV=1 12 757 1.0E-140
sp|Q10VG8|SYA_TRIEI Alanine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=alaS PE=3 SV=1 6 954 2.0E-140
sp|Q8CWY0|SYA_STRMU Alanine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=alaS PE=3 SV=1 9 933 2.0E-140
sp|P0DG25|SYA_STRPQ Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=alaS PE=3 SV=1 9 940 2.0E-140
sp|P0DG24|SYA_STRP3 Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=alaS PE=3 SV=1 9 940 2.0E-140
sp|Q3K1P7|SYA_STRA1 Alanine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=alaS PE=3 SV=1 9 795 2.0E-140
sp|Q1JG77|SYA_STRPD Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=alaS PE=3 SV=1 9 940 2.0E-140
sp|Q48SS4|SYA_STRPM Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=alaS PE=3 SV=1 9 940 2.0E-140
sp|A8AYI8|SYA_STRGC Alanine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=alaS PE=3 SV=1 9 943 2.0E-140
sp|Q86H43|SYAM_DICDI Alanine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=malaS PE=3 SV=1 1 757 2.0E-140
sp|Q3AEN8|SYA_CARHZ Alanine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=alaS PE=3 SV=1 9 802 3.0E-140
sp|A1VYL8|SYA_CAMJJ Alanine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=alaS PE=3 SV=1 12 757 3.0E-140
sp|A7I206|SYA_CAMHC Alanine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=alaS PE=3 SV=1 12 868 3.0E-140
sp|Q5XBH1|SYA_STRP6 Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=alaS PE=3 SV=1 9 940 4.0E-140
sp|Q8E0C4|SYA_STRA5 Alanine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=alaS PE=3 SV=1 9 795 4.0E-140
sp|A8FKT2|SYA_CAMJ8 Alanine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=alaS PE=3 SV=1 12 757 4.0E-140
sp|Q38YN9|SYA_LACSS Alanine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=alaS PE=3 SV=1 9 949 5.0E-140
sp|Q3ZAE4|SYA_DEHM1 Alanine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=alaS PE=3 SV=1 7 798 5.0E-140
sp|C5Z7K4|SYAP_SORBI Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Sorghum bicolor GN=Sb10g008780 PE=3 SV=1 6 756 5.0E-140
sp|P61705|SYA_MYCPA Alanine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=alaS PE=3 SV=1 12 943 6.0E-140
sp|A0QI75|SYA_MYCA1 Alanine--tRNA ligase OS=Mycobacterium avium (strain 104) GN=alaS PE=3 SV=1 12 943 6.0E-140
sp|P56452|SYA_HELPY Alanine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=alaS PE=3 SV=1 12 763 6.0E-140
sp|A7ZE62|SYA_CAMC1 Alanine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=alaS PE=3 SV=1 12 762 8.0E-140
sp|Q5FLW6|SYA_LACAC Alanine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=alaS PE=3 SV=1 6 819 9.0E-140
sp|Q1JL53|SYA_STRPC Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=alaS PE=3 SV=1 9 940 1.0E-139
sp|Q1JB08|SYA_STRPB Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=alaS PE=3 SV=1 9 940 1.0E-139
sp|Q8P0E6|SYA_STRP8 Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=alaS PE=3 SV=1 9 940 1.0E-139
sp|Q5FH56|SYA_EHRRG Alanine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=alaS PE=3 SV=1 9 929 1.0E-139
sp|Q8RAH4|SYA_CALS4 Alanine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=alaS PE=3 SV=1 6 954 2.0E-139
sp|Q03B02|SYA_LACC3 Alanine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=alaS PE=3 SV=1 6 758 2.0E-139
sp|A8YTJ0|SYA_LACH4 Alanine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=alaS PE=3 SV=1 6 943 3.0E-139
sp|A2BTZ9|SYA_PROM5 Alanine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=alaS PE=3 SV=1 12 953 3.0E-139
sp|Q1AWA6|SYA_RUBXD Alanine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=alaS PE=3 SV=1 9 818 5.0E-139
sp|B1LBS9|SYA_THESQ Alanine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=alaS PE=3 SV=1 9 950 6.0E-139
sp|A2RDY3|SYA_STRPG Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=alaS PE=3 SV=1 9 940 8.0E-139
sp|Q1J5Z4|SYA_STRPF Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=alaS PE=3 SV=1 9 940 8.0E-139
sp|A3CLY3|SYA_STRSV Alanine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=alaS PE=3 SV=1 9 797 1.0E-138
sp|B0JI84|SYA_MICAN Alanine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=alaS PE=3 SV=1 10 954 2.0E-138
sp|Q24UT2|SYA_DESHY Alanine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=alaS PE=3 SV=1 7 932 2.0E-138
[Show less]

GO

GO Term Description Terminal node
GO:0006419 alanyl-tRNA aminoacylation Yes
GO:0003676 nucleic acid binding Yes
GO:0000166 nucleotide binding Yes
GO:0043039 tRNA aminoacylation Yes
GO:0004813 alanine-tRNA ligase activity Yes
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0140101 catalytic activity, acting on a tRNA No
GO:0097159 organic cyclic compound binding No
GO:0043436 oxoacid metabolic process No
GO:0043038 amino acid activation No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0019752 carboxylic acid metabolic process No
GO:0006418 tRNA aminoacylation for protein translation No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0006807 nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0140098 catalytic activity, acting on RNA No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0006082 organic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|583
MSREPKWPASRVRKTFFDFFAQRGHTIVPSGSVVPHNDATLLFTNAGMNQFKPIFLGTVGPSDPMAGLKRAADSQ
KVIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAMAWELLTRVYGLDPARLYVTYFEGNAGLGLDP
DLEARDLWKDIGVPEDHILPGNMRDNFWEMGDQGPCGPCSEVHYDKIGGGRNAAKLVNEDDPMVVEIWNIVFIQY
DRQKDKSLKPLPAKHVDTGMGYERLVSALQDTKSNYATDCFTPLFDRIQLVTGVRPYSDKYGKDDVDGIDTAYRV
VADHIRTLSFAIADGAVPNNDGRGYVIRRILRRGVRYARKYLNADIGSFFSKILPALIDHVGDQFPELVSKRNDL
VEILDEEEEAFSRTLDRGEAQFEKHAAKAAAKGDKKLDGDTVWRLYDTFGFPVDLTRIMADERGLIIDDAEVEAA
RERAREASKAVKDAVDTFAKLDVHQIAELEQHRAIARTEDDAKFIRGNCKAKVQLIFDGKAFHSSTRQLPPNSPL
GLLLDRTNFYAESGGQVADTGRIVIDGVAEFKVIDVQNYGGYVLHSGFISYGALSAGDGVVCAYEELRRDPIRHN
HSGTHVLNHALREVLGDDVNQKGSLVDDEKLRFDFSHKSQVKLDQLRRIEELANTYIDRDDDVFAKDVDLHLARQ
INGVRAVFGETYPNPVRVVSLGADIDAMLADPSLPQWRNYSVEFCGGTHVDRTSNIKRLVIVEESGIAKGIRRIV
AFTGESAHHVQREAASYQTTLDALDALPPGPKKESRAREVSQELSQLVVSTLDKDALNRRFQSISAGVVAEHKAR
HKAEAKAALDAALAHFAEAEGRMWFVGRVPVGANAKAVGEVVRYFQGKDGERSVYVLAGDGEGVVHAVYVGKYLS
ERGVTAEEWASVVTGVVGGRSGGKEPVRQGQGTKPEMVDEGVEVAERWLREKLKL*
Coding >Ophun1|583
ATGAGCCGCGAACCCAAGTGGCCCGCGTCTCGCGTGCGCAAGACCTTCTTCGACTTCTTCGCTCAGCGAGGCCAT
ACCATCGTCCCCTCAGGCTCCGTCGTGCCTCACAATGATGCCACGCTTCTCTTCACCAACGCGGGCATGAACCAG
TTCAAGCCCATCTTTCTCGGCACCGTCGGCCCTTCTGATCCCATGGCGGGTCTCAAGCGTGCCGCCGATTCGCAA
AAGGTGATTCGCGCGGGGGGCAAGCACAACGACCTCGACGACGTCGGCAAGGATAGCTATCATCATACCTTTTTC
GAGATGCTGGGCAACTGGTCCTTTGGAGACTACTTTAAAAAAGAGGCCATCGCCATGGCATGGGAGCTTCTCACC
CGTGTATATGGGCTTGACCCGGCTCGTCTCTACGTCACCTACTTCGAGGGCAACGCCGGTCTCGGCCTCGACCCG
GATCTCGAGGCCAGGGACCTGTGGAAGGACATTGGCGTGCCGGAGGATCACATCCTGCCGGGAAACATGCGCGAC
AACTTCTGGGAGATGGGCGATCAAGGCCCCTGCGGTCCCTGCAGCGAGGTCCACTACGACAAGATCGGCGGTGGC
CGCAACGCTGCCAAGCTCGTCAACGAGGATGATCCCATGGTGGTGGAGATTTGGAACATCGTCTTCATCCAGTAC
GATAGGCAAAAGGACAAGTCGCTGAAGCCCCTGCCGGCCAAGCACGTCGACACGGGCATGGGCTACGAGCGGCTC
GTCTCGGCCCTGCAGGACACAAAGTCCAACTACGCAACCGACTGCTTCACGCCGCTCTTCGACCGCATCCAGCTC
GTCACCGGCGTCAGACCTTACTCGGACAAGTACGGGAAAGACGACGTCGACGGCATCGACACCGCCTACCGCGTC
GTCGCCGATCACATCCGCACCCTATCCTTTGCCATTGCCGACGGCGCGGTCCCCAACAACGACGGCCGGGGCTAC
GTCATCCGCCGCATCCTCCGCCGTGGCGTCCGTTACGCCCGCAAGTATCTCAATGCCGACATCGGCTCCTTCTTT
TCCAAGATCCTACCGGCCCTCATCGACCATGTGGGCGATCAGTTCCCCGAGCTGGTCAGCAAGAGAAACGACCTG
GTGGAGATTCTCGACGAGGAGGAAGAGGCCTTTTCCCGCACCCTCGATCGAGGCGAGGCTCAGTTCGAGAAGCAC
GCGGCCAAGGCGGCTGCCAAGGGCGACAAGAAGCTCGACGGCGATACCGTCTGGCGTCTGTACGACACGTTTGGT
TTCCCCGTCGACCTGACGAGGATCATGGCCGACGAGCGCGGACTCATCATCGACGACGCCGAGGTCGAAGCCGCG
CGCGAGCGGGCACGTGAAGCCAGCAAAGCCGTCAAAGACGCCGTCGACACCTTTGCCAAGCTCGACGTCCACCAA
ATCGCCGAACTGGAGCAGCATCGAGCCATCGCCCGTACTGAGGACGACGCCAAGTTCATCCGCGGCAACTGCAAG
GCAAAAGTCCAGCTCATCTTCGACGGCAAGGCCTTCCACTCCTCCACCCGACAACTCCCGCCCAACTCGCCCCTC
GGCCTCCTCCTCGATAGGACCAACTTTTACGCCGAGTCGGGCGGACAGGTGGCGGATACGGGCCGGATCGTCATC
GACGGCGTGGCAGAGTTCAAGGTGATTGACGTGCAGAACTACGGGGGTTACGTTCTGCACAGCGGCTTCATCAGC
TACGGCGCCCTCTCGGCCGGAGACGGCGTCGTCTGCGCGTACGAAGAGCTCCGTCGTGACCCCATCCGACACAAC
CACAGCGGCACCCACGTTCTCAACCACGCGCTGCGAGAGGTGCTGGGCGACGACGTCAACCAAAAGGGCTCACTG
GTAGACGACGAAAAGCTCCGCTTCGACTTCTCGCACAAGTCCCAGGTCAAGCTCGACCAGCTCCGGCGGATAGAA
GAGCTTGCAAACACCTACATCGACCGCGACGACGACGTCTTCGCCAAGGACGTGGATCTCCATCTCGCCCGTCAG
ATCAACGGCGTCCGCGCCGTCTTCGGGGAAACATACCCCAACCCTGTCCGCGTCGTCTCCCTGGGCGCCGACATC
GACGCCATGCTCGCCGACCCGTCCCTCCCCCAATGGCGGAACTACAGCGTCGAGTTCTGCGGAGGCACCCACGTC
GACCGAACCAGCAACATCAAACGCCTCGTCATCGTCGAAGAAAGCGGCATCGCAAAGGGCATCCGTCGAATAGTC
GCCTTCACCGGCGAATCCGCCCACCACGTCCAACGCGAAGCAGCCTCGTACCAGACCACCCTCGACGCCCTCGAC
GCCCTGCCCCCCGGCCCCAAGAAGGAATCCCGCGCAAGGGAAGTCTCGCAGGAGCTCAGCCAGCTCGTCGTCTCG
ACGCTCGACAAGGACGCGCTGAACCGGCGCTTCCAGAGCATCTCGGCGGGCGTCGTCGCCGAGCACAAGGCCAGG
CACAAGGCCGAGGCCAAGGCTGCGCTCGATGCGGCGCTGGCGCACTTCGCCGAGGCCGAGGGCAGGATGTGGTTT
GTTGGGAGGGTGCCCGTCGGGGCGAATGCCAAGGCTGTGGGGGAGGTGGTGCGGTATTTCCAGGGGAAGGATGGG
GAGAGGTCTGTGTATGTGCTGGCCGGGGATGGGGAGGGCGTGGTGCATGCCGTCTACGTTGGAAAGTATCTTTCG
GAGAGGGGCGTCACGGCTGAGGAGTGGGCTTCTGTTGTTACGGGTGTGGTGGGTGGAAGGTCGGGGGGTAAAGAG
CCGGTGAGGCAGGGACAGGGGACGAAGCCTGAGATGGTGGATGAGGGAGTTGAGGTGGCGGAGAGGTGGTTGCGG
GAGAAGCTGAAGCTGTGA
Transcript >Ophun1|583
ATGAGCCGCGAACCCAAGTGGCCCGCGTCTCGCGTGCGCAAGACCTTCTTCGACTTCTTCGCTCAGCGAGGCCAT
ACCATCGTCCCCTCAGGCTCCGTCGTGCCTCACAATGATGCCACGCTTCTCTTCACCAACGCGGGCATGAACCAG
TTCAAGCCCATCTTTCTCGGCACCGTCGGCCCTTCTGATCCCATGGCGGGTCTCAAGCGTGCCGCCGATTCGCAA
AAGGTGATTCGCGCGGGGGGCAAGCACAACGACCTCGACGACGTCGGCAAGGATAGCTATCATCATACCTTTTTC
GAGATGCTGGGCAACTGGTCCTTTGGAGACTACTTTAAAAAAGAGGCCATCGCCATGGCATGGGAGCTTCTCACC
CGTGTATATGGGCTTGACCCGGCTCGTCTCTACGTCACCTACTTCGAGGGCAACGCCGGTCTCGGCCTCGACCCG
GATCTCGAGGCCAGGGACCTGTGGAAGGACATTGGCGTGCCGGAGGATCACATCCTGCCGGGAAACATGCGCGAC
AACTTCTGGGAGATGGGCGATCAAGGCCCCTGCGGTCCCTGCAGCGAGGTCCACTACGACAAGATCGGCGGTGGC
CGCAACGCTGCCAAGCTCGTCAACGAGGATGATCCCATGGTGGTGGAGATTTGGAACATCGTCTTCATCCAGTAC
GATAGGCAAAAGGACAAGTCGCTGAAGCCCCTGCCGGCCAAGCACGTCGACACGGGCATGGGCTACGAGCGGCTC
GTCTCGGCCCTGCAGGACACAAAGTCCAACTACGCAACCGACTGCTTCACGCCGCTCTTCGACCGCATCCAGCTC
GTCACCGGCGTCAGACCTTACTCGGACAAGTACGGGAAAGACGACGTCGACGGCATCGACACCGCCTACCGCGTC
GTCGCCGATCACATCCGCACCCTATCCTTTGCCATTGCCGACGGCGCGGTCCCCAACAACGACGGCCGGGGCTAC
GTCATCCGCCGCATCCTCCGCCGTGGCGTCCGTTACGCCCGCAAGTATCTCAATGCCGACATCGGCTCCTTCTTT
TCCAAGATCCTACCGGCCCTCATCGACCATGTGGGCGATCAGTTCCCCGAGCTGGTCAGCAAGAGAAACGACCTG
GTGGAGATTCTCGACGAGGAGGAAGAGGCCTTTTCCCGCACCCTCGATCGAGGCGAGGCTCAGTTCGAGAAGCAC
GCGGCCAAGGCGGCTGCCAAGGGCGACAAGAAGCTCGACGGCGATACCGTCTGGCGTCTGTACGACACGTTTGGT
TTCCCCGTCGACCTGACGAGGATCATGGCCGACGAGCGCGGACTCATCATCGACGACGCCGAGGTCGAAGCCGCG
CGCGAGCGGGCACGTGAAGCCAGCAAAGCCGTCAAAGACGCCGTCGACACCTTTGCCAAGCTCGACGTCCACCAA
ATCGCCGAACTGGAGCAGCATCGAGCCATCGCCCGTACTGAGGACGACGCCAAGTTCATCCGCGGCAACTGCAAG
GCAAAAGTCCAGCTCATCTTCGACGGCAAGGCCTTCCACTCCTCCACCCGACAACTCCCGCCCAACTCGCCCCTC
GGCCTCCTCCTCGATAGGACCAACTTTTACGCCGAGTCGGGCGGACAGGTGGCGGATACGGGCCGGATCGTCATC
GACGGCGTGGCAGAGTTCAAGGTGATTGACGTGCAGAACTACGGGGGTTACGTTCTGCACAGCGGCTTCATCAGC
TACGGCGCCCTCTCGGCCGGAGACGGCGTCGTCTGCGCGTACGAAGAGCTCCGTCGTGACCCCATCCGACACAAC
CACAGCGGCACCCACGTTCTCAACCACGCGCTGCGAGAGGTGCTGGGCGACGACGTCAACCAAAAGGGCTCACTG
GTAGACGACGAAAAGCTCCGCTTCGACTTCTCGCACAAGTCCCAGGTCAAGCTCGACCAGCTCCGGCGGATAGAA
GAGCTTGCAAACACCTACATCGACCGCGACGACGACGTCTTCGCCAAGGACGTGGATCTCCATCTCGCCCGTCAG
ATCAACGGCGTCCGCGCCGTCTTCGGGGAAACATACCCCAACCCTGTCCGCGTCGTCTCCCTGGGCGCCGACATC
GACGCCATGCTCGCCGACCCGTCCCTCCCCCAATGGCGGAACTACAGCGTCGAGTTCTGCGGAGGCACCCACGTC
GACCGAACCAGCAACATCAAACGCCTCGTCATCGTCGAAGAAAGCGGCATCGCAAAGGGCATCCGTCGAATAGTC
GCCTTCACCGGCGAATCCGCCCACCACGTCCAACGCGAAGCAGCCTCGTACCAGACCACCCTCGACGCCCTCGAC
GCCCTGCCCCCCGGCCCCAAGAAGGAATCCCGCGCAAGGGAAGTCTCGCAGGAGCTCAGCCAGCTCGTCGTCTCG
ACGCTCGACAAGGACGCGCTGAACCGGCGCTTCCAGAGCATCTCGGCGGGCGTCGTCGCCGAGCACAAGGCCAGG
CACAAGGCCGAGGCCAAGGCTGCGCTCGATGCGGCGCTGGCGCACTTCGCCGAGGCCGAGGGCAGGATGTGGTTT
GTTGGGAGGGTGCCCGTCGGGGCGAATGCCAAGGCTGTGGGGGAGGTGGTGCGGTATTTCCAGGGGAAGGATGGG
GAGAGGTCTGTGTATGTGCTGGCCGGGGATGGGGAGGGCGTGGTGCATGCCGTCTACGTTGGAAAGTATCTTTCG
GAGAGGGGCGTCACGGCTGAGGAGTGGGCTTCTGTTGTTACGGGTGTGGTGGGTGGAAGGTCGGGGGGTAAAGAG
CCGGTGAGGCAGGGACAGGGGACGAAGCCTGAGATGGTGGATGAGGGAGTTGAGGTGGCGGAGAGGTGGTTGCGG
GAGAAGCTGAAGCTGTGA
Gene >Ophun1|583
ATGAGCCGCGAACCCAAGTGGCCCGCGTCTCGCGTGCGCAAGACCTTCTTCGACTTCTTCGCTCAGCGAGGCCAT
ACCATCGTCCCCTCAGGCTCCGTCGTGCCTCACAATGATGCCACGCTTCTCTTCACCAACGCGGGCATGAACCAG
TTCAAGCCCATCTTTCTCGGCACCGTCGGCCCTTCTGATCCCATGGCGGGTCTCAAGCGTGCCGCCGATTCGCAA
AAGGTGATTCGCGCGGGGGGCAAGCACAACGACCTCGACGACGTCGGCAAGGATAGCTATCATCATACCTTTTTC
GAGATGCTGGGCAACTGGTCCTTTGGAGACTACTTTAAAAAAGAGGCCATCGCCATGGCATGGGAGCTTCTCACC
CGTGTATATGGGCTTGACCCGGCTCGTCTCTACGTCACCTACTTCGAGGGCAACGCCGGTCTCGGCCTCGACCCG
GATCTCGAGGCCAGGGACCTGTGGAAGGACATTGGCGTGCCGGAGGATCACATCCTGCCGGGAAACATGCGCGAC
AACTTCTGGGAGATGGGCGATCAAGGCCCCTGCGGTCCCTGCAGCGAGGTCCACTACGACAAGATCGGCGGTGGC
CGCAACGCTGCCAAGCTCGTCAACGAGGATGATCCCATGGTGGTGGAGATTTGGAACATCGTCTTCATCCAGTAC
GATAGGCAAAAGGACAAGTCGCTGAAGCCCCTGCCGGCCAAGCACGTCGACACGGGCATGGGCTACGAGCGGCTC
GTCTCGGCCCTGCAGGACACAAAGTCCAACTACGCAACCGACTGCTTCACGCCGCTCTTCGACCGCATCCAGCTC
GTCACCGGCGTCAGACCTTACTCGGACAAGTACGGGAAAGACGACGTCGACGGCATCGACACCGCCTACCGCGTC
GTCGCCGATCACATCCGCACCCTATCCTTTGCCATTGCCGACGGCGCGGTCCCCAACAACGACGGCCGGGGCTAC
GTCATCCGCCGCATCCTCCGCCGTGGCGTCCGTTACGCCCGCAAGTATCTCAATGCCGACATCGGCTCCTTCTTT
TCCAAGATCCTACCGGCCCTCATCGACCATGTGGGCGATCAGTTCCCCGAGCTGGTCAGCAAGAGAAACGACCTG
GTGGAGATTCTCGACGAGGAGGAAGAGGCCTTTTCCCGCACCCTCGATCGAGGCGAGGCTCAGTTCGAGAAGCAC
GCGGCCAAGGCGGCTGCCAAGGGCGACAAGAAGCTCGACGGCGATACCGTCTGGCGTCTGTACGACACGTTTGGT
TTCCCCGTCGACCTGACGAGGATCATGGCCGACGAGCGCGGACTCATCATCGACGACGCCGAGGTCGAAGCCGCG
CGCGAGCGGGCACGTGAAGCCAGCAAAGCCGTCAAAGACGCCGTCGACACCTTTGCCAAGCTCGACGTCCACCAA
ATCGCCGAACTGGAGCAGCATCGAGCCATCGCCCGTACTGAGGACGACGCCAAGTTCATCCGCGGCAACTGCAAG
GCAAAAGTCCAGCTCATCTTCGACGGCAAGGCCTTCCACTCCTCCACCCGACAACTCCCGCCCAACTCGCCCCTC
GGCCTCCTCCTCGATAGGACCAACTTTTACGCCGAGTCGGGCGGACAGGTGGCGGATACGGGCCGGATCGTCATC
GACGGCGTGGCAGAGTTCAAGGTGATTGACGTGCAGAACTACGGGGGTTACGTTCTGCACAGCGGCTTCATCAGC
TACGGCGCCCTCTCGGCCGGAGACGGCGTCGTCTGCGCGTACGAAGAGCTCCGTCGTGACCCCATCCGACACAAC
CACAGCGGCACCCACGTTCTCAACCACGCGCTGCGAGAGGTGCTGGGCGACGACGTCAACCAAAAGGGCTCACTG
GTAGACGACGAAAAGCTCCGCTTCGACTTCTCGCACAAGTCCCAGGTCAAGCTCGACCAGCTCCGGCGGATAGAA
GAGCTTGCAAACACCTACATCGACCGCGACGACGACGTCTTCGCCAAGGACGTGGATCTCCATCTCGCCCGTCAG
ATCAACGGCGTCCGCGCCGTCTTCGGGGAAACATACCCCAACCCTGTCCGCGTCGTCTCCCTGGGCGCCGACATC
GACGCCATGCTCGCCGACCCGTCCCTCCCCCAATGGCGGAACTACAGCGTCGAGTTCTGCGGAGGCACCCACGTC
GACCGAACCAGCAACATCAAACGCCTCGTCATCGTCGAAGAAAGCGGCATCGCAAAGGGCATCCGTCGAATAGTC
GCCTTCACCGGCGAATCCGCCCACCACGTCCAACGCGAAGCAGCCTCGTACCAGACCACCCTCGACGCCCTCGAC
GCCCTGCCCCCCGGCCCCAAGAAGGAATCCCGCGCAAGGGAAGTCTCGCAGGAGCTCAGCCAGCTCGTCGTCTCG
ACGCTCGACAAGGACGCGCTGAACCGGCGCTTCCAGAGCATCTCGGCGGGCGTCGTCGCCGAGCACAAGGCCAGG
CACAAGGCCGAGGCCAAGGCTGCGCTCGATGCGGCGCTGGCGCACTTCGCCGAGGCCGAGGGCAGGATGTGGTTT
GTTGGGAGGGTGCCCGTCGGGGCGAATGCCAAGGCTGTGGGGGAGGTGGTGCGGTATTTCCAGGGGAAGGATGGG
GAGAGGTCTGTGTATGTGCTGGCCGGGGATGGGGAGGGCGTGGTGCATGCCGTCTACGTTGGAAAGGTGAGTCTT
GTTCTTCTTCTTCTTCTTCTTCTGTCTTTGCTACGAGTTGCACAGCTGACGGGAGCAGTATCTTTCGGAGAGGGG
CGTCACGGCTGAGGAGTGGGCTTCTGTTGTTACGGGTGTGGTGGGTGGAAGGTCGGGGGGTAAAGAGCCGGTGAG
GCAGGGACAGGGGACGAAGCCTGAGATGGTGGATGAGGGAGTTGAGGTGGCGGAGAGGTGGTTGCGGGAGAAGCT
GAAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail