Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5827
Gene name
LocationContig_6:48386..49040
Strand+
Gene length (bp)654
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.1E-13 3 168
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 6.5E-09 4 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 25 153 2.0E-09
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 23 184 2.0E-09
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 25 153 3.0E-09
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 25 153 3.0E-09
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 25 153 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 25 153 2.0E-09
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 23 184 2.0E-09
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 25 153 3.0E-09
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 25 153 3.0E-09
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 25 153 3.0E-09
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 25 153 3.0E-09
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 25 153 3.0E-09
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 30 153 6.0E-09
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 32 153 7.0E-09
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 24 175 7.0E-09
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 32 153 7.0E-09
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 24 153 1.0E-08
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 24 153 1.0E-08
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 24 153 1.0E-08
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 23 153 1.0E-08
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 25 153 2.0E-08
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 25 153 2.0E-08
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 30 174 3.0E-08
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 24 215 3.0E-08
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 30 174 3.0E-08
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 25 153 3.0E-08
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 32 153 3.0E-08
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 25 153 3.0E-08
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 15 187 4.0E-08
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 15 187 4.0E-08
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 13 191 6.0E-08
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 24 153 7.0E-08
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 30 174 8.0E-08
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 30 174 1.0E-07
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 30 174 1.0E-07
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 15 170 2.0E-07
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 15 171 2.0E-07
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 40 174 2.0E-07
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 26 175 2.0E-07
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 24 174 3.0E-07
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 15 187 3.0E-07
sp|Q54C18|Y9452_DICDI Probable serine/threonine-protein kinase DDB_G0293276 OS=Dictyostelium discoideum GN=DDB_G0293276 PE=3 SV=1 25 211 5.0E-07
sp|P83104|M3K7L_DROME Putative mitogen-activated protein kinase kinase kinase 7-like OS=Drosophila melanogaster GN=Takl1 PE=2 SV=1 30 172 8.0E-07
sp|P18161|SPLB_DICDI Dual specificity protein kinase splB OS=Dictyostelium discoideum GN=splB PE=2 SV=2 29 192 1.0E-06
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 77 176 2.0E-06
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 24 175 2.0E-06
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 25 175 2.0E-06
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 25 175 3.0E-06
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 1 174 4.0E-06
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 40 174 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5827
MRVEAQAYERLKDAPHVPRLIEWDAESCCLTLEHMQNGNLLYYLRNENIFLNPVVNYVSHQLRRRWVVEAARALA
VVHAADITHCDFVPRKLLLDEQLHLYISGFAGSSVSGSSTLFCAGSRYLPPGWDCRAGSVASDDVFALGSVMYFI
MTGTEVYADLEEDKAEELIQRAEFPVVDQIACGSVIQACWDGTISTAQGAVDAFKGLEWEVDDEKVC*
Coding >Ophun1|5827
ATGCGAGTCGAGGCACAGGCCTACGAGCGACTCAAGGATGCTCCGCACGTTCCAAGACTTATCGAATGGGATGCC
GAGTCCTGCTGCTTGACGTTGGAGCACATGCAGAACGGGAACCTCTTGTATTATCTGAGGAACGAAAACATCTTT
CTCAACCCCGTCGTCAATTATGTTTCCCACCAACTTCGTCGACGGTGGGTCGTCGAGGCGGCGAGAGCCCTGGCT
GTCGTTCATGCGGCCGACATCACTCACTGCGATTTCGTGCCTCGCAAATTGTTGTTGGACGAACAGCTGCATCTC
TATATCAGTGGCTTTGCAGGCTCCTCTGTCTCGGGCTCGTCGACTCTTTTTTGCGCTGGCTCAAGATACCTGCCG
CCGGGCTGGGATTGTAGGGCGGGCTCAGTTGCATCGGACGATGTCTTTGCTCTCGGGTCGGTCATGTACTTCATC
ATGACTGGCACTGAAGTCTATGCCGATTTGGAAGAGGACAAGGCGGAAGAGTTGATACAGAGGGCTGAGTTCCCA
GTTGTGGACCAAATCGCCTGTGGAAGCGTCATCCAGGCTTGCTGGGACGGGACTATATCCACCGCTCAGGGAGCG
GTGGATGCTTTCAAAGGTCTGGAGTGGGAGGTTGATGATGAAAAGGTTTGCTGA
Transcript >Ophun1|5827
ATGCGAGTCGAGGCACAGGCCTACGAGCGACTCAAGGATGCTCCGCACGTTCCAAGACTTATCGAATGGGATGCC
GAGTCCTGCTGCTTGACGTTGGAGCACATGCAGAACGGGAACCTCTTGTATTATCTGAGGAACGAAAACATCTTT
CTCAACCCCGTCGTCAATTATGTTTCCCACCAACTTCGTCGACGGTGGGTCGTCGAGGCGGCGAGAGCCCTGGCT
GTCGTTCATGCGGCCGACATCACTCACTGCGATTTCGTGCCTCGCAAATTGTTGTTGGACGAACAGCTGCATCTC
TATATCAGTGGCTTTGCAGGCTCCTCTGTCTCGGGCTCGTCGACTCTTTTTTGCGCTGGCTCAAGATACCTGCCG
CCGGGCTGGGATTGTAGGGCGGGCTCAGTTGCATCGGACGATGTCTTTGCTCTCGGGTCGGTCATGTACTTCATC
ATGACTGGCACTGAAGTCTATGCCGATTTGGAAGAGGACAAGGCGGAAGAGTTGATACAGAGGGCTGAGTTCCCA
GTTGTGGACCAAATCGCCTGTGGAAGCGTCATCCAGGCTTGCTGGGACGGGACTATATCCACCGCTCAGGGAGCG
GTGGATGCTTTCAAAGGTCTGGAGTGGGAGGTTGATGATGAAAAGGTTTGCTGA
Gene >Ophun1|5827
ATGCGAGTCGAGGCACAGGCCTACGAGCGACTCAAGGATGCTCCGCACGTTCCAAGACTTATCGAATGGGATGCC
GAGTCCTGCTGCTTGACGTTGGAGCACATGCAGAACGGGAACCTCTTGTATTATCTGAGGAACGAAAACATCTTT
CTCAACCCCGTCGTCAATTATGTTTCCCACCAACTTCGTCGACGGTGGGTCGTCGAGGCGGCGAGAGCCCTGGCT
GTCGTTCATGCGGCCGACATCACTCACTGCGATTTCGTGCCTCGCAAATTGTTGTTGGACGAACAGCTGCATCTC
TATATCAGTGGCTTTGCAGGCTCCTCTGTCTCGGGCTCGTCGACTCTTTTTTGCGCTGGCTCAAGATACCTGCCG
CCGGGCTGGGATTGTAGGGCGGGCTCAGTTGCATCGGACGATGTCTTTGCTCTCGGGTCGGTCATGTACTTCATC
ATGACTGGCACTGAAGTCTATGCCGATTTGGAAGAGGACAAGGCGGAAGAGTTGATACAGAGGGCTGAGTTCCCA
GTTGTGGACCAAATCGCCTGTGGAAGCGTCATCCAGGCTTGCTGGGACGGGACTATATCCACCGCTCAGGGAGCG
GTGGATGCTTTCAAAGGTCTGGAGTGGGAGGTTGATGATGAAAAGGTTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail