Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5825
Gene name
LocationContig_6:41809..43366
Strand-
Gene length (bp)1557
Transcript length (bp)1557
Coding sequence length (bp)1557
Protein length (aa) 519

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 23 0.999469

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1351
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03813
Ophiocordyceps camponoti-rufipedis Ophun1|5825 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10756
Ophiocordyceps subramaniannii Hirsu2|2981
Ophiocordyceps subramaniannii Hirsu2|3370
Ophiocordyceps subramaniannii Hirsu2|3900
Ophiocordyceps subramaniannii Hirsu2|862

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5825
MRSLHVSLLLFLSSSSWPLTAFATPAPPSPQTSNPWAFPKDGFWTATWVQAKALRNGYDGSMMMLSTPKPSMSYP
SVRHEGRYRRLLYTTAQEALQDFVSYADDKQTPLRGGAFMLFHWDHVHMFQHKYFGWLRRPSSGSLPHILICKRD
DSRIGLPRPTAYLINDFVRHRFGRLPVSPENVARLLQRPELLPRQSMRRKIYPGCVSSSCSPSTADPACQKRVSH
AAEAIRAGITAKKQPPTPELASQASRAVCSAAQPSAPRQSATATTVKDIEACQDHFTEVFERNFPKRTVDEIMEW
LETTEDNACSILKSFDVNVNLASPPLEGQPRATPVPDSDSLAVLETAFEKPWEIFVFNVQRRFRVSEPQLREAID
GGITQLQQKHPQIYQYLQKEYPSLVGLLPQMAAAGIRLASCVPLRTPSPQLTPLCQKFTTALTKEKSLTSLMTTL
TREDSPIYFTTVTSKGKSPQSVETSPVSFGNRHGLEIIRLEGPRPAAQGDKGQADNTVVDYIDLTMTR*
Coding >Ophun1|5825
ATGCGCTCACTCCACGTCTCACTCCTCCTCTTCCTCTCCTCATCGTCATGGCCTCTAACCGCATTCGCCACGCCG
GCTCCCCCAAGCCCACAAACATCCAACCCCTGGGCCTTCCCGAAAGACGGCTTCTGGACGGCAACCTGGGTCCAA
GCAAAAGCCCTTCGGAACGGCTATGACGGGAGTATGATGATGCTGTCGACCCCGAAACCGTCAATGTCGTATCCC
TCTGTGAGACACGAAGGGCGGTACAGAAGATTGCTCTACACCACTGCTCAAGAGGCGCTGCAAGACTTTGTCTCT
TACGCCGATGATAAGCAAACGCCACTCAGGGGCGGCGCTTTCATGCTCTTTCACTGGGACCATGTGCACATGTTT
CAACATAAATATTTCGGCTGGCTACGGAGACCCAGCTCCGGAAGTCTGCCACACATCTTGATCTGCAAAAGAGAT
GATTCACGGATAGGGTTGCCCAGACCGACGGCCTACCTGATTAATGATTTTGTTCGTCATCGCTTTGGGCGACTG
CCTGTAAGCCCAGAAAACGTTGCGCGTCTTCTTCAACGACCAGAGCTACTCCCGAGACAATCGATGAGAAGGAAG
ATATATCCAGGCTGCGTTTCGTCTTCATGTTCTCCCTCGACAGCAGACCCAGCGTGCCAGAAACGAGTCTCGCAC
GCAGCCGAGGCTATCCGAGCCGGCATCACAGCCAAGAAGCAGCCTCCCACACCTGAGCTGGCCTCTCAGGCATCG
CGGGCCGTCTGCTCGGCGGCGCAACCATCAGCGCCGAGGCAGTCAGCAACTGCAACGACGGTCAAAGATATAGAA
GCTTGTCAGGATCACTTCACGGAAGTCTTTGAAAGAAACTTTCCAAAACGCACCGTGGATGAGATCATGGAATGG
CTTGAGACCACCGAGGACAACGCATGTTCTATACTGAAAAGCTTCGACGTGAATGTTAATCTCGCGAGCCCCCCT
CTTGAGGGACAGCCGCGAGCGACACCTGTCCCAGATTCCGATTCATTGGCGGTCCTGGAAACTGCATTCGAGAAG
CCGTGGGAAATCTTCGTCTTCAACGTCCAGAGACGCTTCCGAGTCAGCGAGCCGCAGCTACGGGAAGCCATCGAC
GGCGGCATCACGCAACTTCAGCAAAAGCATCCTCAGATATACCAGTACTTGCAGAAAGAATACCCATCTCTCGTC
GGGCTTCTGCCGCAGATGGCGGCCGCAGGCATCCGCCTCGCCAGTTGCGTGCCCCTGAGAACGCCCAGCCCGCAG
TTGACGCCGCTGTGCCAGAAGTTCACAACTGCTTTGACCAAAGAGAAGAGTCTTACATCTCTCATGACTACCTTG
ACCAGAGAAGATAGTCCTATATATTTTACGACTGTCACGTCCAAAGGGAAGAGTCCACAATCAGTGGAAACGTCA
CCGGTCTCATTCGGTAACCGTCACGGACTTGAGATCATCAGGCTTGAGGGCCCGCGTCCCGCTGCTCAAGGAGAC
AAAGGCCAAGCCGATAACACAGTAGTCGATTACATAGATCTCACTATGACTCGCTAG
Transcript >Ophun1|5825
ATGCGCTCACTCCACGTCTCACTCCTCCTCTTCCTCTCCTCATCGTCATGGCCTCTAACCGCATTCGCCACGCCG
GCTCCCCCAAGCCCACAAACATCCAACCCCTGGGCCTTCCCGAAAGACGGCTTCTGGACGGCAACCTGGGTCCAA
GCAAAAGCCCTTCGGAACGGCTATGACGGGAGTATGATGATGCTGTCGACCCCGAAACCGTCAATGTCGTATCCC
TCTGTGAGACACGAAGGGCGGTACAGAAGATTGCTCTACACCACTGCTCAAGAGGCGCTGCAAGACTTTGTCTCT
TACGCCGATGATAAGCAAACGCCACTCAGGGGCGGCGCTTTCATGCTCTTTCACTGGGACCATGTGCACATGTTT
CAACATAAATATTTCGGCTGGCTACGGAGACCCAGCTCCGGAAGTCTGCCACACATCTTGATCTGCAAAAGAGAT
GATTCACGGATAGGGTTGCCCAGACCGACGGCCTACCTGATTAATGATTTTGTTCGTCATCGCTTTGGGCGACTG
CCTGTAAGCCCAGAAAACGTTGCGCGTCTTCTTCAACGACCAGAGCTACTCCCGAGACAATCGATGAGAAGGAAG
ATATATCCAGGCTGCGTTTCGTCTTCATGTTCTCCCTCGACAGCAGACCCAGCGTGCCAGAAACGAGTCTCGCAC
GCAGCCGAGGCTATCCGAGCCGGCATCACAGCCAAGAAGCAGCCTCCCACACCTGAGCTGGCCTCTCAGGCATCG
CGGGCCGTCTGCTCGGCGGCGCAACCATCAGCGCCGAGGCAGTCAGCAACTGCAACGACGGTCAAAGATATAGAA
GCTTGTCAGGATCACTTCACGGAAGTCTTTGAAAGAAACTTTCCAAAACGCACCGTGGATGAGATCATGGAATGG
CTTGAGACCACCGAGGACAACGCATGTTCTATACTGAAAAGCTTCGACGTGAATGTTAATCTCGCGAGCCCCCCT
CTTGAGGGACAGCCGCGAGCGACACCTGTCCCAGATTCCGATTCATTGGCGGTCCTGGAAACTGCATTCGAGAAG
CCGTGGGAAATCTTCGTCTTCAACGTCCAGAGACGCTTCCGAGTCAGCGAGCCGCAGCTACGGGAAGCCATCGAC
GGCGGCATCACGCAACTTCAGCAAAAGCATCCTCAGATATACCAGTACTTGCAGAAAGAATACCCATCTCTCGTC
GGGCTTCTGCCGCAGATGGCGGCCGCAGGCATCCGCCTCGCCAGTTGCGTGCCCCTGAGAACGCCCAGCCCGCAG
TTGACGCCGCTGTGCCAGAAGTTCACAACTGCTTTGACCAAAGAGAAGAGTCTTACATCTCTCATGACTACCTTG
ACCAGAGAAGATAGTCCTATATATTTTACGACTGTCACGTCCAAAGGGAAGAGTCCACAATCAGTGGAAACGTCA
CCGGTCTCATTCGGTAACCGTCACGGACTTGAGATCATCAGGCTTGAGGGCCCGCGTCCCGCTGCTCAAGGAGAC
AAAGGCCAAGCCGATAACACAGTAGTCGATTACATAGATCTCACTATGACTCGCTAG
Gene >Ophun1|5825
ATGCGCTCACTCCACGTCTCACTCCTCCTCTTCCTCTCCTCATCGTCATGGCCTCTAACCGCATTCGCCACGCCG
GCTCCCCCAAGCCCACAAACATCCAACCCCTGGGCCTTCCCGAAAGACGGCTTCTGGACGGCAACCTGGGTCCAA
GCAAAAGCCCTTCGGAACGGCTATGACGGGAGTATGATGATGCTGTCGACCCCGAAACCGTCAATGTCGTATCCC
TCTGTGAGACACGAAGGGCGGTACAGAAGATTGCTCTACACCACTGCTCAAGAGGCGCTGCAAGACTTTGTCTCT
TACGCCGATGATAAGCAAACGCCACTCAGGGGCGGCGCTTTCATGCTCTTTCACTGGGACCATGTGCACATGTTT
CAACATAAATATTTCGGCTGGCTACGGAGACCCAGCTCCGGAAGTCTGCCACACATCTTGATCTGCAAAAGAGAT
GATTCACGGATAGGGTTGCCCAGACCGACGGCCTACCTGATTAATGATTTTGTTCGTCATCGCTTTGGGCGACTG
CCTGTAAGCCCAGAAAACGTTGCGCGTCTTCTTCAACGACCAGAGCTACTCCCGAGACAATCGATGAGAAGGAAG
ATATATCCAGGCTGCGTTTCGTCTTCATGTTCTCCCTCGACAGCAGACCCAGCGTGCCAGAAACGAGTCTCGCAC
GCAGCCGAGGCTATCCGAGCCGGCATCACAGCCAAGAAGCAGCCTCCCACACCTGAGCTGGCCTCTCAGGCATCG
CGGGCCGTCTGCTCGGCGGCGCAACCATCAGCGCCGAGGCAGTCAGCAACTGCAACGACGGTCAAAGATATAGAA
GCTTGTCAGGATCACTTCACGGAAGTCTTTGAAAGAAACTTTCCAAAACGCACCGTGGATGAGATCATGGAATGG
CTTGAGACCACCGAGGACAACGCATGTTCTATACTGAAAAGCTTCGACGTGAATGTTAATCTCGCGAGCCCCCCT
CTTGAGGGACAGCCGCGAGCGACACCTGTCCCAGATTCCGATTCATTGGCGGTCCTGGAAACTGCATTCGAGAAG
CCGTGGGAAATCTTCGTCTTCAACGTCCAGAGACGCTTCCGAGTCAGCGAGCCGCAGCTACGGGAAGCCATCGAC
GGCGGCATCACGCAACTTCAGCAAAAGCATCCTCAGATATACCAGTACTTGCAGAAAGAATACCCATCTCTCGTC
GGGCTTCTGCCGCAGATGGCGGCCGCAGGCATCCGCCTCGCCAGTTGCGTGCCCCTGAGAACGCCCAGCCCGCAG
TTGACGCCGCTGTGCCAGAAGTTCACAACTGCTTTGACCAAAGAGAAGAGTCTTACATCTCTCATGACTACCTTG
ACCAGAGAAGATAGTCCTATATATTTTACGACTGTCACGTCCAAAGGGAAGAGTCCACAATCAGTGGAAACGTCA
CCGGTCTCATTCGGTAACCGTCACGGACTTGAGATCATCAGGCTTGAGGGCCCGCGTCCCGCTGCTCAAGGAGAC
AAAGGCCAAGCCGATAACACAGTAGTCGATTACATAGATCTCACTATGACTCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail