Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|583
Gene name
LocationContig_118:30345..33280
Strand-
Gene length (bp)2935
Transcript length (bp)2868
Coding sequence length (bp)2868
Protein length (aa) 956

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01411 tRNA-synt_2c tRNA synthetases class II (A) 7.6E-206 12 591
PF07973 tRNA_SAD Threonyl and Alanyl tRNA synthetase second additional domain 1.5E-16 691 750
PF02272 DHHA1 DHHA1 domain 4.4E-09 825 949

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AQL1|SYA_EMENI Alanine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ala1 PE=3 SV=2 1 955 0.0E+00
sp|Q5A8K2|SYA_CANAL Alanine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALA1 PE=1 SV=1 7 953 0.0E+00
sp|P40825|SYA_YEAST Alanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALA1 PE=1 SV=3 6 955 0.0E+00
sp|O13914|SYA_SCHPO Alanine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ala1 PE=1 SV=1 7 955 0.0E+00
sp|P49588|SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=AARS PE=1 SV=2 9 953 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AQL1|SYA_EMENI Alanine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ala1 PE=3 SV=2 1 955 0.0E+00
sp|Q5A8K2|SYA_CANAL Alanine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALA1 PE=1 SV=1 7 953 0.0E+00
sp|P40825|SYA_YEAST Alanine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALA1 PE=1 SV=3 6 955 0.0E+00
sp|O13914|SYA_SCHPO Alanine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ala1 PE=1 SV=1 7 955 0.0E+00
sp|P49588|SYAC_HUMAN Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=AARS PE=1 SV=2 9 953 0.0E+00
sp|P36428|SYA_ARATH Alanine--tRNA ligase OS=Arabidopsis thaliana GN=ALATS PE=1 SV=3 4 953 0.0E+00
sp|Q5RC02|SYAC_PONAB Alanine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=AARS PE=2 SV=1 9 953 0.0E+00
sp|O01541|SYAC_CAEEL Alanine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=aars-2 PE=2 SV=1 9 948 0.0E+00
sp|Q9VLM8|SYAC_DROME Alanine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster GN=Aats-ala PE=2 SV=1 9 953 0.0E+00
sp|Q8BGQ7|SYAC_MOUSE Alanine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Aars PE=1 SV=1 9 953 0.0E+00
sp|P50475|SYAC_RAT Alanine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Aars PE=1 SV=3 9 953 0.0E+00
sp|Q8CFX8|SYAC_MESAU Alanine--tRNA ligase, cytoplasmic OS=Mesocricetus auratus GN=Aars PE=2 SV=1 9 953 0.0E+00
sp|P21894|SYAC_BOMMO Alanine--tRNA ligase, cytoplasmic OS=Bombyx mori PE=1 SV=1 10 953 0.0E+00
sp|Q54Y20|SYAC_DICDI Alanine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=alaS PE=2 SV=1 9 948 0.0E+00
sp|Q5JTZ9|SYAM_HUMAN Alanine--tRNA ligase, mitochondrial OS=Homo sapiens GN=AARS2 PE=1 SV=1 16 953 0.0E+00
sp|Q14CH7|SYAM_MOUSE Alanine--tRNA ligase, mitochondrial OS=Mus musculus GN=Aars2 PE=1 SV=1 1 932 0.0E+00
sp|Q11V49|SYA_CYTH3 Alanine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=alaS PE=3 SV=1 9 924 0.0E+00
sp|D3ZX08|SYAM_RAT Alanine--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Aars2 PE=3 SV=1 1 932 0.0E+00
sp|Q7MV54|SYA_PORGI Alanine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=alaS PE=3 SV=1 9 754 0.0E+00
sp|A8ANQ1|SYA_CITK8 Alanine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|B0TK15|SYA_SHEHH Alanine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|A4WDQ6|SYA_ENT38 Alanine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A8FSV6|SYA_SHESH Alanine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q5LHE6|SYA_BACFN Alanine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=alaS PE=3 SV=1 9 943 0.0E+00
sp|Q64YB4|SYA_BACFR Alanine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=alaS PE=3 SV=1 9 777 0.0E+00
sp|B1KPS5|SYA_SHEWM Alanine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q31X62|SYA_SHIBS Alanine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|P00957|SYA_ECOLI Alanine--tRNA ligase OS=Escherichia coli (strain K12) GN=alaS PE=1 SV=2 10 954 0.0E+00
sp|B1XCM5|SYA_ECODH Alanine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A8A3H4|SYA_ECOHS Alanine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|B1LQ15|SYA_ECOSM Alanine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q0TEI3|SYA_ECOL5 Alanine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|B1IUY2|SYA_ECOLC Alanine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q32CN1|SYA_SHIDS Alanine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A3QC89|SYA_SHELP Alanine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q1R804|SYA_ECOUT Alanine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A1AEN7|SYA_ECOK1 Alanine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q3YYG6|SYA_SHISS Alanine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A7ZQC5|SYA_ECO24 Alanine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|B2U049|SYA_SHIB3 Alanine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q8X3W8|SYA_ECO57 Alanine--tRNA ligase OS=Escherichia coli O157:H7 GN=alaS PE=3 SV=2 10 954 0.0E+00
sp|Q15RG5|SYA_PSEA6 Alanine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|A9N0C1|SYA_SALPB Alanine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q8ZMK6|SYA_SALTY Alanine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q7UBU3|SYA_SHIFL Alanine--tRNA ligase OS=Shigella flexneri GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q0T1C3|SYA_SHIF8 Alanine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q8Z4D5|SYA_SALTI Alanine--tRNA ligase OS=Salmonella typhi GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q57KU6|SYA_SALCH Alanine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|Q8A0M6|SYA_BACTN Alanine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=alaS PE=3 SV=1 9 777 0.0E+00
sp|A6L1L8|SYA_BACV8 Alanine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=alaS PE=3 SV=1 9 777 0.0E+00
sp|B2UKT4|SYA_AKKM8 Alanine--tRNA ligase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=alaS PE=3 SV=1 9 763 0.0E+00
sp|Q5PF17|SYA_SALPA Alanine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A1S4E9|SYA_SHEAM Alanine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=alaS PE=3 SV=2 12 757 0.0E+00
sp|A9MFZ1|SYA_SALAR Alanine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=alaS PE=3 SV=2 10 954 0.0E+00
sp|Q3ILF3|SYA_PSEHT Alanine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=alaS PE=3 SV=1 10 954 0.0E+00
sp|A8H1T6|SYA_SHEPA Alanine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q6LMU3|SYA_PHOPR Alanine--tRNA ligase OS=Photobacterium profundum GN=alaS PE=3 SV=2 12 953 0.0E+00
sp|A7MJ41|SYA_CROS8 Alanine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A6LEZ8|SYA_PARD8 Alanine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=alaS PE=3 SV=1 9 759 0.0E+00
sp|A0KPG1|SYA_AERHH Alanine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A8GA09|SYA_SERP5 Alanine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=alaS PE=3 SV=2 9 953 0.0E+00
sp|Q7N7A5|SYA_PHOLL Alanine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|A3N018|SYA_ACTP2 Alanine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q8DC49|SYA_VIBVU Alanine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q7MHR6|SYA_VIBVY Alanine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|A6TCV9|SYA_KLEP7 Alanine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A9KYF8|SYA_SHEB9 Alanine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=alaS PE=3 SV=1 10 757 0.0E+00
sp|B0BNS8|SYA_ACTPJ Alanine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q65VQ5|SYA_MANSM Alanine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q5ZUJ9|SYA_LEGPH Alanine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=alaS PE=3 SV=1 9 886 0.0E+00
sp|A5ICV6|SYA_LEGPC Alanine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=alaS PE=3 SV=1 9 886 0.0E+00
sp|Q8EBS1|SYA_SHEON Alanine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|A0KU94|SYA_SHESA Alanine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q7VLK0|SYA_HAEDU Alanine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|A1RHG5|SYA_SHESW Alanine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=alaS PE=3 SV=2 10 953 0.0E+00
sp|A4Y931|SYA_SHEPC Alanine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=alaS PE=3 SV=2 10 953 0.0E+00
sp|Q0HXF8|SYA_SHESR Alanine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q0HL60|SYA_SHESM Alanine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|B3H177|SYA_ACTP7 Alanine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q87LR3|SYA_VIBPA Alanine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=alaS PE=3 SV=1 12 953 0.0E+00
sp|Q02I63|SYA_PSEAB Alanine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|A6WR16|SYA_SHEB8 Alanine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=alaS PE=3 SV=1 10 757 0.0E+00
sp|Q9I553|SYA_PSEAE Alanine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=alaS PE=3 SV=1 9 953 0.0E+00
sp|Q085Z9|SYA_SHEFN Alanine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|A4SS99|SYA_AERS4 Alanine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=alaS PE=3 SV=1 10 953 0.0E+00
sp|Q31F91|SYA_THICR Alanine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=alaS PE=3 SV=1 9 949 0.0E+00
sp|A3D783|SYA_SHEB5 Alanine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=alaS PE=3 SV=1 10 757 0.0E+00
sp|Q1LQ59|SYA_CUPMC Alanine--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=alaS PE=3 SV=2 10 953 1.0E-180
sp|A1T001|SYA_PSYIN Alanine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=alaS PE=3 SV=1 9 763 2.0E-180
sp|A0LXX3|SYA_GRAFK Alanine--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=alaS PE=3 SV=1 12 832 3.0E-180
sp|A6VA71|SYA_PSEA7 Alanine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=alaS PE=3 SV=1 9 953 5.0E-180
sp|Q5E7G5|SYA_VIBF1 Alanine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=alaS PE=3 SV=1 12 953 7.0E-180
sp|Q12PX7|SYA_SHEDO Alanine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=alaS PE=3 SV=1 10 797 7.0E-180
sp|A4XWE2|SYA_PSEMY Alanine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=alaS PE=3 SV=2 9 797 9.0E-180
sp|Q5X4B7|SYA_LEGPA Alanine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=alaS PE=3 SV=1 9 877 1.0E-179
sp|B1YNJ6|SYA_BURA4 Alanine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=alaS PE=3 SV=1 9 953 1.0E-179
sp|A7MYT5|SYA_VIBCB Alanine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=alaS PE=3 SV=1 12 953 3.0E-179
sp|Q39HB7|SYA_BURL3 Alanine--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=alaS PE=3 SV=2 9 953 3.0E-179
sp|Q0BG79|SYA_BURCM Alanine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=alaS PE=3 SV=1 9 953 4.0E-179
sp|Q8KG04|SYA_CHLTE Alanine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=alaS PE=3 SV=1 12 757 4.0E-179
sp|Q5WVQ2|SYA_LEGPL Alanine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=alaS PE=3 SV=1 9 877 4.0E-179
sp|Q474F4|SYA_CUPPJ Alanine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=alaS PE=3 SV=1 10 953 4.0E-179
sp|A6VKD6|SYA_ACTSZ Alanine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=alaS PE=3 SV=1 9 953 4.0E-179
sp|Q885J0|SYA_PSESM Alanine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=alaS PE=3 SV=1 9 945 9.0E-179
sp|A0K6N4|SYA_BURCH Alanine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=alaS PE=3 SV=2 9 953 1.0E-178
sp|B1K026|SYA_BURCC Alanine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=alaS PE=3 SV=1 9 953 3.0E-178
sp|Q1BX19|SYA_BURCA Alanine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=alaS PE=3 SV=2 9 953 7.0E-178
sp|A1WXK5|SYA_HALHL Alanine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=alaS PE=3 SV=1 9 953 8.0E-178
sp|Q56648|SYA_VIBCH Alanine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=alaS PE=3 SV=2 12 953 1.0E-177
sp|Q5GYM8|SYA_XANOR Alanine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=alaS PE=3 SV=1 1 953 2.0E-177
sp|B2SUD0|SYA_XANOP Alanine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=alaS PE=3 SV=1 1 953 2.0E-177
sp|Q2P1N1|SYA_XANOM Alanine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=alaS PE=3 SV=1 1 953 2.0E-177
sp|Q4ZQI4|SYA_PSEU2 Alanine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=alaS PE=3 SV=2 9 757 2.0E-177
sp|A5F9B7|SYA_VIBC3 Alanine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=alaS PE=3 SV=1 12 953 2.0E-177
sp|Q5QUV7|SYA_IDILO Alanine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=alaS PE=3 SV=1 9 953 3.0E-177
sp|Q88EI8|SYA_PSEPK Alanine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=alaS PE=3 SV=1 9 754 5.0E-177
sp|P61698|SYA_BDEBA Alanine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=alaS PE=3 SV=1 9 767 5.0E-177
sp|Q1I6Z8|SYA_PSEE4 Alanine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=alaS PE=3 SV=1 9 754 6.0E-177
sp|A5UDR0|SYA_HAEIE Alanine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=alaS PE=3 SV=1 9 953 7.0E-177
sp|A5FIP9|SYA_FLAJ1 Alanine--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=alaS PE=3 SV=1 12 774 7.0E-177
sp|B2SZN0|SYA_BURPP Alanine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=alaS PE=3 SV=1 9 953 7.0E-177
sp|Q2KY72|SYA_BORA1 Alanine--tRNA ligase OS=Bordetella avium (strain 197N) GN=alaS PE=3 SV=1 9 953 8.0E-177
sp|P57933|SYA_PASMU Alanine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=alaS PE=3 SV=1 10 953 1.0E-176
sp|A4VJB3|SYA_PSEU5 Alanine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=alaS PE=3 SV=2 9 797 2.0E-176
sp|Q13W97|SYA_BURXL Alanine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=alaS PE=3 SV=1 9 953 2.0E-176
sp|B1M0N0|SYA_METRJ Alanine--tRNA ligase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=alaS PE=3 SV=1 10 788 2.0E-176
sp|Q4QM86|SYA_HAEI8 Alanine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=alaS PE=3 SV=1 9 953 2.0E-176
sp|Q3K892|SYA_PSEPF Alanine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=alaS PE=3 SV=1 9 754 3.0E-176
sp|Q1D084|SYA_MYXXD Alanine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=alaS PE=3 SV=1 9 799 3.0E-176
sp|A4JDM9|SYA_BURVG Alanine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=alaS PE=3 SV=1 9 953 3.0E-176
sp|B0KR43|SYA_PSEPG Alanine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=alaS PE=3 SV=2 9 754 4.0E-176
sp|A5W0D9|SYA_PSEP1 Alanine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=alaS PE=3 SV=2 9 754 4.0E-176
sp|Q4K843|SYA_PSEF5 Alanine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=alaS PE=3 SV=1 9 754 6.0E-176
sp|B2JK72|SYA_BURP8 Alanine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=alaS PE=3 SV=1 9 953 7.0E-176
sp|Q48G25|SYA_PSE14 Alanine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=alaS PE=3 SV=1 9 754 9.0E-176
sp|A5UHW6|SYA_HAEIG Alanine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=alaS PE=3 SV=1 9 953 1.0E-175
sp|A4SGJ6|SYA_CHLPM Alanine--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=alaS PE=3 SV=2 9 802 1.0E-175
sp|Q39Z77|SYA_GEOMG Alanine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=alaS PE=3 SV=1 9 942 2.0E-175
sp|Q8PLQ0|SYA_XANAC Alanine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=alaS PE=3 SV=1 1 953 4.0E-175
sp|B1JCG9|SYA_PSEPW Alanine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=alaS PE=3 SV=2 9 754 5.0E-175
sp|A6H0Y3|SYA_FLAPJ Alanine--tRNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=alaS PE=3 SV=1 9 815 6.0E-175
sp|Q1GHA1|SYA_RUEST Alanine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=alaS PE=3 SV=2 12 804 6.0E-175
sp|A1JK09|SYA_YERE8 Alanine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=alaS PE=3 SV=1 10 953 9.0E-175
sp|A1BD33|SYA_CHLPD Alanine--tRNA ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=alaS PE=3 SV=1 12 757 1.0E-174
sp|Q0I426|SYA_HAES1 Alanine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=alaS PE=3 SV=1 9 953 1.0E-174
sp|A1W7D0|SYA_ACISJ Alanine--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=alaS PE=3 SV=1 5 953 2.0E-174
sp|Q3BUQ7|SYA_XANC5 Alanine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=alaS PE=3 SV=1 1 953 2.0E-174
sp|B0VAI3|SYA_ACIBY Alanine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=alaS PE=3 SV=1 9 952 3.0E-174
sp|A3M3W2|SYA_ACIBT Alanine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=alaS PE=3 SV=2 9 952 3.0E-174
sp|B2HWK7|SYA_ACIBC Alanine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=alaS PE=3 SV=2 9 952 3.0E-174
sp|P43815|SYA_HAEIN Alanine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=alaS PE=3 SV=1 9 953 3.0E-174
sp|Q487H5|SYA_COLP3 Alanine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=alaS PE=3 SV=1 9 953 6.0E-174
sp|Q21L68|SYA_SACD2 Alanine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=alaS PE=3 SV=1 9 760 8.0E-174
sp|Q3JCK8|SYA_NITOC Alanine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=alaS PE=3 SV=1 9 953 9.0E-174
sp|Q7WHL6|SYA_BORBR Alanine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=alaS PE=3 SV=1 9 797 1.0E-173
sp|Q7VXE1|SYA_BORPE Alanine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=alaS PE=3 SV=1 9 797 1.0E-173
sp|Q1QA88|SYA_PSYCK Alanine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=alaS PE=3 SV=1 12 953 2.0E-173
sp|Q82TF8|SYA_NITEU Alanine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=alaS PE=3 SV=1 9 953 2.0E-173
sp|B0RTY1|SYA_XANCB Alanine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=alaS PE=3 SV=1 1 953 2.0E-173
sp|Q4UTR6|SYA_XANC8 Alanine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=alaS PE=3 SV=1 1 953 2.0E-173
sp|A1ATU9|SYA_PELPD Alanine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=alaS PE=3 SV=1 10 935 3.0E-173
sp|Q6MB06|SYA_PARUW Alanine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=alaS PE=3 SV=1 12 955 3.0E-173
sp|A1TZ92|SYA_MARHV Alanine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=alaS PE=3 SV=1 9 953 4.0E-173
sp|A9AC16|SYA_BURM1 Alanine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=alaS PE=3 SV=1 9 953 4.0E-173
sp|Q6D1T0|SYA_PECAS Alanine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=alaS PE=3 SV=1 9 953 4.0E-173
sp|Q8P9X0|SYA_XANCP Alanine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=alaS PE=3 SV=1 1 953 4.0E-173
sp|Q56273|SYA_ACIFR Alanine--tRNA ligase OS=Acidithiobacillus ferrooxidans GN=alaS PE=3 SV=1 9 953 4.0E-173
sp|Q7W6N4|SYA_BORPA Alanine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=alaS PE=3 SV=1 9 797 7.0E-173
sp|Q1QMV7|SYA_NITHX Alanine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=alaS PE=3 SV=2 12 779 1.0E-172
sp|Q28QV8|SYA_JANSC Alanine--tRNA ligase OS=Jannaschia sp. (strain CCS1) GN=alaS PE=3 SV=1 12 825 1.0E-172
sp|A5WFW1|SYA_PSYWF Alanine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=alaS PE=3 SV=1 12 771 2.0E-172
sp|A9C0B9|SYA_DELAS Alanine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=alaS PE=3 SV=1 5 953 2.0E-172
sp|B0UTE1|SYA_HISS2 Alanine--tRNA ligase OS=Histophilus somni (strain 2336) GN=alaS PE=3 SV=1 9 953 3.0E-172
sp|A6W1F1|SYA_MARMS Alanine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=alaS PE=3 SV=1 9 953 4.0E-172
sp|B0TFY7|SYA_HELMI Alanine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=alaS PE=3 SV=1 6 803 4.0E-172
sp|Q3ST43|SYA_NITWN Alanine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=alaS PE=3 SV=1 12 799 8.0E-172
sp|B2FL33|SYA_STRMK Alanine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=alaS PE=3 SV=1 1 757 1.0E-171
sp|A7FLR7|SYA_YERP3 Alanine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=alaS PE=3 SV=1 9 757 1.0E-171
sp|B1JJA0|SYA_YERPY Alanine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=alaS PE=3 SV=1 9 757 1.0E-171
sp|Q66E68|SYA_YERPS Alanine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=alaS PE=3 SV=1 9 757 1.0E-171
sp|B2K5X9|SYA_YERPB Alanine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=alaS PE=3 SV=1 9 757 1.0E-171
sp|A6U9N4|SYA_SINMW Alanine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=alaS PE=3 SV=1 10 757 1.0E-171
sp|Q3ATN3|SYA_CHLCH Alanine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=alaS PE=3 SV=1 12 760 1.0E-171
sp|B2IHX3|SYA_BEII9 Alanine--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=alaS PE=3 SV=2 10 798 2.0E-171
sp|B1ZZ40|SYA_OPITP Alanine--tRNA ligase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=alaS PE=3 SV=1 9 828 2.0E-171
sp|A4TQ52|SYA_YERPP Alanine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=alaS PE=3 SV=1 9 757 3.0E-171
sp|Q1CLK9|SYA_YERPN Alanine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=alaS PE=3 SV=1 9 757 3.0E-171
sp|A9R0V7|SYA_YERPG Alanine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=alaS PE=3 SV=1 9 757 3.0E-171
sp|Q8ZBT8|SYA_YERPE Alanine--tRNA ligase OS=Yersinia pestis GN=alaS PE=3 SV=1 9 757 3.0E-171
sp|Q2S2B6|SYA_SALRD Alanine--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=alaS PE=3 SV=1 2 763 3.0E-171
sp|Q6FCT2|SYA_ACIAD Alanine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=alaS PE=3 SV=1 9 951 7.0E-171
sp|P61701|SYA_GEOSL Alanine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=alaS PE=3 SV=1 12 942 8.0E-171
sp|Q218Q3|SYA_RHOPB Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=alaS PE=3 SV=1 10 776 8.0E-171
sp|A5GD98|SYA_GEOUR Alanine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=alaS PE=3 SV=1 12 949 1.0E-170
sp|Q4FRQ0|SYA_PSYA2 Alanine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=alaS PE=3 SV=1 12 757 2.0E-170
sp|Q2SV73|SYA_BURTA Alanine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=alaS PE=3 SV=1 9 953 2.0E-170
sp|B0SZN4|SYA_CAUSK Alanine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=alaS PE=3 SV=1 10 757 2.0E-170
sp|Q0K823|SYA_CUPNH Alanine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=alaS PE=3 SV=1 10 953 2.0E-170
sp|Q2NVL2|SYA_SODGM Alanine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=alaS PE=3 SV=1 10 797 4.0E-170
sp|Q07R87|SYA_RHOP5 Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=alaS PE=3 SV=2 10 759 4.0E-170
sp|Q2ITM9|SYA_RHOP2 Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain HaA2) GN=alaS PE=3 SV=1 12 799 5.0E-170
sp|A5EML9|SYA_BRASB Alanine--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=alaS PE=3 SV=1 10 776 6.0E-170
sp|Q2SBT9|SYA_HAHCH Alanine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=alaS PE=3 SV=1 9 953 9.0E-170
sp|Q13AB9|SYA_RHOPS Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=alaS PE=3 SV=1 10 759 1.0E-169
sp|B1ZC90|SYA_METPB Alanine--tRNA ligase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=alaS PE=3 SV=1 10 798 2.0E-169
sp|A4SZL8|SYA_POLSQ Alanine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=alaS PE=3 SV=1 10 759 5.0E-169
sp|Q1H3U9|SYA_METFK Alanine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=alaS PE=3 SV=1 9 954 5.0E-169
sp|Q7NXM2|SYA_CHRVO Alanine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=alaS PE=3 SV=1 10 953 7.0E-169
sp|A4YXQ6|SYA_BRASO Alanine--tRNA ligase OS=Bradyrhizobium sp. (strain ORS278) GN=alaS PE=3 SV=1 10 799 1.0E-168
sp|Q9A5C1|SYA_CAUCR Alanine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=alaS PE=3 SV=1 10 757 2.0E-168
sp|Q0VNK2|SYA_ALCBS Alanine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=alaS PE=3 SV=2 9 951 2.0E-168
sp|P61706|SYA_RHOPA Alanine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=alaS PE=3 SV=1 10 799 5.0E-168
sp|Q2YD40|SYA_NITMU Alanine--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=alaS PE=3 SV=1 9 953 5.0E-168
sp|A0L3J9|SYA_MAGMM Alanine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=alaS PE=3 SV=1 10 953 6.0E-168
sp|A5VQX4|SYA_BRUO2 Alanine--tRNA ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|P67009|SYA_BRUSU Alanine--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|B0CGZ9|SYA_BRUSI Alanine--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|P67008|SYA_BRUME Alanine--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|A9M5L7|SYA_BRUC2 Alanine--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|Q57CU0|SYA_BRUAB Alanine--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|Q2YRU8|SYA_BRUA2 Alanine--tRNA ligase OS=Brucella abortus (strain 2308) GN=alaS PE=3 SV=1 10 786 8.0E-168
sp|A3N8K7|SYA_BURP6 Alanine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=alaS PE=3 SV=1 9 953 1.0E-167
sp|P27866|SYA_RHIME Alanine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=alaS PE=3 SV=2 10 779 1.0E-167
sp|Q62KZ3|SYA_BURMA Alanine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=alaS PE=3 SV=1 9 953 2.0E-167
sp|Q165U5|SYA_ROSDO Alanine--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=alaS PE=3 SV=1 12 797 3.0E-167
sp|Q63TF9|SYA_BURPS Alanine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|Q3JT87|SYA_BURP1 Alanine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A3NUB0|SYA_BURP0 Alanine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A1V3F2|SYA_BURMS Alanine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A2S3D4|SYA_BURM9 Alanine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A3MJ36|SYA_BURM7 Alanine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=alaS PE=3 SV=1 9 953 4.0E-167
sp|A9FRF5|SYA_SORC5 Alanine--tRNA ligase OS=Sorangium cellulosum (strain So ce56) GN=alaS PE=3 SV=1 8 942 4.0E-167
sp|Q9PH22|SYA_XYLFA Alanine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=alaS PE=3 SV=2 1 954 4.0E-167
sp|A9IVY8|SYA_BART1 Alanine--tRNA ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=alaS PE=3 SV=1 10 757 1.0E-166
sp|A9W5Y4|SYA_METEP Alanine--tRNA ligase OS=Methylobacterium extorquens (strain PA1) GN=alaS PE=3 SV=1 10 798 1.0E-166
sp|A7HWA5|SYA_PARL1 Alanine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=alaS PE=3 SV=2 10 766 1.0E-166
sp|Q3B1I7|SYA_CHLL7 Alanine--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=alaS PE=3 SV=1 12 757 1.0E-166
sp|A9IK31|SYA_BORPD Alanine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=alaS PE=3 SV=1 9 757 2.0E-166
sp|Q0AHX2|SYA_NITEC Alanine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=alaS PE=3 SV=1 9 953 3.0E-166
sp|Q6AQ16|SYA_DESPS Alanine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=alaS PE=3 SV=1 10 830 5.0E-166
sp|Q0AQY6|SYA_MARMM Alanine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=alaS PE=3 SV=1 12 778 8.0E-166
sp|A9B660|SYA_HERA2 Alanine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=alaS PE=3 SV=1 10 867 9.0E-166
sp|A9NCN7|SYA_COXBR Alanine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=alaS PE=3 SV=1 9 954 1.0E-165
sp|B0UGC4|SYA_METS4 Alanine--tRNA ligase OS=Methylobacterium sp. (strain 4-46) GN=alaS PE=3 SV=1 12 796 1.0E-165
sp|A7HH87|SYA_ANADF Alanine--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=alaS PE=3 SV=1 9 942 1.0E-165
sp|Q83CQ6|SYA_COXBU Alanine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=alaS PE=3 SV=1 9 954 1.0E-165
sp|A9KG28|SYA_COXBN Alanine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=alaS PE=3 SV=1 9 954 1.0E-165
sp|A6X0E9|SYA_OCHA4 Alanine--tRNA ligase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=alaS PE=3 SV=1 10 757 2.0E-165
sp|Q0AZQ1|SYA_SYNWW Alanine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=alaS PE=3 SV=1 7 822 2.0E-165
sp|Q8UE87|SYA_AGRFC Alanine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=alaS PE=3 SV=2 10 757 2.0E-165
sp|Q1C420|SYA_YERPA Alanine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=alaS PE=3 SV=1 9 757 6.0E-165
sp|B0TZY8|SYA_FRAP2 Alanine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=alaS PE=3 SV=1 11 954 6.0E-165
sp|A5EW88|SYA_DICNV Alanine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=alaS PE=3 SV=1 10 798 8.0E-165
sp|Q221G2|SYA_RHOFT Alanine--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=alaS PE=3 SV=1 8 953 8.0E-165
sp|Q89I89|SYA_BRADU Alanine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=alaS PE=3 SV=2 10 774 2.0E-164
sp|Q87F43|SYA_XYLFT Alanine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=alaS PE=3 SV=1 1 763 2.0E-164
sp|B2I6K2|SYA_XYLF2 Alanine--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=alaS PE=3 SV=1 1 763 2.0E-164
sp|A8LL20|SYA_DINSH Alanine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=alaS PE=3 SV=1 10 757 3.0E-164
sp|Q0A8K7|SYA_ALKEH Alanine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=alaS PE=3 SV=1 9 955 3.0E-164
sp|Q60BS6|SYA_METCA Alanine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=alaS PE=3 SV=1 9 954 4.0E-164
sp|Q01XA0|SYA_SOLUE Alanine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=alaS PE=3 SV=1 12 942 4.0E-164
sp|A8ICW8|SYA_AZOC5 Alanine--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=alaS PE=3 SV=1 10 774 4.0E-164
sp|Q129G8|SYA_POLSJ Alanine--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=alaS PE=3 SV=1 2 952 8.0E-164
sp|A1AXE0|SYA_RUTMC Alanine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=alaS PE=3 SV=1 9 938 1.0E-163
sp|B0U1K9|SYA_XYLFM Alanine--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=alaS PE=3 SV=1 1 953 1.0E-163
sp|Q11IW3|SYA_CHESB Alanine--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=alaS PE=3 SV=2 12 796 2.0E-163
sp|A4G2S9|SYA_HERAR Alanine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=alaS PE=3 SV=1 9 952 2.0E-163
sp|A5UY81|SYA_ROSS1 Alanine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=alaS PE=3 SV=2 6 943 3.0E-163
sp|Q8Y193|SYA_RALSO Alanine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=alaS PE=3 SV=1 9 953 7.0E-163
sp|Q2W1D9|SYA_MAGSA Alanine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=alaS PE=3 SV=1 9 754 8.0E-163
sp|Q4FMX6|SYA_PELUB Alanine--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=alaS PE=3 SV=1 10 827 1.0E-162
sp|Q30YS5|SYA_DESAG Alanine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=alaS PE=3 SV=1 9 951 1.0E-162
sp|A0LLA3|SYA_SYNFM Alanine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=alaS PE=3 SV=1 9 953 2.0E-162
sp|A4WV47|SYA_RHOS5 Alanine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=alaS PE=3 SV=1 12 797 3.0E-162
sp|Q1MFZ9|SYA_RHIL3 Alanine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=alaS PE=3 SV=1 12 780 3.0E-162
sp|Q2IG40|SYA_ANADE Alanine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=alaS PE=3 SV=1 9 946 3.0E-162
sp|Q5F7C4|SYA_NEIG1 Alanine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=alaS PE=3 SV=1 10 953 3.0E-162
sp|A9M198|SYA_NEIM0 Alanine--tRNA ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=alaS PE=3 SV=2 10 953 4.0E-162
sp|Q9JTG4|SYA_NEIMA Alanine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=alaS PE=3 SV=1 10 953 6.0E-162
sp|Q1LTQ4|SYA_BAUCH Alanine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=alaS PE=3 SV=1 8 757 6.0E-162
sp|B3E044|SYA_METI4 Alanine--tRNA ligase OS=Methylacidiphilum infernorum (isolate V4) GN=alaS PE=3 SV=1 9 930 1.0E-161
sp|A1WIG8|SYA_VEREI Alanine--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=alaS PE=3 SV=1 5 953 2.0E-161
sp|A1KV20|SYA_NEIMF Alanine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=alaS PE=3 SV=1 10 953 2.0E-161
sp|A6SVH6|SYA_JANMA Alanine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=alaS PE=3 SV=1 9 757 3.0E-161
sp|Q3A1W0|SYA_PELCD Alanine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=alaS PE=3 SV=2 10 953 3.0E-161
sp|A0Q604|SYA_FRATN Alanine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=alaS PE=3 SV=1 12 954 4.0E-161
sp|A1AZL6|SYA_PARDP Alanine--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=alaS PE=3 SV=1 12 952 6.0E-161
sp|Q1QZX1|SYA_CHRSD Alanine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=alaS PE=3 SV=1 12 953 2.0E-160
sp|Q2LPL7|SYA_SYNAS Alanine--tRNA ligase OS=Syntrophus aciditrophicus (strain SB) GN=alaS PE=3 SV=1 10 949 3.0E-160
sp|Q65GS5|SYA_BACLD Alanine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=alaS PE=3 SV=1 9 953 3.0E-160
sp|A2SI90|SYA_METPP Alanine--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=alaS PE=3 SV=1 9 757 3.0E-160
sp|A7NQA5|SYA_ROSCS Alanine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=alaS PE=3 SV=1 6 943 4.0E-160
sp|Q98NQ5|SYA_RHILO Alanine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=alaS PE=3 SV=1 10 757 4.0E-160
sp|Q6G2Z4|SYA_BARHE Alanine--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=alaS PE=3 SV=1 12 774 4.0E-160
sp|A1VQK2|SYA_POLNA Alanine--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=alaS PE=3 SV=1 5 778 6.0E-160
sp|O67323|SYA_AQUAE Alanine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=alaS PE=1 SV=1 9 813 9.0E-160
sp|Q5FQ21|SYA_GLUOX Alanine--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=alaS PE=3 SV=1 12 778 2.0E-159
sp|Q3SLA9|SYA_THIDA Alanine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=alaS PE=3 SV=2 9 953 2.0E-159
sp|Q2N9K5|SYA_ERYLH Alanine--tRNA ligase OS=Erythrobacter litoralis (strain HTCC2594) GN=alaS PE=3 SV=1 12 765 2.0E-159
sp|Q2G8V0|SYA_NOVAD Alanine--tRNA ligase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=alaS PE=3 SV=1 10 769 3.0E-159
sp|A4IZ01|SYA_FRATW Alanine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=alaS PE=3 SV=1 12 954 4.0E-159
sp|Q0BYM3|SYA_HYPNA Alanine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=alaS PE=3 SV=1 12 757 6.0E-159
sp|Q47AU8|SYA_DECAR Alanine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=alaS PE=3 SV=1 9 953 7.0E-159
sp|Q5NFW7|SYA_FRATT Alanine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=alaS PE=3 SV=1 12 954 8.0E-159
sp|Q14HB9|SYA_FRAT1 Alanine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=alaS PE=3 SV=1 12 954 8.0E-159
sp|Q0BLS9|SYA_FRATO Alanine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=alaS PE=3 SV=1 12 954 1.0E-158
sp|Q2A3A9|SYA_FRATH Alanine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=alaS PE=3 SV=1 12 954 1.0E-158
sp|A7NCD9|SYA_FRATF Alanine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=alaS PE=3 SV=1 12 954 1.0E-158
sp|Q5LRU1|SYA_RUEPO Alanine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=alaS PE=3 SV=1 12 805 1.0E-158
sp|Q2K7T4|SYA_RHIEC Alanine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=alaS PE=3 SV=2 12 779 1.0E-158
sp|A3PLJ1|SYA_RHOS1 Alanine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=alaS PE=3 SV=1 12 757 1.0E-158
sp|Q3J0R1|SYA_RHOS4 Alanine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=alaS PE=3 SV=1 12 757 2.0E-158
sp|A9WCR2|SYA_CHLAA Alanine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=alaS PE=3 SV=1 6 803 2.0E-158
sp|Q67MV8|SYA_SYMTH Alanine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=alaS PE=3 SV=1 9 814 4.0E-158
sp|Q9JYG6|SYA_NEIMB Alanine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=alaS PE=3 SV=1 10 953 5.0E-158
sp|Q92BK9|SYA_LISIN Alanine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=alaS PE=3 SV=1 9 952 6.0E-158
sp|Q0BSD5|SYA_GRABC Alanine--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=alaS PE=3 SV=2 12 867 7.0E-158
sp|B2SH99|SYA_FRATM Alanine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=alaS PE=3 SV=1 12 954 7.0E-158
sp|A5FXC2|SYA_ACICJ Alanine--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=alaS PE=3 SV=1 12 754 8.0E-158
sp|A7IMR0|SYA_XANP2 Alanine--tRNA ligase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=alaS PE=3 SV=1 10 757 2.0E-157
sp|Q9XDM3|SYA_AQUPY Alanine--tRNA ligase OS=Aquifex pyrophilus GN=alaS PE=3 SV=1 7 757 4.0E-157
sp|Q5P7Q3|SYA_AROAE Alanine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=alaS PE=3 SV=1 9 953 4.0E-157
sp|B1Y1G9|SYA_LEPCP Alanine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=alaS PE=3 SV=1 9 797 6.0E-157
sp|A1USS4|SYA_BARBK Alanine--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=alaS PE=3 SV=1 10 757 8.0E-157
sp|B2V709|SYA_SULSY Alanine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=alaS PE=3 SV=1 9 920 1.0E-156
sp|A1K991|SYA_AZOSB Alanine--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=alaS PE=3 SV=1 9 953 1.0E-156
sp|Q493M6|SYA_BLOPB Alanine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=alaS PE=3 SV=1 12 757 1.0E-156
sp|P70865|SYA_BARBA Alanine--tRNA ligase OS=Bartonella bacilliformis GN=alaS PE=3 SV=1 10 757 7.0E-156
sp|Q6FZF1|SYA_BARQU Alanine--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=alaS PE=3 SV=1 12 757 8.0E-156
sp|Q9RNN8|SYA_ZYMMO Alanine--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=alaS PE=3 SV=2 10 757 1.0E-155
sp|A7GT67|SYA_BACCN Alanine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=alaS PE=3 SV=1 10 950 6.0E-155
sp|Q81LK0|SYA_BACAN Alanine--tRNA ligase OS=Bacillus anthracis GN=alaS PE=3 SV=1 10 817 9.0E-155
sp|A5CVU0|SYA_VESOH Alanine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=alaS PE=3 SV=1 9 938 1.0E-154
sp|Q817Z0|SYA_BACCR Alanine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=alaS PE=3 SV=1 10 817 3.0E-154
sp|Q634F6|SYA_BACCZ Alanine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=alaS PE=3 SV=1 10 817 4.0E-154
sp|A0RJ00|SYA_BACAH Alanine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=alaS PE=3 SV=1 10 817 5.0E-154
sp|P61697|SYA_BACC1 Alanine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=alaS PE=3 SV=1 10 817 6.0E-154
sp|A9VI09|SYA_BACWK Alanine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=alaS PE=3 SV=1 10 817 7.0E-154
sp|Q2GJ36|SYA_ANAPZ Alanine--tRNA ligase OS=Anaplasma phagocytophilum (strain HZ) GN=alaS PE=3 SV=1 10 806 7.0E-154
sp|Q6HDD7|SYA_BACHK Alanine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=alaS PE=3 SV=1 10 817 1.0E-153
sp|Q2RQI0|SYA_RHORT Alanine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=alaS PE=3 SV=1 10 761 1.0E-153
sp|A1VEQ6|SYA_DESVV Alanine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=alaS PE=3 SV=1 9 939 4.0E-153
sp|Q255X6|SYA_CHLFF Alanine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=alaS PE=3 SV=1 9 953 4.0E-153
sp|A8GQ73|SYA_RICAH Alanine--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=alaS PE=3 SV=1 5 803 4.0E-153
sp|O84754|SYA_CHLTR Alanine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=alaS PE=3 SV=2 9 953 6.0E-153
sp|Q3KKU4|SYA_CHLTA Alanine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=alaS PE=3 SV=1 9 953 6.0E-153
sp|A0AIV3|SYA_LISW6 Alanine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=alaS PE=3 SV=1 9 798 1.0E-152
sp|Q9KDE6|SYA_BACHD Alanine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=alaS PE=3 SV=1 9 757 1.0E-152
sp|Q2RHZ3|SYA_MOOTA Alanine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=alaS PE=3 SV=1 10 942 1.0E-152
sp|P61700|SYA_DESVH Alanine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=alaS PE=3 SV=1 9 939 1.0E-152
sp|A7Z735|SYA_BACMF Alanine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=alaS PE=3 SV=1 9 953 1.0E-152
sp|Q02XE9|SYA_LACLS Alanine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=alaS PE=3 SV=1 9 807 3.0E-152
sp|Q9Z714|SYA_CHLPN Alanine--tRNA ligase OS=Chlamydia pneumoniae GN=alaS PE=3 SV=1 9 953 3.0E-152
sp|Q8K9E7|SYA_BUCAP Alanine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=alaS PE=3 SV=1 6 757 5.0E-152
sp|Q4UJT5|SYA_RICFE Alanine--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=alaS PE=3 SV=1 6 803 5.0E-152
sp|P67011|SYA_STAAN Alanine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=alaS PE=1 SV=1 6 950 9.0E-152
sp|P67010|SYA_STAAM Alanine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=alaS PE=3 SV=1 6 950 9.0E-152
sp|A5ITE3|SYA_STAA9 Alanine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=alaS PE=3 SV=1 6 950 9.0E-152
sp|A6U287|SYA_STAA2 Alanine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=alaS PE=3 SV=1 6 950 9.0E-152
sp|A7X328|SYA_STAA1 Alanine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=alaS PE=3 SV=1 6 950 9.0E-152
sp|B0BAK4|SYA_CHLTB Alanine--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=alaS PE=3 SV=1 9 953 1.0E-151
sp|B0B8X5|SYA_CHLT2 Alanine--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=alaS PE=3 SV=1 9 953 1.0E-151
sp|Q5GSS5|SYA_WOLTR Alanine--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=alaS PE=3 SV=1 10 922 1.0E-151
sp|Q8NW87|SYA_STAAW Alanine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=alaS PE=3 SV=1 6 950 2.0E-151
sp|Q6G8V1|SYA_STAAS Alanine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=alaS PE=3 SV=1 6 950 2.0E-151
sp|Q5L512|SYA_CHLAB Alanine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=alaS PE=3 SV=1 9 953 2.0E-151
sp|P61709|SYA_WOLPM Alanine--tRNA ligase OS=Wolbachia pipientis wMel GN=alaS PE=3 SV=1 10 793 2.0E-151
sp|A8F323|SYA_RICM5 Alanine--tRNA ligase OS=Rickettsia massiliae (strain Mtu5) GN=alaS PE=3 SV=2 5 803 2.0E-151
sp|Q1GSD9|SYA_SPHAL Alanine--tRNA ligase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=alaS PE=3 SV=1 12 757 2.0E-151
sp|Q6GG85|SYA_STAAR Alanine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=alaS PE=3 SV=1 6 950 2.0E-151
sp|A4J2K4|SYA_DESRM Alanine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=alaS PE=3 SV=1 12 954 2.0E-151
sp|A5V3L0|SYA_SPHWW Alanine--tRNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=alaS PE=3 SV=1 12 776 3.0E-151
sp|Q71ZG6|SYA_LISMF Alanine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=alaS PE=3 SV=1 9 952 3.0E-151
sp|A6QHF9|SYA_STAAE Alanine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=alaS PE=3 SV=1 6 950 3.0E-151
sp|Q5HFE4|SYA_STAAC Alanine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=alaS PE=3 SV=1 6 950 3.0E-151
sp|Q2FXV9|SYA_STAA8 Alanine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=alaS PE=3 SV=1 6 950 3.0E-151
sp|Q2FGA8|SYA_STAA3 Alanine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=alaS PE=3 SV=1 6 950 3.0E-151
sp|A2RME6|SYA_LACLM Alanine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=alaS PE=3 SV=1 9 807 4.0E-151
sp|Q821R2|SYA_CHLCV Alanine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=alaS PE=3 SV=1 9 953 4.0E-151
sp|A8Z4F6|SYA_STAAT Alanine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=alaS PE=3 SV=1 6 950 4.0E-151
sp|Q8Y722|SYA_LISMO Alanine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=alaS PE=3 SV=1 9 952 6.0E-151
sp|A8GU16|SYA_RICRS Alanine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=alaS PE=3 SV=1 5 803 6.0E-151
sp|B0BVK9|SYA_RICRO Alanine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=alaS PE=3 SV=1 5 803 6.0E-151
sp|Q835J8|SYA_ENTFA Alanine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=alaS PE=3 SV=1 9 763 6.0E-151
sp|O34526|SYA_BACSU Alanine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=alaS PE=3 SV=1 9 953 9.0E-151
sp|Q92G00|SYA_RICCN Alanine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=alaS PE=3 SV=1 5 803 1.0E-150
sp|Q9CEW0|SYA_LACLA Alanine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=alaS PE=3 SV=1 9 807 1.0E-150
sp|A6Q576|SYA_NITSB Alanine--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=alaS PE=3 SV=1 12 757 1.0E-150
sp|Q2YT60|SYA_STAAB Alanine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=alaS PE=3 SV=1 6 950 2.0E-150
sp|Q5PBJ0|SYA_ANAMM Alanine--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=alaS PE=3 SV=1 10 756 3.0E-150
sp|A5D3F4|SYA_PELTS Alanine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=alaS PE=3 SV=2 10 757 3.0E-150
sp|A6Q747|SYA_SULNB Alanine--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=alaS PE=3 SV=1 12 757 4.0E-150
sp|A0RPR0|SYA_CAMFF Alanine--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=alaS PE=3 SV=1 12 763 8.0E-150
sp|Q2JTG8|SYA_SYNJA Alanine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=alaS PE=3 SV=1 5 953 2.0E-149
sp|Q8RFJ8|SYA_FUSNN Alanine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=alaS PE=3 SV=1 9 932 2.0E-149
sp|A8F078|SYA_RICCK Alanine--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=alaS PE=3 SV=1 5 814 3.0E-149
sp|Q8CSA7|SYA_STAES Alanine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=alaS PE=3 SV=1 6 950 3.0E-149
sp|Q5HNT2|SYA_STAEQ Alanine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=alaS PE=3 SV=1 6 950 3.0E-149
sp|Q7VQG3|SYA_BLOFL Alanine--tRNA ligase OS=Blochmannia floridanus GN=alaS PE=3 SV=1 12 760 3.0E-149
sp|Q827S4|SYA_STRAW Alanine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=alaS PE=3 SV=1 9 954 6.0E-149
sp|Q03ER8|SYA_PEDPA Alanine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=alaS PE=3 SV=1 9 952 1.0E-148
sp|Q9ZCA4|SYA_RICPR Alanine--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=alaS PE=3 SV=1 5 803 2.0E-148
sp|A8FFM9|SYA_BACP2 Alanine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=alaS PE=3 SV=1 9 758 4.0E-148
sp|Q9PLH5|SYA_CHLMU Alanine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=alaS PE=3 SV=1 9 953 1.0E-147
sp|Q1MP42|SYA_LAWIP Alanine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=alaS PE=3 SV=1 12 952 2.0E-147
sp|Q4L6W5|SYA_STAHJ Alanine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=alaS PE=3 SV=1 9 951 4.0E-147
sp|A4IR80|SYA_GEOTN Alanine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=alaS PE=3 SV=2 6 829 4.0E-147
sp|Q03R43|SYA_LACBA Alanine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=alaS PE=3 SV=1 9 952 4.0E-147
sp|B1W3I1|SYA_STRGG Alanine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=alaS PE=3 SV=1 9 951 6.0E-147
sp|A8ZY67|SYA_DESOH Alanine--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=alaS PE=3 SV=1 10 757 9.0E-147
sp|Q7VHV4|SYA_HELHP Alanine--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=alaS PE=3 SV=1 12 904 3.0E-146
sp|Q49Y56|SYA_STAS1 Alanine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=alaS PE=3 SV=1 9 950 5.0E-146
sp|Q68VQ7|SYA_RICTY Alanine--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=alaS PE=3 SV=1 5 803 1.0E-145
sp|Q2JLC4|SYA_SYNJB Alanine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=alaS PE=3 SV=1 5 953 2.0E-145
sp|Q7V3N0|SYA_PROMP Alanine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=alaS PE=3 SV=1 12 953 4.0E-145
sp|Q045P6|SYA_LACGA Alanine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=alaS PE=3 SV=1 9 797 8.0E-145
sp|B1I370|SYA_DESAP Alanine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=alaS PE=3 SV=1 9 835 9.0E-145
sp|Q1RKG2|SYA_RICBR Alanine--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=alaS PE=3 SV=1 6 803 9.0E-145
sp|Q5KWU5|SYA_GEOKA Alanine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=alaS PE=3 SV=1 6 815 2.0E-144
sp|A3DKB6|SYA_CLOTH Alanine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=alaS PE=3 SV=1 6 803 3.0E-144
sp|B1HUK4|SYA_LYSSC Alanine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=alaS PE=3 SV=2 9 763 4.0E-144
sp|P61702|SYA_LACJO Alanine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=alaS PE=3 SV=1 9 797 5.0E-144
sp|Q9KXP9|SYA_STRCO Alanine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=alaS PE=3 SV=1 9 954 9.0E-144
sp|A9BJE0|SYA_PETMO Alanine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=alaS PE=3 SV=1 7 806 1.0E-143
sp|A5FSU1|SYA_DEHMB Alanine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=alaS PE=3 SV=1 7 808 1.0E-143
sp|Q30PA9|SYA_SULDN Alanine--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=alaS PE=3 SV=2 12 794 1.0E-143
sp|A5N7T5|SYA_CLOK5 Alanine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=alaS PE=3 SV=1 6 767 2.0E-143
sp|A7GZA4|SYA_CAMC5 Alanine--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=alaS PE=3 SV=1 12 797 2.0E-143
sp|B1YJE5|SYA_EXIS2 Alanine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=alaS PE=3 SV=1 10 760 2.0E-143
sp|Q5WHM8|SYA_BACSK Alanine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=alaS PE=3 SV=1 6 797 3.0E-143
sp|Q9FFC7|SYAP_ARATH Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=EMB86 PE=1 SV=2 12 756 4.0E-143
sp|Q1CS22|SYA_HELPH Alanine--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=alaS PE=3 SV=1 12 884 5.0E-143
sp|A8EWI6|SYA_ARCB4 Alanine--tRNA ligase OS=Arcobacter butzleri (strain RM4018) GN=alaS PE=3 SV=1 12 773 5.0E-143
sp|Q3ZWC3|SYA_DEHMC Alanine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=alaS PE=3 SV=1 7 808 7.0E-143
sp|Q88V10|SYA_LACPL Alanine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=alaS PE=3 SV=1 6 819 1.0E-142
sp|B0SPT4|SYA_LEPBP Alanine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=alaS PE=3 SV=1 12 953 1.0E-142
sp|B0SGD3|SYA_LEPBA Alanine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=alaS PE=3 SV=1 12 953 1.0E-142
sp|Q23122|SYAM_CAEEL Alanine--tRNA ligase, mitochondrial OS=Caenorhabditis elegans GN=aars-1 PE=1 SV=2 10 787 2.0E-142
sp|Q97Q48|SYA_STRPN Alanine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=alaS PE=3 SV=1 9 797 2.0E-142
sp|Q8DPC7|SYA_STRR6 Alanine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=alaS PE=3 SV=1 9 797 3.0E-142
sp|Q04JW5|SYA_STRP2 Alanine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=alaS PE=3 SV=1 9 797 3.0E-142
sp|A8F866|SYA_PSELT Alanine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=alaS PE=3 SV=1 12 884 3.0E-142
sp|Q9ZJY5|SYA_HELPJ Alanine--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=alaS PE=3 SV=1 12 884 1.0E-141
sp|Q8DH56|SYA_THEEB Alanine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=alaS PE=3 SV=2 11 954 1.0E-141
sp|B1ICI3|SYA_STRPI Alanine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=alaS PE=3 SV=1 9 797 1.0E-141
sp|Q5M5L5|SYA_STRT2 Alanine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=alaS PE=3 SV=1 9 933 2.0E-141
sp|Q5M126|SYA_STRT1 Alanine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=alaS PE=3 SV=1 9 933 2.0E-141
sp|P57483|SYA_BUCAI Alanine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=alaS PE=3 SV=1 6 767 2.0E-141
sp|Q03LZ8|SYA_STRTD Alanine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=alaS PE=3 SV=1 9 933 2.0E-141
sp|Q7NI36|SYA_GLOVI Alanine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=alaS PE=3 SV=1 12 754 2.0E-141
sp|Q896F2|SYA_CLOTE Alanine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=alaS PE=3 SV=1 10 776 2.0E-141
sp|A0Q151|SYA_CLONN Alanine--tRNA ligase OS=Clostridium novyi (strain NT) GN=alaS PE=3 SV=1 6 757 2.0E-141
sp|Q8E600|SYA_STRA3 Alanine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=alaS PE=3 SV=1 9 795 3.0E-141
sp|B2KAQ0|SYA_ELUMP Alanine--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=alaS PE=3 SV=1 9 776 3.0E-141
sp|Q7MAD3|SYA_WOLSU Alanine--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=alaS PE=3 SV=1 12 800 3.0E-141
sp|B2IQK0|SYA_STRPS Alanine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=alaS PE=3 SV=1 9 797 4.0E-141
sp|B9HQZ6|SYAP_POPTR Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Populus trichocarpa GN=POPTRDRAFT_821063 PE=3 SV=1 12 756 6.0E-141
sp|A4VVR3|SYA_STRSY Alanine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=alaS PE=3 SV=1 9 797 7.0E-141
sp|A4W221|SYA_STRS2 Alanine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=alaS PE=3 SV=2 9 797 7.0E-141
sp|Q99Z57|SYA_STRP1 Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=alaS PE=3 SV=1 9 940 8.0E-141
sp|Q9PI05|SYA_CAMJE Alanine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=alaS PE=3 SV=1 12 757 1.0E-140
sp|Q5HVQ7|SYA_CAMJR Alanine--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=alaS PE=3 SV=1 12 757 1.0E-140
sp|Q10VG8|SYA_TRIEI Alanine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=alaS PE=3 SV=1 6 954 2.0E-140
sp|Q8CWY0|SYA_STRMU Alanine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=alaS PE=3 SV=1 9 933 2.0E-140
sp|P0DG25|SYA_STRPQ Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=alaS PE=3 SV=1 9 940 2.0E-140
sp|P0DG24|SYA_STRP3 Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=alaS PE=3 SV=1 9 940 2.0E-140
sp|Q3K1P7|SYA_STRA1 Alanine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=alaS PE=3 SV=1 9 795 2.0E-140
sp|Q1JG77|SYA_STRPD Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=alaS PE=3 SV=1 9 940 2.0E-140
sp|Q48SS4|SYA_STRPM Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=alaS PE=3 SV=1 9 940 2.0E-140
sp|A8AYI8|SYA_STRGC Alanine--tRNA ligase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=alaS PE=3 SV=1 9 943 2.0E-140
sp|Q86H43|SYAM_DICDI Alanine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=malaS PE=3 SV=1 1 757 2.0E-140
sp|Q3AEN8|SYA_CARHZ Alanine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=alaS PE=3 SV=1 9 802 3.0E-140
sp|A1VYL8|SYA_CAMJJ Alanine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=alaS PE=3 SV=1 12 757 3.0E-140
sp|A7I206|SYA_CAMHC Alanine--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=alaS PE=3 SV=1 12 868 3.0E-140
sp|Q5XBH1|SYA_STRP6 Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=alaS PE=3 SV=1 9 940 4.0E-140
sp|Q8E0C4|SYA_STRA5 Alanine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=alaS PE=3 SV=1 9 795 4.0E-140
sp|A8FKT2|SYA_CAMJ8 Alanine--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=alaS PE=3 SV=1 12 757 4.0E-140
sp|Q38YN9|SYA_LACSS Alanine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=alaS PE=3 SV=1 9 949 5.0E-140
sp|Q3ZAE4|SYA_DEHM1 Alanine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=alaS PE=3 SV=1 7 798 5.0E-140
sp|C5Z7K4|SYAP_SORBI Alanine--tRNA ligase, chloroplastic/mitochondrial OS=Sorghum bicolor GN=Sb10g008780 PE=3 SV=1 6 756 5.0E-140
sp|P61705|SYA_MYCPA Alanine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=alaS PE=3 SV=1 12 943 6.0E-140
sp|A0QI75|SYA_MYCA1 Alanine--tRNA ligase OS=Mycobacterium avium (strain 104) GN=alaS PE=3 SV=1 12 943 6.0E-140
sp|P56452|SYA_HELPY Alanine--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=alaS PE=3 SV=1 12 763 6.0E-140
sp|A7ZE62|SYA_CAMC1 Alanine--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=alaS PE=3 SV=1 12 762 8.0E-140
sp|Q5FLW6|SYA_LACAC Alanine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=alaS PE=3 SV=1 6 819 9.0E-140
sp|Q1JL53|SYA_STRPC Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=alaS PE=3 SV=1 9 940 1.0E-139
sp|Q1JB08|SYA_STRPB Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=alaS PE=3 SV=1 9 940 1.0E-139
sp|Q8P0E6|SYA_STRP8 Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=alaS PE=3 SV=1 9 940 1.0E-139
sp|Q5FH56|SYA_EHRRG Alanine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=alaS PE=3 SV=1 9 929 1.0E-139
sp|Q8RAH4|SYA_CALS4 Alanine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=alaS PE=3 SV=1 6 954 2.0E-139
sp|Q03B02|SYA_LACC3 Alanine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=alaS PE=3 SV=1 6 758 2.0E-139
sp|A8YTJ0|SYA_LACH4 Alanine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=alaS PE=3 SV=1 6 943 3.0E-139
sp|A2BTZ9|SYA_PROM5 Alanine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=alaS PE=3 SV=1 12 953 3.0E-139
sp|Q1AWA6|SYA_RUBXD Alanine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=alaS PE=3 SV=1 9 818 5.0E-139
sp|B1LBS9|SYA_THESQ Alanine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=alaS PE=3 SV=1 9 950 6.0E-139
sp|A2RDY3|SYA_STRPG Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=alaS PE=3 SV=1 9 940 8.0E-139
sp|Q1J5Z4|SYA_STRPF Alanine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=alaS PE=3 SV=1 9 940 8.0E-139
sp|A3CLY3|SYA_STRSV Alanine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=alaS PE=3 SV=1 9 797 1.0E-138
sp|B0JI84|SYA_MICAN Alanine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=alaS PE=3 SV=1 10 954 2.0E-138
sp|Q24UT2|SYA_DESHY Alanine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=alaS PE=3 SV=1 7 932 2.0E-138
[Show less]

GO

GO Term Description Terminal node
GO:0006419 alanyl-tRNA aminoacylation Yes
GO:0003676 nucleic acid binding Yes
GO:0000166 nucleotide binding Yes
GO:0043039 tRNA aminoacylation Yes
GO:0004813 alanine-tRNA ligase activity Yes
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0140101 catalytic activity, acting on a tRNA No
GO:0097159 organic cyclic compound binding No
GO:0043436 oxoacid metabolic process No
GO:0043038 amino acid activation No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0019752 carboxylic acid metabolic process No
GO:0006418 tRNA aminoacylation for protein translation No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0006807 nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0140098 catalytic activity, acting on RNA No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0006082 organic acid metabolic process No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1977
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2754
Ophiocordyceps australis map64 (Brazil) OphauB2|4427
Ophiocordyceps camponoti-floridani Ophcf2|03370
Ophiocordyceps camponoti-rufipedis Ophun1|583 (this protein)
Ophiocordyceps kimflemingae Ophio5|2261
Ophiocordyceps subramaniannii Hirsu2|2171

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|583
MSREPKWPASRVRKTFFDFFAQRGHTIVPSGSVVPHNDATLLFTNAGMNQFKPIFLGTVGPSDPMAGLKRAADSQ
KVIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAMAWELLTRVYGLDPARLYVTYFEGNAGLGLDP
DLEARDLWKDIGVPEDHILPGNMRDNFWEMGDQGPCGPCSEVHYDKIGGGRNAAKLVNEDDPMVVEIWNIVFIQY
DRQKDKSLKPLPAKHVDTGMGYERLVSALQDTKSNYATDCFTPLFDRIQLVTGVRPYSDKYGKDDVDGIDTAYRV
VADHIRTLSFAIADGAVPNNDGRGYVIRRILRRGVRYARKYLNADIGSFFSKILPALIDHVGDQFPELVSKRNDL
VEILDEEEEAFSRTLDRGEAQFEKHAAKAAAKGDKKLDGDTVWRLYDTFGFPVDLTRIMADERGLIIDDAEVEAA
RERAREASKAVKDAVDTFAKLDVHQIAELEQHRAIARTEDDAKFIRGNCKAKVQLIFDGKAFHSSTRQLPPNSPL
GLLLDRTNFYAESGGQVADTGRIVIDGVAEFKVIDVQNYGGYVLHSGFISYGALSAGDGVVCAYEELRRDPIRHN
HSGTHVLNHALREVLGDDVNQKGSLVDDEKLRFDFSHKSQVKLDQLRRIEELANTYIDRDDDVFAKDVDLHLARQ
INGVRAVFGETYPNPVRVVSLGADIDAMLADPSLPQWRNYSVEFCGGTHVDRTSNIKRLVIVEESGIAKGIRRIV
AFTGESAHHVQREAASYQTTLDALDALPPGPKKESRAREVSQELSQLVVSTLDKDALNRRFQSISAGVVAEHKAR
HKAEAKAALDAALAHFAEAEGRMWFVGRVPVGANAKAVGEVVRYFQGKDGERSVYVLAGDGEGVVHAVYVGKYLS
ERGVTAEEWASVVTGVVGGRSGGKEPVRQGQGTKPEMVDEGVEVAERWLREKLKL*
Coding >Ophun1|583
ATGAGCCGCGAACCCAAGTGGCCCGCGTCTCGCGTGCGCAAGACCTTCTTCGACTTCTTCGCTCAGCGAGGCCAT
ACCATCGTCCCCTCAGGCTCCGTCGTGCCTCACAATGATGCCACGCTTCTCTTCACCAACGCGGGCATGAACCAG
TTCAAGCCCATCTTTCTCGGCACCGTCGGCCCTTCTGATCCCATGGCGGGTCTCAAGCGTGCCGCCGATTCGCAA
AAGGTGATTCGCGCGGGGGGCAAGCACAACGACCTCGACGACGTCGGCAAGGATAGCTATCATCATACCTTTTTC
GAGATGCTGGGCAACTGGTCCTTTGGAGACTACTTTAAAAAAGAGGCCATCGCCATGGCATGGGAGCTTCTCACC
CGTGTATATGGGCTTGACCCGGCTCGTCTCTACGTCACCTACTTCGAGGGCAACGCCGGTCTCGGCCTCGACCCG
GATCTCGAGGCCAGGGACCTGTGGAAGGACATTGGCGTGCCGGAGGATCACATCCTGCCGGGAAACATGCGCGAC
AACTTCTGGGAGATGGGCGATCAAGGCCCCTGCGGTCCCTGCAGCGAGGTCCACTACGACAAGATCGGCGGTGGC
CGCAACGCTGCCAAGCTCGTCAACGAGGATGATCCCATGGTGGTGGAGATTTGGAACATCGTCTTCATCCAGTAC
GATAGGCAAAAGGACAAGTCGCTGAAGCCCCTGCCGGCCAAGCACGTCGACACGGGCATGGGCTACGAGCGGCTC
GTCTCGGCCCTGCAGGACACAAAGTCCAACTACGCAACCGACTGCTTCACGCCGCTCTTCGACCGCATCCAGCTC
GTCACCGGCGTCAGACCTTACTCGGACAAGTACGGGAAAGACGACGTCGACGGCATCGACACCGCCTACCGCGTC
GTCGCCGATCACATCCGCACCCTATCCTTTGCCATTGCCGACGGCGCGGTCCCCAACAACGACGGCCGGGGCTAC
GTCATCCGCCGCATCCTCCGCCGTGGCGTCCGTTACGCCCGCAAGTATCTCAATGCCGACATCGGCTCCTTCTTT
TCCAAGATCCTACCGGCCCTCATCGACCATGTGGGCGATCAGTTCCCCGAGCTGGTCAGCAAGAGAAACGACCTG
GTGGAGATTCTCGACGAGGAGGAAGAGGCCTTTTCCCGCACCCTCGATCGAGGCGAGGCTCAGTTCGAGAAGCAC
GCGGCCAAGGCGGCTGCCAAGGGCGACAAGAAGCTCGACGGCGATACCGTCTGGCGTCTGTACGACACGTTTGGT
TTCCCCGTCGACCTGACGAGGATCATGGCCGACGAGCGCGGACTCATCATCGACGACGCCGAGGTCGAAGCCGCG
CGCGAGCGGGCACGTGAAGCCAGCAAAGCCGTCAAAGACGCCGTCGACACCTTTGCCAAGCTCGACGTCCACCAA
ATCGCCGAACTGGAGCAGCATCGAGCCATCGCCCGTACTGAGGACGACGCCAAGTTCATCCGCGGCAACTGCAAG
GCAAAAGTCCAGCTCATCTTCGACGGCAAGGCCTTCCACTCCTCCACCCGACAACTCCCGCCCAACTCGCCCCTC
GGCCTCCTCCTCGATAGGACCAACTTTTACGCCGAGTCGGGCGGACAGGTGGCGGATACGGGCCGGATCGTCATC
GACGGCGTGGCAGAGTTCAAGGTGATTGACGTGCAGAACTACGGGGGTTACGTTCTGCACAGCGGCTTCATCAGC
TACGGCGCCCTCTCGGCCGGAGACGGCGTCGTCTGCGCGTACGAAGAGCTCCGTCGTGACCCCATCCGACACAAC
CACAGCGGCACCCACGTTCTCAACCACGCGCTGCGAGAGGTGCTGGGCGACGACGTCAACCAAAAGGGCTCACTG
GTAGACGACGAAAAGCTCCGCTTCGACTTCTCGCACAAGTCCCAGGTCAAGCTCGACCAGCTCCGGCGGATAGAA
GAGCTTGCAAACACCTACATCGACCGCGACGACGACGTCTTCGCCAAGGACGTGGATCTCCATCTCGCCCGTCAG
ATCAACGGCGTCCGCGCCGTCTTCGGGGAAACATACCCCAACCCTGTCCGCGTCGTCTCCCTGGGCGCCGACATC
GACGCCATGCTCGCCGACCCGTCCCTCCCCCAATGGCGGAACTACAGCGTCGAGTTCTGCGGAGGCACCCACGTC
GACCGAACCAGCAACATCAAACGCCTCGTCATCGTCGAAGAAAGCGGCATCGCAAAGGGCATCCGTCGAATAGTC
GCCTTCACCGGCGAATCCGCCCACCACGTCCAACGCGAAGCAGCCTCGTACCAGACCACCCTCGACGCCCTCGAC
GCCCTGCCCCCCGGCCCCAAGAAGGAATCCCGCGCAAGGGAAGTCTCGCAGGAGCTCAGCCAGCTCGTCGTCTCG
ACGCTCGACAAGGACGCGCTGAACCGGCGCTTCCAGAGCATCTCGGCGGGCGTCGTCGCCGAGCACAAGGCCAGG
CACAAGGCCGAGGCCAAGGCTGCGCTCGATGCGGCGCTGGCGCACTTCGCCGAGGCCGAGGGCAGGATGTGGTTT
GTTGGGAGGGTGCCCGTCGGGGCGAATGCCAAGGCTGTGGGGGAGGTGGTGCGGTATTTCCAGGGGAAGGATGGG
GAGAGGTCTGTGTATGTGCTGGCCGGGGATGGGGAGGGCGTGGTGCATGCCGTCTACGTTGGAAAGTATCTTTCG
GAGAGGGGCGTCACGGCTGAGGAGTGGGCTTCTGTTGTTACGGGTGTGGTGGGTGGAAGGTCGGGGGGTAAAGAG
CCGGTGAGGCAGGGACAGGGGACGAAGCCTGAGATGGTGGATGAGGGAGTTGAGGTGGCGGAGAGGTGGTTGCGG
GAGAAGCTGAAGCTGTGA
Transcript >Ophun1|583
ATGAGCCGCGAACCCAAGTGGCCCGCGTCTCGCGTGCGCAAGACCTTCTTCGACTTCTTCGCTCAGCGAGGCCAT
ACCATCGTCCCCTCAGGCTCCGTCGTGCCTCACAATGATGCCACGCTTCTCTTCACCAACGCGGGCATGAACCAG
TTCAAGCCCATCTTTCTCGGCACCGTCGGCCCTTCTGATCCCATGGCGGGTCTCAAGCGTGCCGCCGATTCGCAA
AAGGTGATTCGCGCGGGGGGCAAGCACAACGACCTCGACGACGTCGGCAAGGATAGCTATCATCATACCTTTTTC
GAGATGCTGGGCAACTGGTCCTTTGGAGACTACTTTAAAAAAGAGGCCATCGCCATGGCATGGGAGCTTCTCACC
CGTGTATATGGGCTTGACCCGGCTCGTCTCTACGTCACCTACTTCGAGGGCAACGCCGGTCTCGGCCTCGACCCG
GATCTCGAGGCCAGGGACCTGTGGAAGGACATTGGCGTGCCGGAGGATCACATCCTGCCGGGAAACATGCGCGAC
AACTTCTGGGAGATGGGCGATCAAGGCCCCTGCGGTCCCTGCAGCGAGGTCCACTACGACAAGATCGGCGGTGGC
CGCAACGCTGCCAAGCTCGTCAACGAGGATGATCCCATGGTGGTGGAGATTTGGAACATCGTCTTCATCCAGTAC
GATAGGCAAAAGGACAAGTCGCTGAAGCCCCTGCCGGCCAAGCACGTCGACACGGGCATGGGCTACGAGCGGCTC
GTCTCGGCCCTGCAGGACACAAAGTCCAACTACGCAACCGACTGCTTCACGCCGCTCTTCGACCGCATCCAGCTC
GTCACCGGCGTCAGACCTTACTCGGACAAGTACGGGAAAGACGACGTCGACGGCATCGACACCGCCTACCGCGTC
GTCGCCGATCACATCCGCACCCTATCCTTTGCCATTGCCGACGGCGCGGTCCCCAACAACGACGGCCGGGGCTAC
GTCATCCGCCGCATCCTCCGCCGTGGCGTCCGTTACGCCCGCAAGTATCTCAATGCCGACATCGGCTCCTTCTTT
TCCAAGATCCTACCGGCCCTCATCGACCATGTGGGCGATCAGTTCCCCGAGCTGGTCAGCAAGAGAAACGACCTG
GTGGAGATTCTCGACGAGGAGGAAGAGGCCTTTTCCCGCACCCTCGATCGAGGCGAGGCTCAGTTCGAGAAGCAC
GCGGCCAAGGCGGCTGCCAAGGGCGACAAGAAGCTCGACGGCGATACCGTCTGGCGTCTGTACGACACGTTTGGT
TTCCCCGTCGACCTGACGAGGATCATGGCCGACGAGCGCGGACTCATCATCGACGACGCCGAGGTCGAAGCCGCG
CGCGAGCGGGCACGTGAAGCCAGCAAAGCCGTCAAAGACGCCGTCGACACCTTTGCCAAGCTCGACGTCCACCAA
ATCGCCGAACTGGAGCAGCATCGAGCCATCGCCCGTACTGAGGACGACGCCAAGTTCATCCGCGGCAACTGCAAG
GCAAAAGTCCAGCTCATCTTCGACGGCAAGGCCTTCCACTCCTCCACCCGACAACTCCCGCCCAACTCGCCCCTC
GGCCTCCTCCTCGATAGGACCAACTTTTACGCCGAGTCGGGCGGACAGGTGGCGGATACGGGCCGGATCGTCATC
GACGGCGTGGCAGAGTTCAAGGTGATTGACGTGCAGAACTACGGGGGTTACGTTCTGCACAGCGGCTTCATCAGC
TACGGCGCCCTCTCGGCCGGAGACGGCGTCGTCTGCGCGTACGAAGAGCTCCGTCGTGACCCCATCCGACACAAC
CACAGCGGCACCCACGTTCTCAACCACGCGCTGCGAGAGGTGCTGGGCGACGACGTCAACCAAAAGGGCTCACTG
GTAGACGACGAAAAGCTCCGCTTCGACTTCTCGCACAAGTCCCAGGTCAAGCTCGACCAGCTCCGGCGGATAGAA
GAGCTTGCAAACACCTACATCGACCGCGACGACGACGTCTTCGCCAAGGACGTGGATCTCCATCTCGCCCGTCAG
ATCAACGGCGTCCGCGCCGTCTTCGGGGAAACATACCCCAACCCTGTCCGCGTCGTCTCCCTGGGCGCCGACATC
GACGCCATGCTCGCCGACCCGTCCCTCCCCCAATGGCGGAACTACAGCGTCGAGTTCTGCGGAGGCACCCACGTC
GACCGAACCAGCAACATCAAACGCCTCGTCATCGTCGAAGAAAGCGGCATCGCAAAGGGCATCCGTCGAATAGTC
GCCTTCACCGGCGAATCCGCCCACCACGTCCAACGCGAAGCAGCCTCGTACCAGACCACCCTCGACGCCCTCGAC
GCCCTGCCCCCCGGCCCCAAGAAGGAATCCCGCGCAAGGGAAGTCTCGCAGGAGCTCAGCCAGCTCGTCGTCTCG
ACGCTCGACAAGGACGCGCTGAACCGGCGCTTCCAGAGCATCTCGGCGGGCGTCGTCGCCGAGCACAAGGCCAGG
CACAAGGCCGAGGCCAAGGCTGCGCTCGATGCGGCGCTGGCGCACTTCGCCGAGGCCGAGGGCAGGATGTGGTTT
GTTGGGAGGGTGCCCGTCGGGGCGAATGCCAAGGCTGTGGGGGAGGTGGTGCGGTATTTCCAGGGGAAGGATGGG
GAGAGGTCTGTGTATGTGCTGGCCGGGGATGGGGAGGGCGTGGTGCATGCCGTCTACGTTGGAAAGTATCTTTCG
GAGAGGGGCGTCACGGCTGAGGAGTGGGCTTCTGTTGTTACGGGTGTGGTGGGTGGAAGGTCGGGGGGTAAAGAG
CCGGTGAGGCAGGGACAGGGGACGAAGCCTGAGATGGTGGATGAGGGAGTTGAGGTGGCGGAGAGGTGGTTGCGG
GAGAAGCTGAAGCTGTGA
Gene >Ophun1|583
ATGAGCCGCGAACCCAAGTGGCCCGCGTCTCGCGTGCGCAAGACCTTCTTCGACTTCTTCGCTCAGCGAGGCCAT
ACCATCGTCCCCTCAGGCTCCGTCGTGCCTCACAATGATGCCACGCTTCTCTTCACCAACGCGGGCATGAACCAG
TTCAAGCCCATCTTTCTCGGCACCGTCGGCCCTTCTGATCCCATGGCGGGTCTCAAGCGTGCCGCCGATTCGCAA
AAGGTGATTCGCGCGGGGGGCAAGCACAACGACCTCGACGACGTCGGCAAGGATAGCTATCATCATACCTTTTTC
GAGATGCTGGGCAACTGGTCCTTTGGAGACTACTTTAAAAAAGAGGCCATCGCCATGGCATGGGAGCTTCTCACC
CGTGTATATGGGCTTGACCCGGCTCGTCTCTACGTCACCTACTTCGAGGGCAACGCCGGTCTCGGCCTCGACCCG
GATCTCGAGGCCAGGGACCTGTGGAAGGACATTGGCGTGCCGGAGGATCACATCCTGCCGGGAAACATGCGCGAC
AACTTCTGGGAGATGGGCGATCAAGGCCCCTGCGGTCCCTGCAGCGAGGTCCACTACGACAAGATCGGCGGTGGC
CGCAACGCTGCCAAGCTCGTCAACGAGGATGATCCCATGGTGGTGGAGATTTGGAACATCGTCTTCATCCAGTAC
GATAGGCAAAAGGACAAGTCGCTGAAGCCCCTGCCGGCCAAGCACGTCGACACGGGCATGGGCTACGAGCGGCTC
GTCTCGGCCCTGCAGGACACAAAGTCCAACTACGCAACCGACTGCTTCACGCCGCTCTTCGACCGCATCCAGCTC
GTCACCGGCGTCAGACCTTACTCGGACAAGTACGGGAAAGACGACGTCGACGGCATCGACACCGCCTACCGCGTC
GTCGCCGATCACATCCGCACCCTATCCTTTGCCATTGCCGACGGCGCGGTCCCCAACAACGACGGCCGGGGCTAC
GTCATCCGCCGCATCCTCCGCCGTGGCGTCCGTTACGCCCGCAAGTATCTCAATGCCGACATCGGCTCCTTCTTT
TCCAAGATCCTACCGGCCCTCATCGACCATGTGGGCGATCAGTTCCCCGAGCTGGTCAGCAAGAGAAACGACCTG
GTGGAGATTCTCGACGAGGAGGAAGAGGCCTTTTCCCGCACCCTCGATCGAGGCGAGGCTCAGTTCGAGAAGCAC
GCGGCCAAGGCGGCTGCCAAGGGCGACAAGAAGCTCGACGGCGATACCGTCTGGCGTCTGTACGACACGTTTGGT
TTCCCCGTCGACCTGACGAGGATCATGGCCGACGAGCGCGGACTCATCATCGACGACGCCGAGGTCGAAGCCGCG
CGCGAGCGGGCACGTGAAGCCAGCAAAGCCGTCAAAGACGCCGTCGACACCTTTGCCAAGCTCGACGTCCACCAA
ATCGCCGAACTGGAGCAGCATCGAGCCATCGCCCGTACTGAGGACGACGCCAAGTTCATCCGCGGCAACTGCAAG
GCAAAAGTCCAGCTCATCTTCGACGGCAAGGCCTTCCACTCCTCCACCCGACAACTCCCGCCCAACTCGCCCCTC
GGCCTCCTCCTCGATAGGACCAACTTTTACGCCGAGTCGGGCGGACAGGTGGCGGATACGGGCCGGATCGTCATC
GACGGCGTGGCAGAGTTCAAGGTGATTGACGTGCAGAACTACGGGGGTTACGTTCTGCACAGCGGCTTCATCAGC
TACGGCGCCCTCTCGGCCGGAGACGGCGTCGTCTGCGCGTACGAAGAGCTCCGTCGTGACCCCATCCGACACAAC
CACAGCGGCACCCACGTTCTCAACCACGCGCTGCGAGAGGTGCTGGGCGACGACGTCAACCAAAAGGGCTCACTG
GTAGACGACGAAAAGCTCCGCTTCGACTTCTCGCACAAGTCCCAGGTCAAGCTCGACCAGCTCCGGCGGATAGAA
GAGCTTGCAAACACCTACATCGACCGCGACGACGACGTCTTCGCCAAGGACGTGGATCTCCATCTCGCCCGTCAG
ATCAACGGCGTCCGCGCCGTCTTCGGGGAAACATACCCCAACCCTGTCCGCGTCGTCTCCCTGGGCGCCGACATC
GACGCCATGCTCGCCGACCCGTCCCTCCCCCAATGGCGGAACTACAGCGTCGAGTTCTGCGGAGGCACCCACGTC
GACCGAACCAGCAACATCAAACGCCTCGTCATCGTCGAAGAAAGCGGCATCGCAAAGGGCATCCGTCGAATAGTC
GCCTTCACCGGCGAATCCGCCCACCACGTCCAACGCGAAGCAGCCTCGTACCAGACCACCCTCGACGCCCTCGAC
GCCCTGCCCCCCGGCCCCAAGAAGGAATCCCGCGCAAGGGAAGTCTCGCAGGAGCTCAGCCAGCTCGTCGTCTCG
ACGCTCGACAAGGACGCGCTGAACCGGCGCTTCCAGAGCATCTCGGCGGGCGTCGTCGCCGAGCACAAGGCCAGG
CACAAGGCCGAGGCCAAGGCTGCGCTCGATGCGGCGCTGGCGCACTTCGCCGAGGCCGAGGGCAGGATGTGGTTT
GTTGGGAGGGTGCCCGTCGGGGCGAATGCCAAGGCTGTGGGGGAGGTGGTGCGGTATTTCCAGGGGAAGGATGGG
GAGAGGTCTGTGTATGTGCTGGCCGGGGATGGGGAGGGCGTGGTGCATGCCGTCTACGTTGGAAAGGTGAGTCTT
GTTCTTCTTCTTCTTCTTCTTCTGTCTTTGCTACGAGTTGCACAGCTGACGGGAGCAGTATCTTTCGGAGAGGGG
CGTCACGGCTGAGGAGTGGGCTTCTGTTGTTACGGGTGTGGTGGGTGGAAGGTCGGGGGGTAAAGAGCCGGTGAG
GCAGGGACAGGGGACGAAGCCTGAGATGGTGGATGAGGGAGTTGAGGTGGCGGAGAGGTGGTTGCGGGAGAAGCT
GAAGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail