Protein ID | Ophun1|5821 |
Gene name | |
Location | Contig_6:34273..36787 |
Strand | - |
Gene length (bp) | 2514 |
Transcript length (bp) | 2400 |
Coding sequence length (bp) | 2400 |
Protein length (aa) | 800 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01406 | tRNA-synt_1e | tRNA synthetases class I (C) catalytic domain | 6.7E-112 | 18 | 443 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q09860|SYC_SCHPO | Probable cysteine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29E6.06c PE=3 SV=1 | 4 | 792 | 1.0E-169 |
sp|P53852|SYC_YEAST | Cysteine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL247W PE=1 SV=1 | 4 | 792 | 3.0E-162 |
sp|Q5F408|SYCC_CHICK | Cysteine--tRNA ligase, cytoplasmic OS=Gallus gallus GN=CARS PE=2 SV=1 | 4 | 792 | 2.0E-148 |
sp|Q4R550|SYCC_MACFA | Cysteine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=CARS PE=2 SV=1 | 4 | 792 | 3.0E-147 |
sp|Q9ER72|SYCC_MOUSE | Cysteine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Cars PE=1 SV=2 | 4 | 792 | 7.0E-146 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q09860|SYC_SCHPO | Probable cysteine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29E6.06c PE=3 SV=1 | 4 | 792 | 1.0E-169 |
sp|P53852|SYC_YEAST | Cysteine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL247W PE=1 SV=1 | 4 | 792 | 3.0E-162 |
sp|Q5F408|SYCC_CHICK | Cysteine--tRNA ligase, cytoplasmic OS=Gallus gallus GN=CARS PE=2 SV=1 | 4 | 792 | 2.0E-148 |
sp|Q4R550|SYCC_MACFA | Cysteine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=CARS PE=2 SV=1 | 4 | 792 | 3.0E-147 |
sp|Q9ER72|SYCC_MOUSE | Cysteine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Cars PE=1 SV=2 | 4 | 792 | 7.0E-146 |
sp|P49589|SYCC_HUMAN | Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=CARS PE=1 SV=3 | 4 | 792 | 6.0E-145 |
sp|Q5M7N8|SYCC_XENTR | Cysteine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=cars PE=2 SV=1 | 4 | 792 | 1.0E-141 |
sp|Q7ZWR2|SYCC_XENLA | Cysteine--tRNA ligase, cytoplasmic OS=Xenopus laevis GN=cars PE=2 SV=1 | 4 | 792 | 2.0E-139 |
sp|Q291L4|SYCC_DROPS | Cysteine--tRNA ligase, cytoplasmic OS=Drosophila pseudoobscura pseudoobscura GN=Aats-cys PE=3 SV=1 | 4 | 773 | 5.0E-138 |
sp|Q7KN90|SYCC_DROME | Cysteine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster GN=Aats-cys PE=1 SV=1 | 4 | 773 | 9.0E-135 |
sp|Q54KR1|SYCC_DICDI | Cysteine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=cysS PE=3 SV=1 | 210 | 790 | 3.0E-108 |
sp|Q8SRE0|SYC_ENCCU | Cysteine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0490 PE=1 SV=1 | 211 | 595 | 3.0E-79 |
sp|Q8BYM8|SYCM_MOUSE | Probable cysteine--tRNA ligase, mitochondrial OS=Mus musculus GN=Cars2 PE=1 SV=2 | 212 | 563 | 8.0E-70 |
sp|Q6DJ95|SYCM_XENTR | Probable cysteine--tRNA ligase, mitochondrial OS=Xenopus tropicalis GN=cars2 PE=2 SV=1 | 212 | 531 | 2.0E-68 |
sp|Q2KIF8|SYCM_BOVIN | Cysteine--tRNA ligase, mitochondrial OS=Bos taurus GN=CARS2 PE=2 SV=1 | 212 | 531 | 1.0E-63 |
sp|Q9HA77|SYCM_HUMAN | Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens GN=CARS2 PE=1 SV=1 | 212 | 580 | 1.0E-61 |
sp|Q6PA41|SYCM_XENLA | Probable cysteine--tRNA ligase, mitochondrial OS=Xenopus laevis GN=cars2 PE=2 SV=1 | 212 | 558 | 2.0E-60 |
sp|Q8R7T3|SYC_CALS4 | Cysteine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cysS PE=3 SV=1 | 220 | 558 | 1.0E-59 |
sp|O58370|SYC_PYRHO | Cysteine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cysS PE=3 SV=1 | 212 | 556 | 2.0E-59 |
sp|A8MLB7|SYC_ALKOO | Cysteine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=cysS PE=3 SV=1 | 220 | 558 | 4.0E-58 |
sp|B6YUQ3|SYC_THEON | Cysteine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=cysS PE=3 SV=1 | 211 | 605 | 6.0E-58 |
sp|Q8U227|SYC_PYRFU | Cysteine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cysS PE=3 SV=2 | 211 | 556 | 3.0E-57 |
sp|A6VG07|SYC_METM7 | Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=cysS PE=3 SV=1 | 211 | 530 | 4.0E-57 |
sp|C5A739|SYC_THEGJ | Cysteine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=cysS PE=3 SV=1 | 211 | 605 | 8.0E-57 |
sp|A9AAN8|SYC_METM6 | Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=cysS PE=3 SV=1 | 211 | 530 | 2.0E-56 |
sp|Q5JD45|SYC_THEKO | Cysteine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cysS PE=3 SV=1 | 211 | 605 | 3.0E-56 |
sp|Q890M4|SYC_CLOTE | Cysteine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=cysS PE=3 SV=1 | 220 | 556 | 3.0E-56 |
sp|Q9UYV2|SYC_PYRAB | Cysteine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cysS PE=3 SV=1 | 212 | 556 | 3.0E-56 |
sp|A0PXS5|SYC_CLONN | Cysteine--tRNA ligase OS=Clostridium novyi (strain NT) GN=cysS PE=3 SV=1 | 220 | 563 | 5.0E-56 |
sp|C0ZIF7|SYC_BREBN | Cysteine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=cysS PE=3 SV=1 | 218 | 559 | 6.0E-56 |
sp|Q6LYD1|SYC_METMP | Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=cysS PE=3 SV=1 | 211 | 561 | 1.0E-55 |
sp|A6UP68|SYC_METVS | Cysteine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=cysS PE=3 SV=1 | 218 | 597 | 5.0E-55 |
sp|B0K5F6|SYC_THEPX | Cysteine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=cysS PE=3 SV=1 | 214 | 558 | 1.0E-54 |
sp|B0KCH9|SYC_THEP3 | Cysteine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=cysS PE=3 SV=1 | 214 | 558 | 1.0E-54 |
sp|Q54ZY3|SYCM_DICDI | Probable cysteine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=mcysS PE=3 SV=1 | 210 | 563 | 3.0E-54 |
sp|A3N0S3|SYC_ACTP2 | Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cysS PE=3 SV=1 | 199 | 558 | 3.0E-54 |
sp|Q65UY1|SYC_MANSM | Cysteine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysS PE=3 SV=2 | 199 | 558 | 3.0E-54 |
sp|Q31H54|SYC_THICR | Cysteine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=cysS PE=3 SV=1 | 212 | 529 | 4.0E-54 |
sp|A1RYM3|SYC_THEPD | Cysteine--tRNA ligase OS=Thermofilum pendens (strain Hrk 5) GN=cysS PE=3 SV=1 | 214 | 604 | 7.0E-54 |
sp|B3GXR0|SYC_ACTP7 | Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cysS PE=3 SV=1 | 205 | 558 | 8.0E-54 |
sp|Q0SQC1|SYC_CLOPS | Cysteine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=cysS PE=3 SV=1 | 220 | 530 | 8.0E-54 |
sp|Q8XHQ5|SYC_CLOPE | Cysteine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=cysS PE=3 SV=1 | 220 | 530 | 9.0E-54 |
sp|Q0TMM4|SYC_CLOP1 | Cysteine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=cysS PE=3 SV=1 | 220 | 530 | 9.0E-54 |
sp|Q6HPS8|SYC_BACHK | Cysteine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-53 |
sp|Q63HB0|SYC_BACCZ | Cysteine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-53 |
sp|B7JK97|SYC_BACC0 | Cysteine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-53 |
sp|Q81VV1|SYC_BACAN | Cysteine--tRNA ligase OS=Bacillus anthracis GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-53 |
sp|C3LJ62|SYC_BACAC | Cysteine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-53 |
sp|C3P9N5|SYC_BACAA | Cysteine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-53 |
sp|C1ET19|SYC_BACC3 | Cysteine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-53 |
sp|B0BPJ8|SYC_ACTPJ | Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cysS PE=3 SV=1 | 199 | 558 | 1.0E-53 |
sp|A0R8G1|SYC_BACAH | Cysteine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=cysS PE=3 SV=1 | 220 | 559 | 2.0E-53 |
sp|Q6AJ23|SYC_DESPS | Cysteine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=cysS PE=3 SV=1 | 212 | 561 | 2.0E-53 |
sp|F4IPY2|SYCM_ARATH | Cysteine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SYCO PE=2 SV=1 | 159 | 558 | 2.0E-53 |
sp|B9IZH4|SYC_BACCQ | Cysteine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=cysS PE=3 SV=1 | 220 | 559 | 2.0E-53 |
sp|B7HQS4|SYC_BACC7 | Cysteine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=cysS PE=3 SV=1 | 220 | 559 | 2.0E-53 |
sp|A6TWK5|SYC_ALKMQ | Cysteine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=cysS PE=3 SV=1 | 220 | 558 | 3.0E-53 |
sp|Q73FB7|SYC_BACC1 | Cysteine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysS PE=3 SV=1 | 220 | 559 | 3.0E-53 |
sp|Q3BSH9|SYC_XANC5 | Cysteine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cysS PE=3 SV=1 | 209 | 532 | 3.0E-53 |
sp|A9VNA2|SYC_BACWK | Cysteine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=cysS PE=3 SV=1 | 220 | 559 | 6.0E-53 |
sp|A6VQ79|SYC_ACTSZ | Cysteine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cysS PE=3 SV=1 | 199 | 558 | 9.0E-53 |
sp|Q81J59|SYC_BACCR | Cysteine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-52 |
sp|B7HJ28|SYC_BACC4 | Cysteine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-52 |
sp|B8F392|SYC_HAEPS | Cysteine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=cysS PE=3 SV=1 | 199 | 558 | 1.0E-52 |
sp|B1KLU0|SYC_SHEWM | Cysteine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysS PE=3 SV=1 | 198 | 558 | 3.0E-52 |
sp|Q3IF51|SYC_PSEHT | Cysteine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cysS PE=3 SV=1 | 209 | 562 | 3.0E-52 |
sp|A6LPP1|SYC_CLOB8 | Cysteine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=cysS PE=3 SV=1 | 220 | 556 | 4.0E-52 |
sp|B2UY90|SYC_CLOBA | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=cysS PE=3 SV=1 | 220 | 530 | 4.0E-52 |
sp|Q47XL5|SYC_COLP3 | Cysteine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysS PE=3 SV=1 | 222 | 522 | 6.0E-52 |
sp|B7ISZ9|SYC_BACC2 | Cysteine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=cysS PE=3 SV=1 | 220 | 559 | 6.0E-52 |
sp|Q6NFC3|SYC_CORDI | Cysteine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=cysS PE=3 SV=1 | 209 | 585 | 9.0E-52 |
sp|Q12L98|SYC_SHEDO | Cysteine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cysS PE=3 SV=1 | 212 | 559 | 1.0E-51 |
sp|Q319Z9|SYC_PROM9 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=cysS PE=3 SV=1 | 220 | 522 | 1.0E-51 |
sp|Q8PK23|SYC_XANAC | Cysteine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysS PE=3 SV=1 | 209 | 528 | 1.0E-51 |
sp|A3QFX9|SYC_SHELP | Cysteine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cysS PE=3 SV=1 | 212 | 527 | 2.0E-51 |
sp|B0TLV2|SYC_SHEHH | Cysteine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cysS PE=3 SV=1 | 212 | 561 | 2.0E-51 |
sp|A7GK01|SYC_BACCN | Cysteine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=cysS PE=3 SV=1 | 220 | 558 | 2.0E-51 |
sp|Q97ED6|SYC_CLOAB | Cysteine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cysS PE=3 SV=1 | 220 | 556 | 2.0E-51 |
sp|A0KYM2|SYC_SHESA | Cysteine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=cysS PE=3 SV=1 | 205 | 558 | 2.0E-51 |
sp|B2TIF6|SYC_CLOBB | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=cysS PE=3 SV=1 | 220 | 530 | 2.0E-51 |
sp|A3PDX8|SYC_PROM0 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=cysS PE=3 SV=1 | 220 | 522 | 2.0E-51 |
sp|A3DLW5|SYC_STAMF | Cysteine--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=cysS PE=3 SV=1 | 220 | 519 | 3.0E-51 |
sp|Q0A7N3|SYC_ALKEH | Cysteine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cysS PE=3 SV=2 | 222 | 527 | 3.0E-51 |
sp|Q8D8R1|SYC_VIBVU | Cysteine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=cysS PE=3 SV=2 | 212 | 562 | 3.0E-51 |
sp|A2BS39|SYC_PROMS | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=cysS PE=3 SV=1 | 220 | 522 | 4.0E-51 |
sp|C0QRE6|SYC_PERMH | Cysteine--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=cysS PE=3 SV=1 | 209 | 564 | 4.0E-51 |
sp|B9LZV4|SYC_GEODF | Cysteine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=cysS PE=3 SV=1 | 220 | 558 | 4.0E-51 |
sp|A6UWT0|SYC_META3 | Cysteine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=cysS PE=3 SV=1 | 211 | 558 | 4.0E-51 |
sp|P57890|SYC_PASMU | Cysteine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=cysS PE=3 SV=1 | 194 | 558 | 4.0E-51 |
sp|Q06752|SYC_BACSU | Cysteine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=cysS PE=1 SV=1 | 220 | 567 | 4.0E-51 |
sp|A8F596|SYC_PSELT | Cysteine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=cysS PE=3 SV=1 | 209 | 604 | 5.0E-51 |
sp|Q3A9P1|SYC_CARHZ | Cysteine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=cysS PE=3 SV=1 | 220 | 597 | 5.0E-51 |
sp|A7HDA1|SYC_ANADF | Cysteine--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=cysS PE=3 SV=1 | 220 | 558 | 5.0E-51 |
sp|Q7MLR5|SYC_VIBVY | Cysteine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=cysS PE=3 SV=2 | 212 | 562 | 5.0E-51 |
sp|B8CRG0|SYC_SHEPW | Cysteine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cysS PE=3 SV=1 | 212 | 562 | 6.0E-51 |
sp|B1KTA5|SYC_CLOBM | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=cysS PE=3 SV=1 | 220 | 530 | 6.0E-51 |
sp|B6ISG4|SYC_RHOCS | Cysteine--tRNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=cysS PE=3 SV=1 | 220 | 459 | 7.0E-51 |
sp|B5YID4|SYC_THEYD | Cysteine--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cysS PE=3 SV=1 | 220 | 538 | 7.0E-51 |
sp|A5I7M8|SYC_CLOBH | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=cysS PE=3 SV=1 | 220 | 530 | 7.0E-51 |
sp|A7FZ91|SYC_CLOB1 | Cysteine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=cysS PE=3 SV=1 | 220 | 530 | 7.0E-51 |
sp|B0U0I3|SYC_FRAP2 | Cysteine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=cysS PE=3 SV=1 | 214 | 558 | 8.0E-51 |
sp|Q5GZD9|SYC_XANOR | Cysteine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=cysS PE=3 SV=1 | 209 | 528 | 8.0E-51 |
sp|Q2P2E8|SYC_XANOM | Cysteine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cysS PE=3 SV=1 | 209 | 528 | 8.0E-51 |
sp|A3M419|SYC_ACIBT | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=cysS PE=3 SV=2 | 212 | 555 | 8.0E-51 |
sp|B2HX34|SYC_ACIBC | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=cysS PE=3 SV=1 | 212 | 555 | 8.0E-51 |
sp|A7GJ96|SYC_CLOBL | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=cysS PE=3 SV=1 | 220 | 530 | 8.0E-51 |
sp|A9KWH4|SYC_SHEB9 | Cysteine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=cysS PE=3 SV=1 | 212 | 558 | 9.0E-51 |
sp|B1IGH6|SYC_CLOBK | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=cysS PE=3 SV=1 | 220 | 530 | 1.0E-50 |
sp|Q97S25|SYC_STRPN | Cysteine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cysS PE=3 SV=1 | 220 | 546 | 1.0E-50 |
sp|B0VAU1|SYC_ACIBY | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=cysS PE=3 SV=1 | 212 | 555 | 1.0E-50 |
sp|B7IBU3|SYC_ACIB5 | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=cysS PE=3 SV=1 | 212 | 555 | 1.0E-50 |
sp|B7GWA1|SYC_ACIB3 | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=cysS PE=3 SV=1 | 212 | 555 | 1.0E-50 |
sp|C1FMX3|SYC_CLOBJ | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=cysS PE=3 SV=1 | 220 | 530 | 1.0E-50 |
sp|B0VS71|SYC_ACIBS | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=cysS PE=3 SV=1 | 212 | 555 | 1.0E-50 |
sp|B1I0T1|SYC_DESAP | Cysteine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=cysS PE=3 SV=1 | 212 | 556 | 1.0E-50 |
sp|B8E5F2|SYC_SHEB2 | Cysteine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=cysS PE=3 SV=1 | 212 | 558 | 1.0E-50 |
sp|A6WLP8|SYC_SHEB8 | Cysteine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=cysS PE=3 SV=1 | 212 | 558 | 1.0E-50 |
sp|Q0HTK4|SYC_SHESR | Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=cysS PE=3 SV=1 | 205 | 558 | 2.0E-50 |
sp|B6EH43|SYC_ALISL | Cysteine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=cysS PE=3 SV=1 | 223 | 562 | 2.0E-50 |
sp|A3D302|SYC_SHEB5 | Cysteine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cysS PE=3 SV=1 | 212 | 558 | 2.0E-50 |
sp|Q5LRJ6|SYC_RUEPO | Cysteine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=cysS PE=3 SV=1 | 211 | 527 | 2.0E-50 |
sp|A8H617|SYC_SHEPA | Cysteine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cysS PE=3 SV=1 | 198 | 562 | 2.0E-50 |
sp|Q65PC8|SYC_BACLD | Cysteine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysS PE=3 SV=1 | 220 | 567 | 2.0E-50 |
sp|Q6LT67|SYC1_PHOPR | Cysteine--tRNA ligase 1 OS=Photobacterium profundum GN=cysS1 PE=3 SV=1 | 212 | 558 | 2.0E-50 |
sp|C3LNF1|SYC_VIBCM | Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysS PE=3 SV=1 | 212 | 556 | 2.0E-50 |
sp|Q9KQZ9|SYC_VIBCH | Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysS PE=3 SV=1 | 212 | 556 | 2.0E-50 |
sp|A5F763|SYC_VIBC3 | Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysS PE=3 SV=1 | 212 | 556 | 2.0E-50 |
sp|Q8EG22|SYC_SHEON | Cysteine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=cysS PE=3 SV=1 | 205 | 558 | 2.0E-50 |
sp|Q0HH98|SYC_SHESM | Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=cysS PE=3 SV=1 | 205 | 558 | 2.0E-50 |
sp|Q8DQS8|SYC_STRR6 | Cysteine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cysS PE=3 SV=1 | 220 | 546 | 2.0E-50 |
sp|Q87QJ9|SYC_VIBPA | Cysteine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysS PE=3 SV=1 | 223 | 562 | 3.0E-50 |
sp|Q7VMA0|SYC_HAEDU | Cysteine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=cysS PE=3 SV=1 | 223 | 506 | 3.0E-50 |
sp|A8FTH6|SYC_SHESH | Cysteine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=cysS PE=3 SV=1 | 212 | 576 | 3.0E-50 |
sp|A8G5S9|SYC_PROM2 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=cysS PE=3 SV=1 | 220 | 522 | 3.0E-50 |
sp|A1RL92|SYC_SHESW | Cysteine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=cysS PE=3 SV=1 | 212 | 558 | 3.0E-50 |
sp|Q21JG6|SYC_SACD2 | Cysteine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysS PE=3 SV=1 | 164 | 502 | 3.0E-50 |
sp|A4Y5H9|SYC_SHEPC | Cysteine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cysS PE=3 SV=1 | 212 | 558 | 4.0E-50 |
sp|Q5E4F1|SYC_VIBF1 | Cysteine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysS PE=3 SV=1 | 199 | 562 | 5.0E-50 |
sp|A2C3T6|SYC_PROM1 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=cysS PE=3 SV=1 | 211 | 453 | 6.0E-50 |
sp|C3KVS3|SYC_CLOB6 | Cysteine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=cysS PE=3 SV=1 | 220 | 530 | 7.0E-50 |
sp|A1WT89|SYC_HALHL | Cysteine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=cysS PE=3 SV=1 | 209 | 444 | 1.0E-49 |
sp|Q46JT8|SYC_PROMT | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=cysS PE=3 SV=1 | 211 | 604 | 1.0E-49 |
sp|Q96YC3|SYC_SULTO | Cysteine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cysS PE=3 SV=2 | 218 | 601 | 2.0E-49 |
sp|B2SFH9|SYC_FRATM | Cysteine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=cysS PE=3 SV=1 | 214 | 558 | 2.0E-49 |
sp|A7MK00|SYC_CROS8 | Cysteine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysS PE=3 SV=2 | 209 | 558 | 2.0E-49 |
sp|A5G949|SYC_GEOUR | Cysteine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=cysS PE=3 SV=1 | 220 | 556 | 2.0E-49 |
sp|B5EEK6|SYC_GEOBB | Cysteine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=cysS PE=3 SV=1 | 203 | 558 | 2.0E-49 |
sp|A0Q4Q1|SYC_FRATN | Cysteine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=cysS PE=3 SV=1 | 214 | 558 | 2.0E-49 |
sp|C6E7P0|SYC_GEOSM | Cysteine--tRNA ligase OS=Geobacter sp. (strain M21) GN=cysS PE=3 SV=1 | 203 | 558 | 3.0E-49 |
sp|Q03ZR0|SYC_LEUMM | Cysteine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=cysS PE=3 SV=1 | 218 | 560 | 3.0E-49 |
sp|A4IWF2|SYC_FRATW | Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cysS PE=3 SV=1 | 214 | 558 | 3.0E-49 |
sp|Q0BKI3|SYC_FRATO | Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=cysS PE=3 SV=1 | 214 | 558 | 3.0E-49 |
sp|Q2A1T7|SYC_FRATH | Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=cysS PE=3 SV=1 | 214 | 558 | 3.0E-49 |
sp|A7NE53|SYC_FRATF | Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=cysS PE=3 SV=1 | 214 | 558 | 3.0E-49 |
sp|Q6FC71|SYC_ACIAD | Cysteine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysS PE=3 SV=1 | 212 | 561 | 3.0E-49 |
sp|B7VGZ1|SYC_VIBTL | Cysteine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=cysS PE=3 SV=1 | 212 | 612 | 4.0E-49 |
sp|Q10XJ9|SYC_TRIEI | Cysteine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=cysS PE=3 SV=1 | 207 | 563 | 4.0E-49 |
sp|B1YGS9|SYC_EXIS2 | Cysteine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=cysS PE=3 SV=1 | 212 | 555 | 4.0E-49 |
sp|B1HNM3|SYC_LYSSC | Cysteine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=cysS PE=3 SV=1 | 211 | 532 | 5.0E-49 |
sp|A7Z0L6|SYC_BACMF | Cysteine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cysS PE=3 SV=1 | 220 | 558 | 6.0E-49 |
sp|Q07ZX5|SYC_SHEFN | Cysteine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=cysS PE=3 SV=1 | 212 | 558 | 6.0E-49 |
sp|A1AK01|SYC_PELPD | Cysteine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=cysS PE=3 SV=1 | 209 | 587 | 7.0E-49 |
sp|Q8NMD7|SYC_CORGL | Cysteine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=cysS PE=3 SV=1 | 209 | 417 | 7.0E-49 |
sp|Q2IQG7|SYC_ANADE | Cysteine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=cysS PE=3 SV=1 | 212 | 569 | 8.0E-49 |
sp|O67163|SYC_AQUAE | Cysteine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=cysS PE=3 SV=1 | 220 | 564 | 1.0E-48 |
sp|A1S4X2|SYC_SHEAM | Cysteine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cysS PE=3 SV=1 | 212 | 556 | 1.0E-48 |
sp|A2BXK1|SYC_PROM5 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=cysS PE=3 SV=1 | 220 | 522 | 1.0E-48 |
sp|Q83BL7|SYC_COXBU | Cysteine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cysS PE=1 SV=2 | 212 | 558 | 1.0E-48 |
sp|A9KBJ2|SYC_COXBN | Cysteine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cysS PE=3 SV=1 | 212 | 558 | 2.0E-48 |
sp|A0LIR9|SYC_SYNFM | Cysteine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=cysS PE=3 SV=1 | 220 | 450 | 2.0E-48 |
sp|Q72BQ5|SYC_DESVH | Cysteine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=cysS PE=3 SV=1 | 218 | 562 | 2.0E-48 |
sp|A1VDQ5|SYC_DESVV | Cysteine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=cysS PE=3 SV=1 | 218 | 562 | 2.0E-48 |
sp|C4KZR7|SYC_EXISA | Cysteine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=cysS PE=3 SV=1 | 212 | 558 | 2.0E-48 |
sp|Q5NEL1|SYC_FRATT | Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cysS PE=3 SV=1 | 214 | 558 | 2.0E-48 |
sp|Q14G14|SYC_FRAT1 | Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cysS PE=3 SV=1 | 214 | 558 | 2.0E-48 |
sp|Q747A2|SYC_GEOSL | Cysteine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=cysS PE=3 SV=1 | 220 | 556 | 2.0E-48 |
sp|Q8P8J0|SYC_XANCP | Cysteine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysS PE=3 SV=1 | 209 | 451 | 2.0E-48 |
sp|Q4UVJ3|SYC_XANC8 | Cysteine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cysS PE=3 SV=1 | 209 | 451 | 2.0E-48 |
sp|B1GYT2|SYC_UNCTG | Cysteine--tRNA ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=cysS PE=3 SV=1 | 216 | 442 | 2.0E-48 |
sp|Q7VB63|SYC_PROMA | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=cysS PE=3 SV=1 | 203 | 560 | 2.0E-48 |
sp|A4QH41|SYC_CORGB | Cysteine--tRNA ligase OS=Corynebacterium glutamicum (strain R) GN=cysS PE=3 SV=1 | 209 | 417 | 2.0E-48 |
sp|Q18CD5|SYC_PEPD6 | Cysteine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=cysS PE=3 SV=2 | 214 | 526 | 2.0E-48 |
sp|C5BI15|SYC_TERTT | Cysteine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysS PE=3 SV=1 | 220 | 449 | 3.0E-48 |
sp|A9N924|SYC_COXBR | Cysteine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cysS PE=3 SV=1 | 212 | 558 | 3.0E-48 |
sp|A6SZV1|SYC_JANMA | Cysteine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=cysS PE=3 SV=1 | 212 | 558 | 3.0E-48 |
sp|A5GM79|SYC_SYNPW | Cysteine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=cysS PE=3 SV=1 | 218 | 558 | 3.0E-48 |
sp|C4XSW5|SYC_DESMR | Cysteine--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=cysS PE=3 SV=1 | 220 | 562 | 3.0E-48 |
sp|B3E1P0|SYC_GEOLS | Cysteine--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=cysS PE=3 SV=1 | 220 | 556 | 3.0E-48 |
sp|Q5QYP3|SYC_IDILO | Cysteine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cysS PE=3 SV=1 | 209 | 449 | 3.0E-48 |
sp|B2V6B4|SYC_SULSY | Cysteine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=cysS PE=3 SV=1 | 220 | 564 | 3.0E-48 |
sp|A8AB68|SYC_IGNH4 | Cysteine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=cysS PE=3 SV=1 | 214 | 545 | 3.0E-48 |
sp|A9MLA7|SYC_SALAR | Cysteine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysS PE=3 SV=1 | 209 | 558 | 5.0E-48 |
sp|B7GJ46|SYC_ANOFW | Cysteine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cysS PE=3 SV=1 | 220 | 558 | 5.0E-48 |
sp|Q04DQ8|SYC_OENOB | Cysteine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=cysS PE=3 SV=1 | 220 | 558 | 6.0E-48 |
sp|A5N4M6|SYC_CLOK5 | Cysteine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=cysS PE=3 SV=1 | 218 | 556 | 7.0E-48 |
sp|B9DY88|SYC_CLOK1 | Cysteine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=cysS PE=3 SV=1 | 218 | 556 | 7.0E-48 |
sp|Q8ZR68|SYC_SALTY | Cysteine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|C0PVI8|SYC_SALPC | Cysteine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|B5R6X0|SYC_SALG2 | Cysteine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|B5QUV0|SYC_SALEP | Cysteine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|Q57S29|SYC_SALCH | Cysteine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|B5EYD7|SYC_SALA4 | Cysteine--tRNA ligase OS=Salmonella agona (strain SL483) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|Q97WE6|SYC_SULSO | Cysteine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cysS PE=3 SV=1 | 218 | 599 | 7.0E-48 |
sp|Q8Z8P6|SYC_SALTI | Cysteine--tRNA ligase OS=Salmonella typhi GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|B4TN59|SYC_SALSV | Cysteine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|B5BCZ8|SYC_SALPK | Cysteine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|A9MW31|SYC_SALPB | Cysteine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|Q5PCE2|SYC_SALPA | Cysteine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|B4SXP2|SYC_SALNS | Cysteine--tRNA ligase OS=Salmonella newport (strain SL254) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|B4TA89|SYC_SALHS | Cysteine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|B5FLP7|SYC_SALDC | Cysteine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-48 |
sp|Q7N0S5|SYC_PHOLL | Cysteine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysS PE=3 SV=1 | 211 | 558 | 9.0E-48 |
sp|Q8FMI8|SYC_COREF | Cysteine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cysS PE=3 SV=2 | 209 | 417 | 1.0E-47 |
sp|A6VX53|SYC_MARMS | Cysteine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=cysS PE=3 SV=1 | 232 | 601 | 1.0E-47 |
sp|Q8E7F2|SYC_STRA3 | Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=cysS PE=3 SV=1 | 213 | 546 | 1.0E-47 |
sp|Q8UGG4|SYC_AGRFC | Cysteine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysS PE=3 SV=1 | 212 | 442 | 1.0E-47 |
sp|A8LLR2|SYC_DINSH | Cysteine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=cysS PE=3 SV=1 | 163 | 527 | 1.0E-47 |
sp|B4UGC3|SYC_ANASK | Cysteine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=cysS PE=3 SV=1 | 212 | 535 | 1.0E-47 |
sp|A2C808|SYC_PROM3 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=cysS PE=3 SV=2 | 220 | 560 | 2.0E-47 |
sp|B8JDH1|SYC_ANAD2 | Cysteine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=cysS PE=3 SV=1 | 212 | 535 | 2.0E-47 |
sp|Q8E1Z4|SYC_STRA5 | Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=cysS PE=3 SV=1 | 213 | 546 | 2.0E-47 |
sp|A4XHE2|SYC_CALS8 | Cysteine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=cysS PE=3 SV=1 | 220 | 529 | 2.0E-47 |
sp|Q2RWK2|SYC_RHORT | Cysteine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=cysS PE=3 SV=1 | 211 | 431 | 2.0E-47 |
sp|Q3J8Y9|SYC_NITOC | Cysteine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cysS PE=3 SV=1 | 202 | 561 | 2.0E-47 |
sp|Q9YBK6|SYC_AERPE | Cysteine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cysS PE=3 SV=2 | 237 | 417 | 2.0E-47 |
sp|Q7V6K0|SYC_PROMM | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=cysS PE=3 SV=2 | 220 | 564 | 2.0E-47 |
sp|Q28QY7|SYC_JANSC | Cysteine--tRNA ligase OS=Jannaschia sp. (strain CCS1) GN=cysS PE=3 SV=1 | 211 | 485 | 2.0E-47 |
sp|Q4K9S1|SYC_PSEF5 | Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cysS PE=3 SV=1 | 209 | 444 | 2.0E-47 |
sp|A4F6W7|SYC_SACEN | Cysteine--tRNA ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=cysS PE=3 SV=2 | 217 | 559 | 2.0E-47 |
sp|B6JHT8|SYC_OLICO | Cysteine--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=cysS PE=3 SV=1 | 212 | 417 | 2.0E-47 |
sp|Q1GHI0|SYC_RUEST | Cysteine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=cysS PE=3 SV=1 | 211 | 459 | 2.0E-47 |
sp|Q0I1Q1|SYC_HAES1 | Cysteine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=cysS PE=3 SV=1 | 194 | 558 | 3.0E-47 |
sp|C1D7F5|SYC_LARHH | Cysteine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=cysS PE=3 SV=1 | 212 | 558 | 3.0E-47 |
sp|Q4QPG7|SYC_HAEI8 | Cysteine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=cysS PE=3 SV=1 | 198 | 444 | 3.0E-47 |
sp|Q9CEJ0|SYC_LACLA | Cysteine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=cysS PE=3 SV=1 | 210 | 527 | 3.0E-47 |
sp|A5UFP3|SYC_HAEIG | Cysteine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=cysS PE=3 SV=1 | 198 | 444 | 4.0E-47 |
sp|A5D5M0|SYC_PELTS | Cysteine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=cysS PE=3 SV=1 | 220 | 560 | 4.0E-47 |
sp|Q4ZVN9|SYC_PSEU2 | Cysteine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cysS PE=3 SV=1 | 209 | 527 | 4.0E-47 |
sp|Q7V0W1|SYC_PROMP | Cysteine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=cysS PE=3 SV=1 | 220 | 453 | 4.0E-47 |
sp|A5IBG0|SYC_LEGPC | Cysteine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=cysS PE=3 SV=1 | 204 | 558 | 4.0E-47 |
sp|Q5WX29|SYC_LEGPL | Cysteine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=cysS PE=3 SV=1 | 204 | 558 | 4.0E-47 |
sp|Q47HK6|SYC_DECAR | Cysteine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=cysS PE=3 SV=1 | 194 | 562 | 4.0E-47 |
sp|Q1QVV6|SYC_CHRSD | Cysteine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysS PE=3 SV=1 | 212 | 604 | 4.0E-47 |
sp|A6U7D9|SYC_SINMW | Cysteine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=cysS PE=3 SV=1 | 212 | 442 | 5.0E-47 |
sp|Q3K3G5|SYC_STRA1 | Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=cysS PE=3 SV=1 | 213 | 546 | 5.0E-47 |
sp|Q3SHN1|SYC_THIDA | Cysteine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=cysS PE=3 SV=1 | 212 | 527 | 5.0E-47 |
sp|P43816|SYC_HAEIN | Cysteine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cysS PE=3 SV=1 | 198 | 444 | 5.0E-47 |
sp|Q0AM03|SYC_MARMM | Cysteine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=cysS PE=3 SV=1 | 211 | 562 | 5.0E-47 |
sp|Q67JP9|SYC_SYMTH | Cysteine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cysS PE=3 SV=1 | 210 | 564 | 5.0E-47 |
sp|Q5UP36|SYC_MIMIV | Cysteine--tRNA ligase OS=Acanthamoeba polyphaga mimivirus GN=CARS PE=3 SV=1 | 211 | 472 | 6.0E-47 |
sp|Q99XZ9|SYC_STRP1 | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=cysS PE=3 SV=1 | 220 | 419 | 7.0E-47 |
sp|B0UVH6|SYC_HISS2 | Cysteine--tRNA ligase OS=Histophilus somni (strain 2336) GN=cysS PE=3 SV=1 | 198 | 558 | 7.0E-47 |
sp|Q5X9W5|SYC_STRP6 | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=cysS PE=3 SV=1 | 220 | 419 | 8.0E-47 |
sp|P0DG33|SYC_STRPQ | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=cysS PE=3 SV=1 | 220 | 419 | 8.0E-47 |
sp|P0DG32|SYC_STRP3 | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=cysS PE=3 SV=1 | 220 | 419 | 8.0E-47 |
sp|Q3ZAD5|SYC_DEHM1 | Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=cysS PE=3 SV=1 | 219 | 444 | 9.0E-47 |
sp|B9MMM6|SYC_CALBD | Cysteine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=cysS PE=3 SV=1 | 220 | 528 | 9.0E-47 |
sp|Q0T776|SYC_SHIF8 | Cysteine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=cysS PE=3 SV=2 | 209 | 558 | 1.0E-46 |
sp|Q1RF08|SYC_ECOUT | Cysteine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|B6I0H1|SYC_ECOSE | Cysteine--tRNA ligase OS=Escherichia coli (strain SE11) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|B1IZ75|SYC_ECOLC | Cysteine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|Q8FK44|SYC_ECOL6 | Cysteine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|A1A8J2|SYC_ECOK1 | Cysteine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|A7ZXI1|SYC_ECOHS | Cysteine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|B7M4M9|SYC_ECO8A | Cysteine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|B7MRI9|SYC_ECO81 | Cysteine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|B7NL20|SYC_ECO7I | Cysteine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|B7L7F3|SYC_ECO55 | Cysteine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|B7ME49|SYC_ECO45 | Cysteine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|A7ZIT5|SYC_ECO24 | Cysteine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|B7N980|SYC_ECOLU | Cysteine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|Q48RA7|SYC_STRPM | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=cysS PE=3 SV=1 | 220 | 419 | 1.0E-46 |
sp|Q0TKB5|SYC_ECOL5 | Cysteine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|B7UKK3|SYC_ECO27 | Cysteine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|Q83M27|SYC_SHIFL | Cysteine--tRNA ligase OS=Shigella flexneri GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-46 |
sp|Q39ZL8|SYC_GEOMG | Cysteine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=cysS PE=3 SV=1 | 220 | 556 | 1.0E-46 |
sp|Q1IBP9|SYC_PSEE4 | Cysteine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=cysS PE=3 SV=1 | 209 | 444 | 1.0E-46 |
sp|Q5X5P9|SYC_LEGPA | Cysteine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=cysS PE=3 SV=1 | 211 | 558 | 1.0E-46 |
sp|Q48L06|SYC_PSE14 | Cysteine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cysS PE=3 SV=1 | 209 | 544 | 2.0E-46 |
sp|B1LKE5|SYC_ECOSM | Cysteine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysS PE=3 SV=1 | 209 | 558 | 2.0E-46 |
sp|C4LG04|SYC_TOLAT | Cysteine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysS PE=3 SV=1 | 223 | 558 | 2.0E-46 |
sp|P21888|SYC_ECOLI | Cysteine--tRNA ligase OS=Escherichia coli (strain K12) GN=cysS PE=1 SV=2 | 209 | 558 | 2.0E-46 |
sp|B1XGC4|SYC_ECODH | Cysteine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=cysS PE=3 SV=1 | 209 | 558 | 2.0E-46 |
sp|C4ZUX4|SYC_ECOBW | Cysteine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysS PE=3 SV=1 | 209 | 558 | 2.0E-46 |
sp|C3JYD3|SYC_PSEFS | Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=cysS PE=3 SV=1 | 209 | 444 | 2.0E-46 |
sp|Q324Y3|SYC_SHIBS | Cysteine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=cysS PE=3 SV=1 | 209 | 558 | 2.0E-46 |
sp|Q5ZVY1|SYC_LEGPH | Cysteine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=cysS PE=3 SV=1 | 211 | 558 | 2.0E-46 |
sp|B5YPP1|SYC_ECO5E | Cysteine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysS PE=3 SV=1 | 209 | 558 | 2.0E-46 |
sp|Q8XCT9|SYC_ECO57 | Cysteine--tRNA ligase OS=Escherichia coli O157:H7 GN=cysS PE=3 SV=1 | 209 | 558 | 2.0E-46 |
sp|Q9JXE6|SYC_NEIMB | Cysteine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysS PE=3 SV=1 | 212 | 541 | 2.0E-46 |
sp|B7LJI4|SYC_ESCF3 | Cysteine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysS PE=3 SV=1 | 209 | 558 | 2.0E-46 |
sp|Q7U8C0|SYC_SYNPX | Cysteine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=cysS PE=3 SV=1 | 207 | 435 | 2.0E-46 |
sp|Q3Z4P5|SYC_SHISS | Cysteine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=cysS PE=3 SV=1 | 209 | 558 | 3.0E-46 |
sp|Q8NZD1|SYC_STRP8 | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=cysS PE=3 SV=1 | 220 | 419 | 3.0E-46 |
sp|Q87YQ2|SYC_PSESM | Cysteine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysS PE=3 SV=1 | 209 | 527 | 3.0E-46 |
sp|Q0VML5|SYC_ALCBS | Cysteine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=cysS PE=3 SV=1 | 209 | 460 | 3.0E-46 |
sp|B8EMY2|SYC_METSB | Cysteine--tRNA ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=cysS PE=3 SV=1 | 212 | 417 | 4.0E-46 |
sp|Q4JCA6|SYC_SULAC | Cysteine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cysS PE=3 SV=1 | 214 | 449 | 4.0E-46 |
sp|B2TTB3|SYC_SHIB3 | Cysteine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysS PE=3 SV=1 | 209 | 558 | 4.0E-46 |
sp|A4YIG5|SYC_METS5 | Cysteine--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=cysS PE=3 SV=1 | 230 | 449 | 4.0E-46 |
sp|Q2NV45|SYC_SODGM | Cysteine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=cysS PE=3 SV=1 | 209 | 558 | 4.0E-46 |
sp|A0L4P8|SYC_MAGMM | Cysteine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=cysS PE=3 SV=1 | 202 | 559 | 4.0E-46 |
sp|B4U570|SYC_STREM | Cysteine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=cysS PE=3 SV=1 | 220 | 419 | 4.0E-46 |
sp|Q60BG8|SYC_METCA | Cysteine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysS PE=3 SV=1 | 212 | 586 | 5.0E-46 |
sp|B9JCA5|SYC_AGRRK | Cysteine--tRNA ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=cysS PE=3 SV=1 | 212 | 477 | 5.0E-46 |
sp|C0R1J9|SYC_BRAHW | Cysteine--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=cysS PE=3 SV=1 | 165 | 558 | 5.0E-46 |
sp|Q8ETZ9|SYC_OCEIH | Cysteine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cysS PE=3 SV=1 | 220 | 559 | 5.0E-46 |
sp|Q7NMB5|SYC_GLOVI | Cysteine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=cysS PE=3 SV=1 | 220 | 452 | 5.0E-46 |
sp|Q8YAB1|SYC_LISMO | Cysteine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cysS PE=3 SV=1 | 220 | 555 | 5.0E-46 |
sp|A9KSM5|SYC_CLOPH | Cysteine--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=cysS PE=3 SV=1 | 220 | 560 | 5.0E-46 |
sp|Q5M6F6|SYC_STRT2 | Cysteine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=cysS PE=3 SV=1 | 220 | 419 | 5.0E-46 |
sp|Q5M1W6|SYC_STRT1 | Cysteine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=cysS PE=3 SV=1 | 220 | 419 | 5.0E-46 |
sp|Q92R20|SYC_RHIME | Cysteine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=cysS PE=3 SV=1 | 212 | 442 | 6.0E-46 |
sp|B8GNT5|SYC_THISH | Cysteine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cysS PE=3 SV=1 | 212 | 536 | 6.0E-46 |
sp|C4Z3N5|SYC_EUBE2 | Cysteine--tRNA ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=cysS PE=3 SV=1 | 222 | 558 | 6.0E-46 |
sp|B2IEE1|SYC_BEII9 | Cysteine--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=cysS PE=3 SV=1 | 164 | 431 | 6.0E-46 |
sp|Q3AZ17|SYC_SYNS9 | Cysteine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=cysS PE=3 SV=1 | 194 | 435 | 6.0E-46 |
sp|C5B8V6|SYC_EDWI9 | Cysteine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=cysS PE=3 SV=1 | 205 | 558 | 7.0E-46 |
sp|Q3A8C9|SYC_PELCD | Cysteine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=cysS PE=3 SV=1 | 220 | 442 | 7.0E-46 |
sp|C1DHE6|SYC_AZOVD | Cysteine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=cysS PE=3 SV=1 | 209 | 532 | 7.0E-46 |
sp|A4G4M2|SYC_HERAR | Cysteine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=cysS PE=3 SV=1 | 209 | 558 | 7.0E-46 |
sp|A4IJG8|SYC_GEOTN | Cysteine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cysS PE=3 SV=1 | 220 | 558 | 7.0E-46 |
sp|Q5MZA4|SYC_SYNP6 | Cysteine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cysS PE=3 SV=1 | 214 | 563 | 7.0E-46 |
sp|Q31MM7|SYC_SYNE7 | Cysteine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=cysS PE=3 SV=1 | 214 | 563 | 7.0E-46 |
sp|Q74MI1|SYC_NANEQ | Cysteine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=cysS PE=3 SV=1 | 161 | 547 | 8.0E-46 |
sp|Q8Y077|SYC_RALSO | Cysteine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=cysS PE=3 SV=1 | 212 | 558 | 8.0E-46 |
sp|Q30ZH8|SYC_DESAG | Cysteine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=cysS PE=3 SV=1 | 210 | 556 | 8.0E-46 |
sp|A1U1Q7|SYC_MARHV | Cysteine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=cysS PE=3 SV=1 | 208 | 449 | 8.0E-46 |
sp|B8DF15|SYC_LISMH | Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=cysS PE=3 SV=1 | 220 | 555 | 8.0E-46 |
sp|Q724H3|SYC_LISMF | Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cysS PE=3 SV=1 | 220 | 555 | 8.0E-46 |
sp|C1KYH2|SYC_LISMC | Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=cysS PE=3 SV=1 | 220 | 555 | 8.0E-46 |
sp|Q8DWA9|SYC_STRMU | Cysteine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=cysS PE=3 SV=1 | 213 | 419 | 1.0E-45 |
sp|A4W7I4|SYC_ENT38 | Cysteine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=cysS PE=3 SV=2 | 209 | 449 | 1.0E-45 |
sp|Q32JL0|SYC_SHIDS | Cysteine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysS PE=3 SV=1 | 209 | 558 | 1.0E-45 |
sp|C5D3P6|SYC_GEOSW | Cysteine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=cysS PE=3 SV=1 | 220 | 558 | 2.0E-45 |
sp|Q8DHW6|SYC_THEEB | Cysteine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=cysS PE=3 SV=2 | 220 | 453 | 2.0E-45 |
sp|A5FP90|SYC_DEHMB | Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=cysS PE=3 SV=1 | 219 | 444 | 2.0E-45 |
sp|A4VL73|SYC_PSEU5 | Cysteine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=cysS PE=3 SV=2 | 209 | 527 | 2.0E-45 |
sp|Q5L429|SYC_GEOKA | Cysteine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=cysS PE=3 SV=1 | 220 | 558 | 2.0E-45 |
sp|Q1LTX2|SYC_BAUCH | Cysteine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysS PE=3 SV=1 | 212 | 558 | 2.0E-45 |
sp|A9AHN6|SYC_BURM1 | Cysteine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=cysS PE=3 SV=1 | 212 | 541 | 2.0E-45 |
sp|Q63SS8|SYC_BURPS | Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=cysS PE=3 SV=1 | 212 | 527 | 3.0E-45 |
sp|A3NB50|SYC_BURP6 | Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=cysS PE=3 SV=1 | 212 | 527 | 3.0E-45 |
sp|Q3JQT6|SYC_BURP1 | Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=cysS PE=3 SV=1 | 212 | 527 | 3.0E-45 |
sp|A3NWX8|SYC_BURP0 | Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=cysS PE=3 SV=1 | 212 | 527 | 3.0E-45 |
sp|A1V5G8|SYC_BURMS | Cysteine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=cysS PE=3 SV=1 | 212 | 527 | 3.0E-45 |
sp|Q62J37|SYC_BURMA | Cysteine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=cysS PE=3 SV=1 | 212 | 527 | 3.0E-45 |
sp|A2SAX8|SYC_BURM9 | Cysteine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=cysS PE=3 SV=1 | 212 | 527 | 3.0E-45 |
sp|A3ML43|SYC_BURM7 | Cysteine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=cysS PE=3 SV=1 | 212 | 527 | 3.0E-45 |
sp|Q6MKR7|SYC_BDEBA | Cysteine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=cysS PE=3 SV=1 | 210 | 562 | 3.0E-45 |
sp|B7K7T8|SYC_CYAP7 | Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=cysS PE=3 SV=1 | 215 | 454 | 4.0E-45 |
sp|Q92F36|SYC_LISIN | Cysteine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cysS PE=3 SV=1 | 220 | 555 | 4.0E-45 |
sp|Q9WZH8|SYC_THEMA | Cysteine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cysS PE=3 SV=1 | 214 | 559 | 5.0E-45 |
sp|Q984X8|SYC_RHILO | Cysteine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=cysS PE=3 SV=1 | 212 | 451 | 5.0E-45 |
sp|Q2W7Y5|SYC_MAGSA | Cysteine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=cysS PE=3 SV=1 | 212 | 533 | 5.0E-45 |
sp|A4WH15|SYC_PYRAR | Cysteine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=cysS PE=3 SV=1 | 237 | 565 | 5.0E-45 |
sp|A0QAB5|SYC_MYCA1 | Cysteine--tRNA ligase OS=Mycobacterium avium (strain 104) GN=cysS PE=3 SV=1 | 215 | 559 | 6.0E-45 |
sp|B4F1M6|SYC_PROMH | Cysteine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=cysS PE=3 SV=1 | 194 | 558 | 6.0E-45 |
sp|B1J805|SYC_PSEPW | Cysteine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=cysS PE=3 SV=1 | 209 | 444 | 6.0E-45 |
sp|A6T5R2|SYC_KLEP7 | Cysteine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysS PE=3 SV=1 | 209 | 449 | 6.0E-45 |
sp|B5Y0K6|SYC_KLEP3 | Cysteine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=cysS PE=3 SV=1 | 209 | 449 | 6.0E-45 |
sp|Q74L26|SYC_LACJO | Cysteine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=cysS PE=3 SV=1 | 220 | 558 | 7.0E-45 |
sp|A4J0Y9|SYC_DESRM | Cysteine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=cysS PE=3 SV=1 | 214 | 418 | 7.0E-45 |
sp|Q9PLE0|SYC_CHLMU | Cysteine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=cysS PE=3 SV=1 | 220 | 435 | 8.0E-45 |
sp|A0AF38|SYC_LISW6 | Cysteine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=cysS PE=3 SV=1 | 220 | 555 | 8.0E-45 |
sp|Q3ZWG4|SYC_DEHMC | Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=cysS PE=3 SV=1 | 219 | 444 | 1.0E-44 |
sp|Q045X8|SYC_LACGA | Cysteine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=cysS PE=3 SV=1 | 220 | 534 | 1.0E-44 |
sp|Q5F5D6|SYC_NEIG1 | Cysteine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=cysS PE=3 SV=1 | 222 | 545 | 1.0E-44 |
sp|A1JNP9|SYC_YERE8 | Cysteine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysS PE=3 SV=1 | 212 | 558 | 1.0E-44 |
sp|Q6N8A7|SYC_RHOPA | Cysteine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysS PE=3 SV=1 | 212 | 547 | 1.0E-44 |
sp|Q02WZ9|SYC_LACLS | Cysteine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=cysS PE=3 SV=1 | 220 | 555 | 1.0E-44 |
sp|Q3KA28|SYC_PSEPF | Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=cysS PE=3 SV=1 | 209 | 444 | 1.0E-44 |
sp|Q5HBK5|SYC_EHRRW | Cysteine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=cysS PE=3 SV=1 | 205 | 527 | 1.0E-44 |
sp|Q8TSP6|SYC_METAC | Cysteine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=cysS PE=3 SV=1 | 211 | 565 | 1.0E-44 |
sp|Q2SX78|SYC_BURTA | Cysteine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=cysS PE=3 SV=1 | 212 | 527 | 2.0E-44 |
sp|Q82GD0|SYC_STRAW | Cysteine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=cysS PE=3 SV=1 | 217 | 559 | 2.0E-44 |
sp|Q13X60|SYC_BURXL | Cysteine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=cysS PE=3 SV=1 | 214 | 527 | 2.0E-44 |
sp|Q8KAK2|SYC_CHLTE | Cysteine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=cysS PE=3 SV=1 | 220 | 535 | 2.0E-44 |
sp|Q8ZYD8|SYC_PYRAE | Cysteine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cysS PE=3 SV=1 | 223 | 565 | 2.0E-44 |
sp|Q2KAA8|SYC_RHIEC | Cysteine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=cysS PE=3 SV=1 | 212 | 442 | 3.0E-44 |
sp|A2RMS1|SYC_LACLM | Cysteine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=cysS PE=3 SV=1 | 220 | 555 | 3.0E-44 |
sp|A0K8K2|SYC_BURCH | Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=cysS PE=3 SV=1 | 214 | 541 | 3.0E-44 |
sp|Q1BHP1|SYC_BURCA | Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=cysS PE=3 SV=1 | 214 | 541 | 3.0E-44 |
sp|A8F962|SYC_BACP2 | Cysteine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=cysS PE=3 SV=1 | 220 | 532 | 3.0E-44 |
sp|Q9JWJ3|SYC_NEIMA | Cysteine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysS PE=3 SV=1 | 211 | 541 | 3.0E-44 |
sp|A3DH43|SYC_CLOTH | Cysteine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=cysS PE=3 SV=1 | 223 | 558 | 3.0E-44 |
sp|B8HQA4|SYC_CYAP4 | Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=cysS PE=3 SV=1 | 220 | 454 | 3.0E-44 |
sp|A3MS54|SYC_PYRCJ | Cysteine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=cysS PE=3 SV=1 | 237 | 558 | 3.0E-44 |
sp|Q743W3|SYC_MYCPA | Cysteine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysS PE=3 SV=1 | 215 | 559 | 3.0E-44 |
sp|Q021Y7|SYC_SOLUE | Cysteine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=cysS PE=3 SV=1 | 213 | 430 | 3.0E-44 |
sp|C4K6G8|SYC_HAMD5 | Cysteine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=cysS PE=3 SV=1 | 212 | 449 | 3.0E-44 |
sp|B5ZWB3|SYC_RHILW | Cysteine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=cysS PE=3 SV=1 | 212 | 455 | 3.0E-44 |
sp|B1MW68|SYC_LEUCK | Cysteine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=cysS PE=3 SV=1 | 220 | 559 | 4.0E-44 |
sp|Q89NP8|SYC_BRADU | Cysteine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysS PE=3 SV=1 | 211 | 418 | 4.0E-44 |
sp|A0LQZ8|SYC_ACIC1 | Cysteine--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=cysS PE=3 SV=1 | 219 | 568 | 4.0E-44 |
sp|Q49V39|SYC_STAS1 | Cysteine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cysS PE=3 SV=1 | 218 | 548 | 5.0E-44 |
sp|Q5FHI9|SYC_EHRRG | Cysteine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=cysS PE=3 SV=1 | 205 | 527 | 5.0E-44 |
sp|A5EHE7|SYC_BRASB | Cysteine--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=cysS PE=3 SV=1 | 211 | 418 | 6.0E-44 |
sp|Q1H417|SYC_METFK | Cysteine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cysS PE=3 SV=1 | 212 | 537 | 6.0E-44 |
sp|B4ED73|SYC_BURCJ | Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=cysS PE=3 SV=1 | 214 | 541 | 6.0E-44 |
sp|Q07Q42|SYC_RHOP5 | Cysteine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=cysS PE=3 SV=1 | 212 | 500 | 6.0E-44 |
sp|B0T101|SYC_CAUSK | Cysteine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=cysS PE=3 SV=1 | 220 | 449 | 6.0E-44 |
sp|Q1QN87|SYC_NITHX | Cysteine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=cysS PE=3 SV=1 | 212 | 419 | 7.0E-44 |
sp|Q0KCA9|SYC_CUPNH | Cysteine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cysS PE=3 SV=1 | 211 | 558 | 7.0E-44 |
sp|O29836|SYC_ARCFU | Cysteine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cysS PE=3 SV=1 | 220 | 558 | 8.0E-44 |
sp|A5W458|SYC_PSEP1 | Cysteine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cysS PE=3 SV=1 | 209 | 444 | 9.0E-44 |
sp|A4JFD0|SYC_BURVG | Cysteine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=cysS PE=3 SV=1 | 214 | 541 | 9.0E-44 |
sp|Q4L3I9|SYC_STAHJ | Cysteine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cysS PE=3 SV=1 | 220 | 417 | 1.0E-43 |
sp|Q048S9|SYC_LACDB | Cysteine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=cysS PE=3 SV=1 | 220 | 561 | 1.0E-43 |
sp|B9DKW3|SYC_STACT | Cysteine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=cysS PE=3 SV=1 | 220 | 548 | 1.0E-43 |
sp|B3R4D1|SYC_CUPTR | Cysteine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=cysS PE=3 SV=1 | 211 | 558 | 1.0E-43 |
sp|B0KUU0|SYC_PSEPG | Cysteine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=cysS PE=3 SV=1 | 209 | 444 | 1.0E-43 |
sp|Q88IU4|SYC_PSEPK | Cysteine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=cysS PE=3 SV=1 | 209 | 561 | 1.0E-43 |
sp|Q6D2E4|SYC_PECAS | Cysteine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysS PE=3 SV=1 | 194 | 558 | 1.0E-43 |
sp|Q8RIK9|SYC_FUSNN | Cysteine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=cysS PE=3 SV=1 | 220 | 530 | 1.0E-43 |
sp|Q493A1|SYC_BLOPB | Cysteine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=cysS PE=3 SV=1 | 212 | 556 | 1.0E-43 |
sp|Q66DK9|SYC_YERPS | Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysS PE=3 SV=1 | 194 | 558 | 1.0E-43 |
sp|B2K7N2|SYC_YERPB | Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cysS PE=3 SV=1 | 194 | 558 | 1.0E-43 |
sp|A4TP63|SYC_YERPP | Cysteine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=cysS PE=3 SV=1 | 194 | 558 | 1.0E-43 |
sp|Q1CKY1|SYC_YERPN | Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysS PE=3 SV=1 | 194 | 558 | 1.0E-43 |
sp|A9R253|SYC_YERPG | Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cysS PE=3 SV=1 | 194 | 558 | 1.0E-43 |
sp|Q8ZCC0|SYC_YERPE | Cysteine--tRNA ligase OS=Yersinia pestis GN=cysS PE=3 SV=1 | 194 | 558 | 1.0E-43 |
sp|Q1C4U1|SYC_YERPA | Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysS PE=3 SV=1 | 194 | 558 | 1.0E-43 |
sp|A7FL46|SYC_YERP3 | Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysS PE=3 SV=1 | 194 | 558 | 1.0E-43 |
sp|B1JUK8|SYC_BURCC | Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=cysS PE=3 SV=1 | 214 | 541 | 2.0E-43 |
sp|Q5P1H8|SYC_AROAE | Cysteine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=cysS PE=3 SV=1 | 222 | 527 | 2.0E-43 |
sp|Q8CTU1|SYC_STAES | Cysteine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysS PE=3 SV=1 | 220 | 417 | 2.0E-43 |
sp|Q5HRM3|SYC_STAEQ | Cysteine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysS PE=3 SV=1 | 220 | 417 | 2.0E-43 |
sp|B8DKL0|SYC_DESVM | Cysteine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=cysS PE=3 SV=1 | 220 | 557 | 2.0E-43 |
sp|B1L7Y7|SYC_THESQ | Cysteine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=cysS PE=3 SV=1 | 214 | 559 | 2.0E-43 |
sp|A5IJ66|SYC_THEP1 | Cysteine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=cysS PE=3 SV=1 | 214 | 559 | 2.0E-43 |
sp|Q8PVQ1|SYC_METMA | Cysteine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=cysS PE=3 SV=1 | 211 | 602 | 2.0E-43 |
sp|Q1MJ22|SYC_RHIL3 | Cysteine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=cysS PE=3 SV=1 | 212 | 442 | 2.0E-43 |
sp|B2GAB5|SYC_LACF3 | Cysteine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=cysS PE=3 SV=1 | 220 | 559 | 2.0E-43 |
sp|Q3STA1|SYC_NITWN | Cysteine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=cysS PE=3 SV=1 | 220 | 419 | 2.0E-43 |
sp|Q139D9|SYC_RHOPS | Cysteine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=cysS PE=3 SV=1 | 212 | 504 | 2.0E-43 |
sp|Q88YX9|SYC_LACPL | Cysteine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cysS PE=3 SV=1 | 220 | 558 | 2.0E-43 |
sp|Q2JTF4|SYC_SYNJA | Cysteine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=cysS PE=3 SV=1 | 194 | 453 | 2.0E-43 |
sp|B1JHJ1|SYC_YERPY | Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cysS PE=3 SV=1 | 194 | 558 | 2.0E-43 |
sp|B1VS94|SYC_STRGG | Cysteine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=cysS PE=3 SV=1 | 217 | 559 | 2.0E-43 |
sp|A6LJ41|SYC_THEM4 | Cysteine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=cysS PE=3 SV=1 | 209 | 556 | 2.0E-43 |
sp|A7HWJ0|SYC_PARL1 | Cysteine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=cysS PE=3 SV=1 | 212 | 562 | 3.0E-43 |
sp|Q9AAY2|SYC_CAUCR | Cysteine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cysS PE=3 SV=1 | 220 | 449 | 3.0E-43 |
sp|B8GZS3|SYC_CAUCN | Cysteine--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cysS PE=3 SV=1 | 220 | 449 | 3.0E-43 |
sp|Q02KT6|SYC_PSEAB | Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysS PE=3 SV=1 | 209 | 465 | 3.0E-43 |
sp|Q839V5|SYC_ENTFA | Cysteine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cysS PE=3 SV=1 | 220 | 558 | 3.0E-43 |
sp|C6BS23|SYC_DESAD | Cysteine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=cysS PE=3 SV=1 | 210 | 523 | 3.0E-43 |
sp|Q87EL7|SYC_XYLFT | Cysteine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysS PE=3 SV=2 | 209 | 532 | 3.0E-43 |
sp|C6DAX2|SYC_PECCP | Cysteine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cysS PE=3 SV=1 | 199 | 558 | 3.0E-43 |
sp|Q39EY8|SYC2_BURL3 | Cysteine--tRNA ligase 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=cysS2 PE=3 SV=1 | 214 | 541 | 3.0E-43 |
sp|Q9I2U7|SYC_PSEAE | Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysS PE=3 SV=1 | 209 | 465 | 4.0E-43 |
sp|B7VB84|SYC_PSEA8 | Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysS PE=3 SV=1 | 209 | 465 | 4.0E-43 |
sp|A6V727|SYC_PSEA7 | Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=cysS PE=3 SV=1 | 209 | 465 | 4.0E-43 |
sp|B3QCS4|SYC_RHOPT | Cysteine--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=cysS PE=3 SV=1 | 212 | 449 | 4.0E-43 |
sp|Q2J545|SYC_FRASC | Cysteine--tRNA ligase OS=Frankia sp. (strain CcI3) GN=cysS PE=3 SV=1 | 204 | 568 | 4.0E-43 |
sp|B1YSM8|SYC_BURA4 | Cysteine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=cysS PE=3 SV=1 | 214 | 527 | 4.0E-43 |
sp|Q1G8Z0|SYC_LACDA | Cysteine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=cysS PE=3 SV=1 | 220 | 561 | 5.0E-43 |
sp|Q6GJD9|SYC_STAAR | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=cysS PE=3 SV=1 | 220 | 417 | 5.0E-43 |
sp|B2G5S5|SYC_LACRJ | Cysteine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=cysS PE=3 SV=1 | 220 | 562 | 5.0E-43 |
sp|A5VI99|SYC_LACRD | Cysteine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=cysS PE=3 SV=1 | 220 | 562 | 5.0E-43 |
sp|Q5WLT3|SYC_BACSK | Cysteine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=cysS PE=3 SV=1 | 220 | 534 | 5.0E-43 |
sp|Q0BXB7|SYC_HYPNA | Cysteine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=cysS PE=3 SV=1 | 212 | 449 | 6.0E-43 |
sp|B7JUH4|SYC_CYAP8 | Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=cysS PE=3 SV=1 | 220 | 452 | 6.0E-43 |
sp|Q9PEN3|SYC_XYLFA | Cysteine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=cysS PE=3 SV=2 | 209 | 532 | 6.0E-43 |
sp|A9BGT9|SYC_PETMO | Cysteine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=cysS PE=3 SV=1 | 209 | 604 | 6.0E-43 |
sp|A5EWG6|SYC_DICNV | Cysteine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=cysS PE=3 SV=1 | 212 | 442 | 6.0E-43 |
sp|Q38UZ6|SYC_LACSS | Cysteine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=cysS PE=3 SV=1 | 220 | 597 | 7.0E-43 |
sp|Q5FM34|SYC_LACAC | Cysteine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=cysS PE=3 SV=1 | 211 | 559 | 7.0E-43 |
sp|Q8NXY7|SYC_STAAW | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=cysS PE=3 SV=1 | 220 | 417 | 8.0E-43 |
sp|Q6GBV8|SYC_STAAS | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=cysS PE=3 SV=1 | 220 | 417 | 8.0E-43 |
sp|B2U9P8|SYC_RALPJ | Cysteine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=cysS PE=3 SV=1 | 222 | 559 | 8.0E-43 |
sp|Q0BDV4|SYC_BURCM | Cysteine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=cysS PE=3 SV=1 | 214 | 541 | 9.0E-43 |
sp|Q9RTT6|SYC_DEIRA | Cysteine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=cysS PE=3 SV=2 | 220 | 530 | 9.0E-43 |
sp|Q99W73|SYC_STAAN | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=cysS PE=1 SV=1 | 220 | 417 | 1.0E-42 |
sp|Q932G0|SYC_STAAM | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cysS PE=3 SV=2 | 220 | 417 | 1.0E-42 |
sp|A5IQ83|SYC_STAA9 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=cysS PE=3 SV=1 | 220 | 417 | 1.0E-42 |
sp|A6TZ06|SYC_STAA2 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=cysS PE=3 SV=1 | 220 | 417 | 1.0E-42 |
sp|A7WYU7|SYC_STAA1 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cysS PE=3 SV=1 | 220 | 417 | 1.0E-42 |
sp|A1RTJ7|SYC_PYRIL | Cysteine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=cysS PE=3 SV=1 | 237 | 473 | 1.0E-42 |
sp|Q47TG4|SYC_THEFY | Cysteine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=cysS PE=3 SV=1 | 220 | 559 | 1.0E-42 |
sp|A8YZM7|SYC_STAAT | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cysS PE=3 SV=2 | 220 | 417 | 1.0E-42 |
sp|A6QEI2|SYC_STAAE | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=cysS PE=3 SV=1 | 220 | 417 | 1.0E-42 |
sp|Q5HIE5|SYC_STAAC | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=cysS PE=3 SV=1 | 220 | 417 | 1.0E-42 |
sp|Q2G2M6|SYC_STAA8 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=cysS PE=3 SV=1 | 220 | 417 | 1.0E-42 |
sp|Q2FJB0|SYC_STAA3 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=cysS PE=3 SV=1 | 220 | 417 | 1.0E-42 |
sp|B2HJ21|SYC_MYCMM | Cysteine--tRNA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=cysS PE=3 SV=1 | 209 | 417 | 1.0E-42 |
sp|A0PV27|SYC_MYCUA | Cysteine--tRNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=cysS PE=3 SV=1 | 209 | 417 | 1.0E-42 |
sp|C1BAC4|SYC_RHOOB | Cysteine--tRNA ligase OS=Rhodococcus opacus (strain B4) GN=cysS PE=3 SV=1 | 209 | 417 | 1.0E-42 |
sp|B0JJL5|SYC_MICAN | Cysteine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=cysS PE=3 SV=1 | 220 | 453 | 1.0E-42 |
sp|Q9Z6X4|SYC_CHLPN | Cysteine--tRNA ligase OS=Chlamydia pneumoniae GN=cysS PE=3 SV=1 | 211 | 435 | 1.0E-42 |
sp|B4RE90|SYC_PHEZH | Cysteine--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=cysS PE=3 SV=1 | 220 | 536 | 1.0E-42 |
sp|Q0S888|SYC_RHOJR | Cysteine--tRNA ligase OS=Rhodococcus jostii (strain RHA1) GN=cysS PE=3 SV=1 | 209 | 417 | 1.0E-42 |
sp|B0S0W3|SYC_FINM2 | Cysteine--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=cysS PE=3 SV=1 | 204 | 451 | 2.0E-42 |
sp|Q2JKL2|SYC_SYNJB | Cysteine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=cysS PE=3 SV=1 | 194 | 539 | 2.0E-42 |
sp|O84787|SYC_CHLTR | Cysteine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=cysS PE=3 SV=2 | 220 | 435 | 2.0E-42 |
sp|B1XND1|SYC_SYNP2 | Cysteine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=cysS PE=3 SV=1 | 220 | 453 | 2.0E-42 |
sp|Q2YSD1|SYC_STAAB | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cysS PE=3 SV=1 | 220 | 417 | 2.0E-42 |
sp|Q03SU6|SYC_LACBA | Cysteine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=cysS PE=3 SV=1 | 220 | 419 | 2.0E-42 |
sp|Q3KKR0|SYC_CHLTA | Cysteine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=cysS PE=3 SV=2 | 220 | 435 | 2.0E-42 |
sp|B9KAQ8|SYC_THENN | Cysteine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=cysS PE=3 SV=1 | 220 | 559 | 2.0E-42 |
sp|Q8SRE0|SYC_ENCCU | Cysteine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0490 PE=1 SV=1 | 3 | 82 | 1.0E-19 |
sp|Q54ZY3|SYCM_DICDI | Probable cysteine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=mcysS PE=3 SV=1 | 4 | 93 | 1.0E-19 |
sp|O58370|SYC_PYRHO | Cysteine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=cysS PE=3 SV=1 | 2 | 83 | 2.0E-18 |
sp|Q8U227|SYC_PYRFU | Cysteine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=cysS PE=3 SV=2 | 4 | 83 | 2.0E-18 |
sp|Q8BYM8|SYCM_MOUSE | Probable cysteine--tRNA ligase, mitochondrial OS=Mus musculus GN=Cars2 PE=1 SV=2 | 4 | 82 | 5.0E-18 |
sp|Q5MZA4|SYC_SYNP6 | Cysteine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cysS PE=3 SV=1 | 2 | 85 | 5.0E-18 |
sp|Q31MM7|SYC_SYNE7 | Cysteine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=cysS PE=3 SV=1 | 2 | 85 | 5.0E-18 |
sp|Q54KR1|SYCC_DICDI | Cysteine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=cysS PE=3 SV=1 | 4 | 70 | 6.0E-18 |
sp|A1RYM3|SYC_THEPD | Cysteine--tRNA ligase OS=Thermofilum pendens (strain Hrk 5) GN=cysS PE=3 SV=1 | 4 | 105 | 6.0E-18 |
sp|Q5JD45|SYC_THEKO | Cysteine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cysS PE=3 SV=1 | 2 | 82 | 9.0E-18 |
sp|A6VG07|SYC_METM7 | Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=cysS PE=3 SV=1 | 4 | 109 | 1.0E-17 |
sp|A6VX53|SYC_MARMS | Cysteine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-17 |
sp|B8HQA4|SYC_CYAP4 | Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-17 |
sp|B6YUQ3|SYC_THEON | Cysteine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=cysS PE=3 SV=1 | 2 | 82 | 2.0E-17 |
sp|C5A739|SYC_THEGJ | Cysteine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=cysS PE=3 SV=1 | 2 | 82 | 2.0E-17 |
sp|A9AAN8|SYC_METM6 | Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-17 |
sp|Q9HA77|SYCM_HUMAN | Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens GN=CARS2 PE=1 SV=1 | 2 | 82 | 3.0E-17 |
sp|A5GM79|SYC_SYNPW | Cysteine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=cysS PE=3 SV=1 | 2 | 82 | 4.0E-17 |
sp|Q9UYV2|SYC_PYRAB | Cysteine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=cysS PE=3 SV=1 | 2 | 83 | 6.0E-17 |
sp|A6UP68|SYC_METVS | Cysteine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=cysS PE=3 SV=1 | 4 | 82 | 7.0E-17 |
sp|Q6LYD1|SYC_METMP | Cysteine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-16 |
sp|C0QRE6|SYC_PERMH | Cysteine--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=cysS PE=3 SV=1 | 2 | 87 | 1.0E-16 |
sp|C3LNF1|SYC_VIBCM | Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-16 |
sp|Q9KQZ9|SYC_VIBCH | Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-16 |
sp|A5F763|SYC_VIBC3 | Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-16 |
sp|Q87QJ9|SYC_VIBPA | Cysteine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-16 |
sp|A1WT89|SYC_HALHL | Cysteine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-16 |
sp|B7VGZ1|SYC_VIBTL | Cysteine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-16 |
sp|B7K7T8|SYC_CYAP7 | Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=cysS PE=3 SV=1 | 2 | 85 | 1.0E-16 |
sp|Q8KAK2|SYC_CHLTE | Cysteine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=cysS PE=3 SV=1 | 1 | 91 | 1.0E-16 |
sp|Q2KIF8|SYCM_BOVIN | Cysteine--tRNA ligase, mitochondrial OS=Bos taurus GN=CARS2 PE=2 SV=1 | 4 | 82 | 2.0E-16 |
sp|Q8D8R1|SYC_VIBVU | Cysteine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=cysS PE=3 SV=2 | 4 | 82 | 2.0E-16 |
sp|Q7MLR5|SYC_VIBVY | Cysteine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=cysS PE=3 SV=2 | 4 | 82 | 2.0E-16 |
sp|B2V6B4|SYC_SULSY | Cysteine--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=cysS PE=3 SV=1 | 2 | 87 | 2.0E-16 |
sp|A2C808|SYC_PROM3 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=cysS PE=3 SV=2 | 2 | 87 | 2.0E-16 |
sp|Q7U8C0|SYC_SYNPX | Cysteine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=cysS PE=3 SV=1 | 2 | 85 | 2.0E-16 |
sp|Q3AZ17|SYC_SYNS9 | Cysteine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=cysS PE=3 SV=1 | 2 | 82 | 2.0E-16 |
sp|C5B8V6|SYC_EDWI9 | Cysteine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-16 |
sp|B3GXR0|SYC_ACTP7 | Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-16 |
sp|B9LZV4|SYC_GEODF | Cysteine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=cysS PE=3 SV=1 | 2 | 85 | 3.0E-16 |
sp|B6EH43|SYC_ALISL | Cysteine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-16 |
sp|Q6LT67|SYC1_PHOPR | Cysteine--tRNA ligase 1 OS=Photobacterium profundum GN=cysS1 PE=3 SV=1 | 4 | 82 | 3.0E-16 |
sp|A0Q4Q1|SYC_FRATN | Cysteine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=cysS PE=3 SV=1 | 6 | 82 | 3.0E-16 |
sp|Q03ZR0|SYC_LEUMM | Cysteine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=cysS PE=3 SV=1 | 4 | 91 | 3.0E-16 |
sp|A4IWF2|SYC_FRATW | Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cysS PE=3 SV=1 | 6 | 82 | 3.0E-16 |
sp|Q0BKI3|SYC_FRATO | Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=cysS PE=3 SV=1 | 6 | 82 | 3.0E-16 |
sp|Q2A1T7|SYC_FRATH | Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=cysS PE=3 SV=1 | 6 | 82 | 3.0E-16 |
sp|A7NE53|SYC_FRATF | Cysteine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=cysS PE=3 SV=1 | 6 | 82 | 3.0E-16 |
sp|Q10XJ9|SYC_TRIEI | Cysteine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=cysS PE=3 SV=1 | 2 | 83 | 3.0E-16 |
sp|Q5NEL1|SYC_FRATT | Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cysS PE=3 SV=1 | 6 | 82 | 3.0E-16 |
sp|Q14G14|SYC_FRAT1 | Cysteine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cysS PE=3 SV=1 | 6 | 82 | 3.0E-16 |
sp|O67163|SYC_AQUAE | Cysteine--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=cysS PE=3 SV=1 | 2 | 85 | 4.0E-16 |
sp|Q7V6K0|SYC_PROMM | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=cysS PE=3 SV=2 | 2 | 82 | 4.0E-16 |
sp|Q67JP9|SYC_SYMTH | Cysteine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=cysS PE=3 SV=1 | 2 | 85 | 5.0E-16 |
sp|B0JJL5|SYC_MICAN | Cysteine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=cysS PE=3 SV=1 | 2 | 86 | 5.0E-16 |
sp|Q5E4F1|SYC_VIBF1 | Cysteine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysS PE=3 SV=1 | 4 | 82 | 6.0E-16 |
sp|Q7NMB5|SYC_GLOVI | Cysteine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=cysS PE=3 SV=1 | 2 | 85 | 6.0E-16 |
sp|A3N0S3|SYC_ACTP2 | Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cysS PE=3 SV=1 | 4 | 82 | 7.0E-16 |
sp|B0BPJ8|SYC_ACTPJ | Cysteine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cysS PE=3 SV=1 | 4 | 82 | 7.0E-16 |
sp|A6TWK5|SYC_ALKMQ | Cysteine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=cysS PE=3 SV=1 | 4 | 140 | 7.0E-16 |
sp|C4LG04|SYC_TOLAT | Cysteine--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysS PE=3 SV=1 | 4 | 82 | 7.0E-16 |
sp|C0R1J9|SYC_BRAHW | Cysteine--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=cysS PE=3 SV=1 | 1 | 87 | 8.0E-16 |
sp|Q65UY1|SYC_MANSM | Cysteine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cysS PE=3 SV=2 | 4 | 82 | 1.0E-15 |
sp|Q0A7N3|SYC_ALKEH | Cysteine--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cysS PE=3 SV=2 | 4 | 82 | 1.0E-15 |
sp|A7HDA1|SYC_ANADF | Cysteine--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=cysS PE=3 SV=1 | 18 | 86 | 1.0E-15 |
sp|B2SFH9|SYC_FRATM | Cysteine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=cysS PE=3 SV=1 | 6 | 82 | 1.0E-15 |
sp|Q07ZX5|SYC_SHEFN | Cysteine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|A6SZV1|SYC_JANMA | Cysteine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=cysS PE=3 SV=1 | 1 | 149 | 1.0E-15 |
sp|A6T5R2|SYC_KLEP7 | Cysteine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|B5Y0K6|SYC_KLEP3 | Cysteine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|Q3ZWG4|SYC_DEHMC | Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-15 |
sp|Q66DK9|SYC_YERPS | Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|B2K7N2|SYC_YERPB | Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|A4TP63|SYC_YERPP | Cysteine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|Q1CKY1|SYC_YERPN | Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|A9R253|SYC_YERPG | Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|Q8ZCC0|SYC_YERPE | Cysteine--tRNA ligase OS=Yersinia pestis GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|Q1C4U1|SYC_YERPA | Cysteine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|A7FL46|SYC_YERP3 | Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|B1JHJ1|SYC_YERPY | Cysteine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|C6DAX2|SYC_PECCP | Cysteine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-15 |
sp|Q5FM34|SYC_LACAC | Cysteine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=cysS PE=3 SV=1 | 1 | 87 | 1.0E-15 |
sp|Q12L98|SYC_SHEDO | Cysteine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B0U0I3|SYC_FRAP2 | Cysteine--tRNA ligase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=cysS PE=3 SV=1 | 6 | 132 | 2.0E-15 |
sp|Q7VMA0|SYC_HAEDU | Cysteine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|A8FTH6|SYC_SHESH | Cysteine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=cysS PE=3 SV=1 | 4 | 86 | 2.0E-15 |
sp|A1RL92|SYC_SHESW | Cysteine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=cysS PE=3 SV=1 | 1 | 82 | 2.0E-15 |
sp|A4Y5H9|SYC_SHEPC | Cysteine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cysS PE=3 SV=1 | 1 | 82 | 2.0E-15 |
sp|Q83BL7|SYC_COXBU | Cysteine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cysS PE=1 SV=2 | 2 | 82 | 2.0E-15 |
sp|A9MLA7|SYC_SALAR | Cysteine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q04DQ8|SYC_OENOB | Cysteine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=cysS PE=3 SV=1 | 18 | 119 | 2.0E-15 |
sp|Q8ZR68|SYC_SALTY | Cysteine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|C0PVI8|SYC_SALPC | Cysteine--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B5R6X0|SYC_SALG2 | Cysteine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B5QUV0|SYC_SALEP | Cysteine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q57S29|SYC_SALCH | Cysteine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B5EYD7|SYC_SALA4 | Cysteine--tRNA ligase OS=Salmonella agona (strain SL483) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q8Z8P6|SYC_SALTI | Cysteine--tRNA ligase OS=Salmonella typhi GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B4TN59|SYC_SALSV | Cysteine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B5BCZ8|SYC_SALPK | Cysteine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|A9MW31|SYC_SALPB | Cysteine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q5PCE2|SYC_SALPA | Cysteine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B4SXP2|SYC_SALNS | Cysteine--tRNA ligase OS=Salmonella newport (strain SL254) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B4TA89|SYC_SALHS | Cysteine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B5FLP7|SYC_SALDC | Cysteine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B0UVH6|SYC_HISS2 | Cysteine--tRNA ligase OS=Histophilus somni (strain 2336) GN=cysS PE=3 SV=1 | 4 | 95 | 2.0E-15 |
sp|Q3ZAD5|SYC_DEHM1 | Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=cysS PE=3 SV=1 | 4 | 85 | 2.0E-15 |
sp|Q0T776|SYC_SHIF8 | Cysteine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=cysS PE=3 SV=2 | 4 | 82 | 2.0E-15 |
sp|Q1RF08|SYC_ECOUT | Cysteine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B6I0H1|SYC_ECOSE | Cysteine--tRNA ligase OS=Escherichia coli (strain SE11) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B1IZ75|SYC_ECOLC | Cysteine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q8FK44|SYC_ECOL6 | Cysteine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|A1A8J2|SYC_ECOK1 | Cysteine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|A7ZXI1|SYC_ECOHS | Cysteine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B7M4M9|SYC_ECO8A | Cysteine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B7MRI9|SYC_ECO81 | Cysteine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B7NL20|SYC_ECO7I | Cysteine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B7L7F3|SYC_ECO55 | Cysteine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B7ME49|SYC_ECO45 | Cysteine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|A7ZIT5|SYC_ECO24 | Cysteine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q0TKB5|SYC_ECOL5 | Cysteine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B7UKK3|SYC_ECO27 | Cysteine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q83M27|SYC_SHIFL | Cysteine--tRNA ligase OS=Shigella flexneri GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B1LKE5|SYC_ECOSM | Cysteine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|P21888|SYC_ECOLI | Cysteine--tRNA ligase OS=Escherichia coli (strain K12) GN=cysS PE=1 SV=2 | 4 | 82 | 2.0E-15 |
sp|B1XGC4|SYC_ECODH | Cysteine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|C4ZUX4|SYC_ECOBW | Cysteine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q324Y3|SYC_SHIBS | Cysteine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B5YPP1|SYC_ECO5E | Cysteine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q8XCT9|SYC_ECO57 | Cysteine--tRNA ligase OS=Escherichia coli O157:H7 GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B7LJI4|SYC_ESCF3 | Cysteine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q3Z4P5|SYC_SHISS | Cysteine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B2TTB3|SYC_SHIB3 | Cysteine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|A9KSM5|SYC_CLOPH | Cysteine--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=cysS PE=3 SV=1 | 4 | 85 | 2.0E-15 |
sp|A4W7I4|SYC_ENT38 | Cysteine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=cysS PE=3 SV=2 | 4 | 82 | 2.0E-15 |
sp|Q32JL0|SYC_SHIDS | Cysteine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|Q8DHW6|SYC_THEEB | Cysteine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=cysS PE=3 SV=2 | 17 | 82 | 2.0E-15 |
sp|Q045X8|SYC_LACGA | Cysteine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=cysS PE=3 SV=1 | 4 | 86 | 2.0E-15 |
sp|A1JNP9|SYC_YERE8 | Cysteine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-15 |
sp|B1XND1|SYC_SYNP2 | Cysteine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=cysS PE=3 SV=1 | 2 | 86 | 2.0E-15 |
sp|A0KYM2|SYC_SHESA | Cysteine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=cysS PE=3 SV=1 | 1 | 86 | 3.0E-15 |
sp|P57890|SYC_PASMU | Cysteine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-15 |
sp|Q2IQG7|SYC_ANADE | Cysteine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=cysS PE=3 SV=1 | 2 | 82 | 3.0E-15 |
sp|A2BXK1|SYC_PROM5 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9515) GN=cysS PE=3 SV=1 | 4 | 85 | 3.0E-15 |
sp|B4UGC3|SYC_ANASK | Cysteine--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=cysS PE=3 SV=1 | 2 | 82 | 3.0E-15 |
sp|B8JDH1|SYC_ANAD2 | Cysteine--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=cysS PE=3 SV=1 | 2 | 82 | 3.0E-15 |
sp|B7N980|SYC_ECOLU | Cysteine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-15 |
sp|Q8ETZ9|SYC_OCEIH | Cysteine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=cysS PE=3 SV=1 | 2 | 83 | 3.0E-15 |
sp|Q74L26|SYC_LACJO | Cysteine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=cysS PE=3 SV=1 | 4 | 85 | 3.0E-15 |
sp|B8F392|SYC_HAEPS | Cysteine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=cysS PE=3 SV=1 | 4 | 79 | 4.0E-15 |
sp|A3QFX9|SYC_SHELP | Cysteine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-15 |
sp|Q0HTK4|SYC_SHESR | Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=cysS PE=3 SV=1 | 1 | 86 | 4.0E-15 |
sp|Q8EG22|SYC_SHEON | Cysteine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=cysS PE=3 SV=1 | 4 | 86 | 4.0E-15 |
sp|Q0HH98|SYC_SHESM | Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=cysS PE=3 SV=1 | 1 | 86 | 4.0E-15 |
sp|Q46JT8|SYC_PROMT | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=cysS PE=3 SV=1 | 2 | 85 | 4.0E-15 |
sp|A7MK00|SYC_CROS8 | Cysteine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysS PE=3 SV=2 | 4 | 82 | 4.0E-15 |
sp|B1YGS9|SYC_EXIS2 | Cysteine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=cysS PE=3 SV=1 | 4 | 79 | 4.0E-15 |
sp|C4KZR7|SYC_EXISA | Cysteine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=cysS PE=3 SV=1 | 4 | 79 | 4.0E-15 |
sp|Q0I1Q1|SYC_HAES1 | Cysteine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=cysS PE=3 SV=1 | 4 | 86 | 4.0E-15 |
sp|Q2NV45|SYC_SODGM | Cysteine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-15 |
sp|Q3A8C9|SYC_PELCD | Cysteine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=cysS PE=3 SV=1 | 2 | 82 | 4.0E-15 |
sp|Q8TSP6|SYC_METAC | Cysteine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=cysS PE=3 SV=1 | 4 | 79 | 4.0E-15 |
sp|A9KWH4|SYC_SHEB9 | Cysteine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=cysS PE=3 SV=1 | 4 | 82 | 5.0E-15 |
sp|B8E5F2|SYC_SHEB2 | Cysteine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=cysS PE=3 SV=1 | 4 | 82 | 5.0E-15 |
sp|A6WLP8|SYC_SHEB8 | Cysteine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=cysS PE=3 SV=1 | 4 | 82 | 5.0E-15 |
sp|A3D302|SYC_SHEB5 | Cysteine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cysS PE=3 SV=1 | 4 | 82 | 5.0E-15 |
sp|A2C3T6|SYC_PROM1 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=cysS PE=3 SV=1 | 2 | 85 | 5.0E-15 |
sp|A5G949|SYC_GEOUR | Cysteine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=cysS PE=3 SV=1 | 2 | 85 | 5.0E-15 |
sp|Q7N0S5|SYC_PHOLL | Cysteine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysS PE=3 SV=1 | 4 | 82 | 5.0E-15 |
sp|B1KLU0|SYC_SHEWM | Cysteine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysS PE=3 SV=1 | 4 | 82 | 6.0E-15 |
sp|Q97S25|SYC_STRPN | Cysteine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cysS PE=3 SV=1 | 18 | 110 | 6.0E-15 |
sp|Q8DQS8|SYC_STRR6 | Cysteine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cysS PE=3 SV=1 | 18 | 110 | 6.0E-15 |
sp|A0LIR9|SYC_SYNFM | Cysteine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=cysS PE=3 SV=1 | 4 | 82 | 6.0E-15 |
sp|A8MLB7|SYC_ALKOO | Cysteine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=cysS PE=3 SV=1 | 4 | 85 | 7.0E-15 |
sp|A6VQ79|SYC_ACTSZ | Cysteine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cysS PE=3 SV=1 | 4 | 82 | 7.0E-15 |
sp|Q5WLT3|SYC_BACSK | Cysteine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=cysS PE=3 SV=1 | 4 | 79 | 7.0E-15 |
sp|A9KBJ2|SYC_COXBN | Cysteine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cysS PE=3 SV=1 | 4 | 82 | 8.0E-15 |
sp|A9N924|SYC_COXBR | Cysteine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cysS PE=3 SV=1 | 4 | 82 | 8.0E-15 |
sp|Q839V5|SYC_ENTFA | Cysteine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=cysS PE=3 SV=1 | 4 | 87 | 8.0E-15 |
sp|Q39ZL8|SYC_GEOMG | Cysteine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=cysS PE=3 SV=1 | 2 | 85 | 9.0E-15 |
sp|B4F1M6|SYC_PROMH | Cysteine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=cysS PE=3 SV=1 | 4 | 82 | 9.0E-15 |
sp|Q8PVQ1|SYC_METMA | Cysteine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=cysS PE=3 SV=1 | 4 | 79 | 9.0E-15 |
sp|Q6PA41|SYCM_XENLA | Probable cysteine--tRNA ligase, mitochondrial OS=Xenopus laevis GN=cars2 PE=2 SV=1 | 4 | 83 | 1.0E-14 |
sp|F4IPY2|SYCM_ARATH | Cysteine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SYCO PE=2 SV=1 | 4 | 83 | 1.0E-14 |
sp|A3PDX8|SYC_PROM0 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=cysS PE=3 SV=1 | 4 | 87 | 1.0E-14 |
sp|A2BS39|SYC_PROMS | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-14 |
sp|A6UWT0|SYC_META3 | Cysteine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-14 |
sp|C3KVS3|SYC_CLOB6 | Cysteine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-14 |
sp|A1S4X2|SYC_SHEAM | Cysteine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-14 |
sp|Q7VB63|SYC_PROMA | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-14 |
sp|Q7V0W1|SYC_PROMP | Cysteine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-14 |
sp|A5FP90|SYC_DEHMB | Cysteine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-14 |
sp|A0PXS5|SYC_CLONN | Cysteine--tRNA ligase OS=Clostridium novyi (strain NT) GN=cysS PE=3 SV=1 | 18 | 87 | 2.0E-14 |
sp|Q3IF51|SYC_PSEHT | Cysteine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-14 |
sp|Q47XL5|SYC_COLP3 | Cysteine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-14 |
sp|Q319Z9|SYC_PROM9 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=cysS PE=3 SV=1 | 4 | 85 | 2.0E-14 |
sp|A3DLW5|SYC_STAMF | Cysteine--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=cysS PE=3 SV=1 | 1 | 105 | 2.0E-14 |
sp|A8G5S9|SYC_PROM2 | Cysteine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9215) GN=cysS PE=3 SV=1 | 4 | 85 | 2.0E-14 |
sp|C4Z3N5|SYC_EUBE2 | Cysteine--tRNA ligase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=cysS PE=3 SV=1 | 4 | 85 | 2.0E-14 |
sp|B8DF15|SYC_LISMH | Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=cysS PE=3 SV=1 | 2 | 87 | 2.0E-14 |
sp|Q724H3|SYC_LISMF | Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=cysS PE=3 SV=1 | 2 | 87 | 2.0E-14 |
sp|C1KYH2|SYC_LISMC | Cysteine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=cysS PE=3 SV=1 | 2 | 87 | 2.0E-14 |
sp|A4VL73|SYC_PSEU5 | Cysteine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=cysS PE=3 SV=2 | 2 | 82 | 2.0E-14 |
sp|Q6D2E4|SYC_PECAS | Cysteine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-14 |
sp|Q9CEJ0|SYC_LACLA | Cysteine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=cysS PE=3 SV=1 | 4 | 83 | 3.0E-14 |
sp|Q48L06|SYC_PSE14 | Cysteine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cysS PE=3 SV=1 | 4 | 83 | 3.0E-14 |
sp|Q8YAB1|SYC_LISMO | Cysteine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cysS PE=3 SV=1 | 2 | 87 | 3.0E-14 |
sp|C1DHE6|SYC_AZOVD | Cysteine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=cysS PE=3 SV=1 | 2 | 82 | 3.0E-14 |
sp|A4G4M2|SYC_HERAR | Cysteine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=cysS PE=3 SV=1 | 1 | 149 | 3.0E-14 |
sp|Q92F36|SYC_LISIN | Cysteine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cysS PE=3 SV=1 | 2 | 87 | 3.0E-14 |
sp|Q8RIK9|SYC_FUSNN | Cysteine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-14 |
sp|B1YSM8|SYC_BURA4 | Cysteine--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=cysS PE=3 SV=1 | 1 | 149 | 3.0E-14 |
sp|B7JUH4|SYC_CYAP8 | Cysteine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=cysS PE=3 SV=1 | 2 | 85 | 3.0E-14 |
sp|Q38UZ6|SYC_LACSS | Cysteine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=cysS PE=3 SV=1 | 4 | 87 | 3.0E-14 |
sp|B8CRG0|SYC_SHEPW | Cysteine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-14 |
sp|A8H617|SYC_SHEPA | Cysteine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cysS PE=3 SV=1 | 4 | 86 | 4.0E-14 |
sp|Q4ZVN9|SYC_PSEU2 | Cysteine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cysS PE=3 SV=1 | 4 | 83 | 4.0E-14 |
sp|Q1LTX2|SYC_BAUCH | Cysteine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-14 |
sp|A0AF38|SYC_LISW6 | Cysteine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=cysS PE=3 SV=1 | 2 | 87 | 4.0E-14 |
sp|A2RMS1|SYC_LACLM | Cysteine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=cysS PE=3 SV=1 | 4 | 109 | 4.0E-14 |
sp|B1MW68|SYC_LEUCK | Cysteine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=cysS PE=3 SV=1 | 4 | 119 | 4.0E-14 |
sp|A9BGT9|SYC_PETMO | Cysteine--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=cysS PE=3 SV=1 | 3 | 132 | 4.0E-14 |
sp|Q9RTT6|SYC_DEIRA | Cysteine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=cysS PE=3 SV=2 | 3 | 91 | 4.0E-14 |
sp|B0TLV2|SYC_SHEHH | Cysteine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cysS PE=3 SV=1 | 4 | 82 | 5.0E-14 |
sp|Q747A2|SYC_GEOSL | Cysteine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=cysS PE=3 SV=1 | 2 | 85 | 5.0E-14 |
sp|Q5L429|SYC_GEOKA | Cysteine--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=cysS PE=3 SV=1 | 1 | 83 | 5.0E-14 |
sp|Q02WZ9|SYC_LACLS | Cysteine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=cysS PE=3 SV=1 | 4 | 109 | 5.0E-14 |
sp|A0K8K2|SYC_BURCH | Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=cysS PE=3 SV=1 | 1 | 149 | 5.0E-14 |
sp|Q1BHP1|SYC_BURCA | Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=cysS PE=3 SV=1 | 1 | 149 | 5.0E-14 |
sp|B1JUK8|SYC_BURCC | Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=cysS PE=3 SV=1 | 1 | 149 | 5.0E-14 |
sp|Q0BDV4|SYC_BURCM | Cysteine--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=cysS PE=3 SV=1 | 1 | 149 | 5.0E-14 |
sp|B4ED73|SYC_BURCJ | Cysteine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=cysS PE=3 SV=1 | 1 | 82 | 6.0E-14 |
sp|Q39EY8|SYC2_BURL3 | Cysteine--tRNA ligase 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=cysS2 PE=3 SV=1 | 1 | 149 | 6.0E-14 |
sp|Q6GJD9|SYC_STAAR | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|Q8NXY7|SYC_STAAW | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|Q6GBV8|SYC_STAAS | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|Q99W73|SYC_STAAN | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=cysS PE=1 SV=1 | 4 | 83 | 6.0E-14 |
sp|Q932G0|SYC_STAAM | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cysS PE=3 SV=2 | 4 | 83 | 6.0E-14 |
sp|A5IQ83|SYC_STAA9 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|A6TZ06|SYC_STAA2 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|A7WYU7|SYC_STAA1 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|A8YZM7|SYC_STAAT | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cysS PE=3 SV=2 | 4 | 83 | 6.0E-14 |
sp|A6QEI2|SYC_STAAE | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|Q5HIE5|SYC_STAAC | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|Q2G2M6|SYC_STAA8 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|Q2FJB0|SYC_STAA3 | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|Q2YSD1|SYC_STAAB | Cysteine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cysS PE=3 SV=1 | 4 | 83 | 6.0E-14 |
sp|A6LPP1|SYC_CLOB8 | Cysteine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=cysS PE=3 SV=1 | 4 | 82 | 7.0E-14 |
sp|Q18CD5|SYC_PEPD6 | Cysteine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=cysS PE=3 SV=2 | 4 | 103 | 7.0E-14 |
sp|Q4QPG7|SYC_HAEI8 | Cysteine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=cysS PE=3 SV=1 | 4 | 95 | 7.0E-14 |
sp|P43816|SYC_HAEIN | Cysteine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cysS PE=3 SV=1 | 4 | 95 | 7.0E-14 |
sp|Q87YQ2|SYC_PSESM | Cysteine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysS PE=3 SV=1 | 4 | 83 | 7.0E-14 |
sp|B8GNT5|SYC_THISH | Cysteine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cysS PE=3 SV=1 | 4 | 82 | 7.0E-14 |
sp|A4JFD0|SYC_BURVG | Cysteine--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=cysS PE=3 SV=1 | 1 | 82 | 7.0E-14 |
sp|Q0SQC1|SYC_CLOPS | Cysteine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=cysS PE=3 SV=1 | 4 | 85 | 8.0E-14 |
sp|Q8XHQ5|SYC_CLOPE | Cysteine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=cysS PE=3 SV=1 | 4 | 85 | 8.0E-14 |
sp|Q0TMM4|SYC_CLOP1 | Cysteine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=cysS PE=3 SV=1 | 4 | 85 | 8.0E-14 |
sp|C6E7P0|SYC_GEOSM | Cysteine--tRNA ligase OS=Geobacter sp. (strain M21) GN=cysS PE=3 SV=1 | 4 | 179 | 8.0E-14 |
sp|Q5QYP3|SYC_IDILO | Cysteine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cysS PE=3 SV=1 | 2 | 82 | 8.0E-14 |
sp|A1U1Q7|SYC_MARHV | Cysteine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=cysS PE=3 SV=1 | 4 | 82 | 8.0E-14 |
sp|B2GAB5|SYC_LACF3 | Cysteine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=cysS PE=3 SV=1 | 4 | 85 | 8.0E-14 |
sp|B0S0W3|SYC_FINM2 | Cysteine--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=cysS PE=3 SV=1 | 4 | 112 | 8.0E-14 |
sp|A5UFP3|SYC_HAEIG | Cysteine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=cysS PE=3 SV=1 | 4 | 95 | 9.0E-14 |
sp|B9DKW3|SYC_STACT | Cysteine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=cysS PE=3 SV=1 | 17 | 83 | 9.0E-14 |
sp|Q890M4|SYC_CLOTE | Cysteine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-13 |
sp|B2TIF6|SYC_CLOBB | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-13 |
sp|B5EEK6|SYC_GEOBB | Cysteine--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=cysS PE=3 SV=1 | 4 | 179 | 1.0E-13 |
sp|A1AK01|SYC_PELPD | Cysteine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=cysS PE=3 SV=1 | 2 | 85 | 1.0E-13 |
sp|A8AB68|SYC_IGNH4 | Cysteine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=cysS PE=3 SV=1 | 4 | 83 | 1.0E-13 |
sp|B7GJ46|SYC_ANOFW | Cysteine--tRNA ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=cysS PE=3 SV=1 | 2 | 83 | 1.0E-13 |
sp|Q1GHI0|SYC_RUEST | Cysteine--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=cysS PE=3 SV=1 | 1 | 82 | 1.0E-13 |
sp|C5D3P6|SYC_GEOSW | Cysteine--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=cysS PE=3 SV=1 | 1 | 83 | 1.0E-13 |
sp|A9AHN6|SYC_BURM1 | Cysteine--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=cysS PE=3 SV=1 | 1 | 82 | 1.0E-13 |
sp|B3R4D1|SYC_CUPTR | Cysteine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=cysS PE=3 SV=1 | 1 | 82 | 1.0E-13 |
sp|Q493A1|SYC_BLOPB | Cysteine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-13 |
sp|Q88YX9|SYC_LACPL | Cysteine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-13 |
sp|Q6AJ23|SYC_DESPS | Cysteine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=cysS PE=3 SV=1 | 2 | 82 | 2.0E-13 |
sp|B2UY90|SYC_CLOBA | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=cysS PE=3 SV=1 | 4 | 85 | 2.0E-13 |
sp|B5YID4|SYC_THEYD | Cysteine--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=cysS PE=3 SV=1 | 18 | 85 | 2.0E-13 |
sp|B1I0T1|SYC_DESAP | Cysteine--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=cysS PE=3 SV=1 | 4 | 85 | 2.0E-13 |
sp|B3E1P0|SYC_GEOLS | Cysteine--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=cysS PE=3 SV=1 | 2 | 85 | 2.0E-13 |
sp|Q4K9S1|SYC_PSEF5 | Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-13 |
sp|Q60BG8|SYC_METCA | Cysteine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-13 |
sp|Q49V39|SYC_STAS1 | Cysteine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cysS PE=3 SV=1 | 18 | 83 | 2.0E-13 |
sp|Q1H417|SYC_METFK | Cysteine--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-13 |
sp|Q0KCA9|SYC_CUPNH | Cysteine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cysS PE=3 SV=1 | 1 | 82 | 2.0E-13 |
sp|B2U9P8|SYC_RALPJ | Cysteine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=cysS PE=3 SV=1 | 1 | 82 | 2.0E-13 |
sp|B1KTA5|SYC_CLOBM | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=cysS PE=3 SV=1 | 4 | 85 | 3.0E-13 |
sp|A5I7M8|SYC_CLOBH | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=cysS PE=3 SV=1 | 4 | 85 | 3.0E-13 |
sp|A7FZ91|SYC_CLOB1 | Cysteine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=cysS PE=3 SV=1 | 4 | 85 | 3.0E-13 |
sp|A7GJ96|SYC_CLOBL | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=cysS PE=3 SV=1 | 4 | 85 | 3.0E-13 |
sp|B1IGH6|SYC_CLOBK | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=cysS PE=3 SV=1 | 4 | 85 | 3.0E-13 |
sp|C1FMX3|SYC_CLOBJ | Cysteine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=cysS PE=3 SV=1 | 4 | 85 | 3.0E-13 |
sp|Q65PC8|SYC_BACLD | Cysteine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysS PE=3 SV=1 | 2 | 79 | 3.0E-13 |
sp|B1HNM3|SYC_LYSSC | Cysteine--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=cysS PE=3 SV=1 | 2 | 79 | 3.0E-13 |
sp|Q28QY7|SYC_JANSC | Cysteine--tRNA ligase OS=Jannaschia sp. (strain CCS1) GN=cysS PE=3 SV=1 | 1 | 82 | 3.0E-13 |
sp|A5D5M0|SYC_PELTS | Cysteine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=cysS PE=3 SV=1 | 18 | 85 | 3.0E-13 |
sp|Q2SX78|SYC_BURTA | Cysteine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=cysS PE=3 SV=1 | 1 | 82 | 3.0E-13 |
sp|Q048S9|SYC_LACDB | Cysteine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-13 |
sp|B1L7Y7|SYC_THESQ | Cysteine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-13 |
sp|A5IJ66|SYC_THEP1 | Cysteine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-13 |
sp|Q1G8Z0|SYC_LACDA | Cysteine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-13 |
sp|Q3J8Y9|SYC_NITOC | Cysteine--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-13 |
sp|Q47HK6|SYC_DECAR | Cysteine--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-13 |
sp|Q1QVV6|SYC_CHRSD | Cysteine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-13 |
sp|Q8Y077|SYC_RALSO | Cysteine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=cysS PE=3 SV=1 | 1 | 82 | 4.0E-13 |
sp|Q63SS8|SYC_BURPS | Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=cysS PE=3 SV=1 | 1 | 82 | 4.0E-13 |
sp|A3NB50|SYC_BURP6 | Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=cysS PE=3 SV=1 | 1 | 82 | 4.0E-13 |
sp|Q3JQT6|SYC_BURP1 | Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=cysS PE=3 SV=1 | 1 | 82 | 4.0E-13 |
sp|A3NWX8|SYC_BURP0 | Cysteine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=cysS PE=3 SV=1 | 1 | 82 | 4.0E-13 |
sp|A1V5G8|SYC_BURMS | Cysteine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=cysS PE=3 SV=1 | 1 | 82 | 4.0E-13 |
sp|Q62J37|SYC_BURMA | Cysteine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=cysS PE=3 SV=1 | 1 | 82 | 4.0E-13 |
sp|A2SAX8|SYC_BURM9 | Cysteine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=cysS PE=3 SV=1 | 1 | 82 | 4.0E-13 |
sp|A3ML43|SYC_BURM7 | Cysteine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=cysS PE=3 SV=1 | 1 | 82 | 4.0E-13 |
sp|Q3KA28|SYC_PSEPF | Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-13 |
sp|A4XHE2|SYC_CALS8 | Cysteine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=cysS PE=3 SV=1 | 4 | 91 | 5.0E-13 |
sp|B9MMM6|SYC_CALBD | Cysteine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=cysS PE=3 SV=1 | 4 | 91 | 5.0E-13 |
sp|Q03SU6|SYC_LACBA | Cysteine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=cysS PE=3 SV=1 | 4 | 85 | 5.0E-13 |
sp|Q8E7F2|SYC_STRA3 | Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=cysS PE=3 SV=1 | 18 | 79 | 6.0E-13 |
sp|A4IJG8|SYC_GEOTN | Cysteine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=cysS PE=3 SV=1 | 1 | 83 | 6.0E-13 |
sp|Q4L3I9|SYC_STAHJ | Cysteine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cysS PE=3 SV=1 | 18 | 83 | 6.0E-13 |
sp|Q8CTU1|SYC_STAES | Cysteine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cysS PE=3 SV=1 | 18 | 83 | 6.0E-13 |
sp|Q5HRM3|SYC_STAEQ | Cysteine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cysS PE=3 SV=1 | 18 | 83 | 6.0E-13 |
sp|B9KAQ8|SYC_THENN | Cysteine--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=cysS PE=3 SV=1 | 4 | 82 | 6.0E-13 |
sp|Q8E1Z4|SYC_STRA5 | Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=cysS PE=3 SV=1 | 18 | 79 | 7.0E-13 |
sp|Q3K3G5|SYC_STRA1 | Cysteine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=cysS PE=3 SV=1 | 18 | 79 | 7.0E-13 |
sp|A0L4P8|SYC_MAGMM | Cysteine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=cysS PE=3 SV=1 | 2 | 129 | 7.0E-13 |
sp|Q9WZH8|SYC_THEMA | Cysteine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=cysS PE=3 SV=1 | 4 | 82 | 7.0E-13 |
sp|Q8R7T3|SYC_CALS4 | Cysteine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=cysS PE=3 SV=1 | 4 | 91 | 8.0E-13 |
sp|A4J0Y9|SYC_DESRM | Cysteine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=cysS PE=3 SV=1 | 4 | 93 | 8.0E-13 |
sp|Q13X60|SYC_BURXL | Cysteine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=cysS PE=3 SV=1 | 1 | 82 | 8.0E-13 |
sp|C3JYD3|SYC_PSEFS | Cysteine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=cysS PE=3 SV=1 | 4 | 82 | 9.0E-13 |
sp|B2G5S5|SYC_LACRJ | Cysteine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=cysS PE=3 SV=1 | 4 | 85 | 9.0E-13 |
sp|A5VI99|SYC_LACRD | Cysteine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=cysS PE=3 SV=1 | 4 | 85 | 9.0E-13 |
sp|C0ZIF7|SYC_BREBN | Cysteine--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=cysS PE=3 SV=1 | 17 | 85 | 1.0E-12 |
sp|B0K5F6|SYC_THEPX | Cysteine--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=cysS PE=3 SV=1 | 4 | 87 | 1.0E-12 |
sp|B0KCH9|SYC_THEP3 | Cysteine--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=cysS PE=3 SV=1 | 4 | 87 | 1.0E-12 |
sp|Q97ED6|SYC_CLOAB | Cysteine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-12 |
sp|B6ISG4|SYC_RHOCS | Cysteine--tRNA ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=cysS PE=3 SV=1 | 2 | 84 | 1.0E-12 |
sp|Q5LRJ6|SYC_RUEPO | Cysteine--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=cysS PE=3 SV=1 | 1 | 82 | 1.0E-12 |
sp|B1GYT2|SYC_UNCTG | Cysteine--tRNA ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=cysS PE=3 SV=1 | 2 | 87 | 1.0E-12 |
sp|A5IBG0|SYC_LEGPC | Cysteine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|Q5WX29|SYC_LEGPL | Cysteine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|Q5X5P9|SYC_LEGPA | Cysteine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|B1J805|SYC_PSEPW | Cysteine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|Q6N8A7|SYC_RHOPA | Cysteine--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysS PE=3 SV=1 | 17 | 84 | 1.0E-12 |
sp|Q2KAA8|SYC_RHIEC | Cysteine--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=cysS PE=3 SV=1 | 4 | 84 | 1.0E-12 |
sp|A3DH43|SYC_CLOTH | Cysteine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=cysS PE=3 SV=1 | 4 | 85 | 1.0E-12 |
sp|C4K6G8|SYC_HAMD5 | Cysteine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|A5W458|SYC_PSEP1 | Cysteine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|Q88IU4|SYC_PSEPK | Cysteine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|Q02KT6|SYC_PSEAB | Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|Q9I2U7|SYC_PSEAE | Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|B7VB84|SYC_PSEA8 | Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|A6V727|SYC_PSEA7 | Cysteine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=cysS PE=3 SV=1 | 4 | 82 | 1.0E-12 |
sp|B3QCS4|SYC_RHOPT | Cysteine--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=cysS PE=3 SV=1 | 17 | 84 | 1.0E-12 |
sp|Q2J545|SYC_FRASC | Cysteine--tRNA ligase OS=Frankia sp. (strain CcI3) GN=cysS PE=3 SV=1 | 17 | 132 | 1.0E-12 |
sp|Q2JKL2|SYC_SYNJB | Cysteine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=cysS PE=3 SV=1 | 3 | 82 | 1.0E-12 |
sp|Q8UGG4|SYC_AGRFC | Cysteine--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysS PE=3 SV=1 | 2 | 84 | 2.0E-12 |
sp|A6U7D9|SYC_SINMW | Cysteine--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=cysS PE=3 SV=1 | 1 | 84 | 2.0E-12 |
sp|Q984X8|SYC_RHILO | Cysteine--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=cysS PE=3 SV=1 | 4 | 102 | 2.0E-12 |
sp|A8F962|SYC_BACP2 | Cysteine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-12 |
sp|Q5P1H8|SYC_AROAE | Cysteine--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-12 |
sp|Q3A9P1|SYC_CARHZ | Cysteine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=cysS PE=3 SV=1 | 4 | 91 | 3.0E-12 |
sp|C4XSW5|SYC_DESMR | Cysteine--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-12 |
sp|A5N4M6|SYC_CLOK5 | Cysteine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=cysS PE=3 SV=1 | 18 | 87 | 3.0E-12 |
sp|B9DY88|SYC_CLOK1 | Cysteine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=cysS PE=3 SV=1 | 18 | 87 | 3.0E-12 |
sp|B5ZWB3|SYC_RHILW | Cysteine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=cysS PE=3 SV=1 | 1 | 84 | 3.0E-12 |
sp|Q72BQ5|SYC_DESVH | Cysteine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=cysS PE=3 SV=1 | 4 | 87 | 4.0E-12 |
sp|Q5ZVY1|SYC_LEGPH | Cysteine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-12 |
sp|Q6MKR7|SYC_BDEBA | Cysteine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-12 |
sp|B0KUU0|SYC_PSEPG | Cysteine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=cysS PE=3 SV=1 | 4 | 82 | 4.0E-12 |
sp|A1VDQ5|SYC_DESVV | Cysteine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=cysS PE=3 SV=1 | 4 | 87 | 5.0E-12 |
sp|B8EMY2|SYC_METSB | Cysteine--tRNA ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=cysS PE=3 SV=1 | 2 | 82 | 5.0E-12 |
sp|Q92R20|SYC_RHIME | Cysteine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=cysS PE=3 SV=1 | 1 | 84 | 5.0E-12 |
sp|Q9Z6X4|SYC_CHLPN | Cysteine--tRNA ligase OS=Chlamydia pneumoniae GN=cysS PE=3 SV=1 | 26 | 130 | 5.0E-12 |
sp|Q5X9W5|SYC_STRP6 | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=cysS PE=3 SV=1 | 18 | 109 | 6.0E-12 |
sp|Q48RA7|SYC_STRPM | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=cysS PE=3 SV=1 | 18 | 109 | 6.0E-12 |
sp|Q8NZD1|SYC_STRP8 | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=cysS PE=3 SV=1 | 18 | 109 | 6.0E-12 |
sp|Q99XZ9|SYC_STRP1 | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=cysS PE=3 SV=1 | 18 | 109 | 7.0E-12 |
sp|P0DG33|SYC_STRPQ | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=cysS PE=3 SV=1 | 18 | 109 | 8.0E-12 |
sp|P0DG32|SYC_STRP3 | Cysteine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=cysS PE=3 SV=1 | 18 | 109 | 8.0E-12 |
sp|Q9PLE0|SYC_CHLMU | Cysteine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=cysS PE=3 SV=1 | 26 | 85 | 8.0E-12 |
sp|Q89NP8|SYC_BRADU | Cysteine--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysS PE=3 SV=1 | 18 | 84 | 8.0E-12 |
sp|Q30ZH8|SYC_DESAG | Cysteine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=cysS PE=3 SV=1 | 4 | 82 | 9.0E-12 |
sp|C6BS23|SYC_DESAD | Cysteine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=cysS PE=3 SV=1 | 4 | 82 | 9.0E-12 |
sp|Q31H54|SYC_THICR | Cysteine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=cysS PE=3 SV=1 | 2 | 82 | 1.0E-11 |
sp|Q06752|SYC_BACSU | Cysteine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=cysS PE=1 SV=1 | 2 | 79 | 1.0E-11 |
sp|Q9YBK6|SYC_AERPE | Cysteine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=cysS PE=3 SV=2 | 4 | 110 | 1.0E-11 |
sp|Q2W7Y5|SYC_MAGSA | Cysteine--tRNA ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=cysS PE=3 SV=1 | 2 | 83 | 1.0E-11 |
sp|A5EHE7|SYC_BRASB | Cysteine--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=cysS PE=3 SV=1 | 17 | 84 | 1.0E-11 |
sp|B8DKL0|SYC_DESVM | Cysteine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=cysS PE=3 SV=1 | 18 | 91 | 1.0E-11 |
sp|Q2JTF4|SYC_SYNJA | Cysteine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=cysS PE=3 SV=1 | 26 | 82 | 1.0E-11 |
sp|Q6HPS8|SYC_BACHK | Cysteine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-11 |
sp|Q63HB0|SYC_BACCZ | Cysteine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-11 |
sp|B7JK97|SYC_BACC0 | Cysteine--tRNA ligase OS=Bacillus cereus (strain AH820) GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-11 |
sp|Q81VV1|SYC_BACAN | Cysteine--tRNA ligase OS=Bacillus anthracis GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-11 |
sp|C3LJ62|SYC_BACAC | Cysteine--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-11 |
sp|C3P9N5|SYC_BACAA | Cysteine--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-11 |
sp|A7Z0L6|SYC_BACMF | Cysteine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-11 |
sp|C1D7F5|SYC_LARHH | Cysteine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=cysS PE=3 SV=1 | 18 | 82 | 2.0E-11 |
sp|Q3SHN1|SYC_THIDA | Cysteine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=cysS PE=3 SV=1 | 4 | 86 | 2.0E-11 |
sp|Q1IBP9|SYC_PSEE4 | Cysteine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=cysS PE=3 SV=1 | 4 | 82 | 2.0E-11 |
sp|B4U570|SYC_STREM | Cysteine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=cysS PE=3 SV=1 | 18 | 109 | 2.0E-11 |
sp|Q021Y7|SYC_SOLUE | Cysteine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=cysS PE=3 SV=1 | 2 | 85 | 2.0E-11 |
sp|Q1MJ22|SYC_RHIL3 | Cysteine--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=cysS PE=3 SV=1 | 4 | 84 | 2.0E-11 |
sp|Q139D9|SYC_RHOPS | Cysteine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=cysS PE=3 SV=1 | 18 | 84 | 2.0E-11 |
sp|Q47TG4|SYC_THEFY | Cysteine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=cysS PE=3 SV=1 | 18 | 79 | 2.0E-11 |
sp|O84787|SYC_CHLTR | Cysteine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=cysS PE=3 SV=2 | 18 | 85 | 2.0E-11 |
sp|Q3KKR0|SYC_CHLTA | Cysteine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=cysS PE=3 SV=2 | 18 | 85 | 2.0E-11 |
sp|A9VNA2|SYC_BACWK | Cysteine--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=cysS PE=3 SV=1 | 2 | 79 | 3.0E-11 |
sp|A3M419|SYC_ACIBT | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=cysS PE=3 SV=2 | 1 | 82 | 3.0E-11 |
sp|B2HX34|SYC_ACIBC | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=cysS PE=3 SV=1 | 1 | 82 | 3.0E-11 |
sp|B0VAU1|SYC_ACIBY | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=cysS PE=3 SV=1 | 1 | 82 | 3.0E-11 |
sp|B7IBU3|SYC_ACIB5 | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=cysS PE=3 SV=1 | 1 | 82 | 3.0E-11 |
sp|B7GWA1|SYC_ACIB3 | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=cysS PE=3 SV=1 | 1 | 82 | 3.0E-11 |
sp|B0VS71|SYC_ACIBS | Cysteine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=cysS PE=3 SV=1 | 1 | 82 | 3.0E-11 |
sp|A4YIG5|SYC_METS5 | Cysteine--tRNA ligase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=cysS PE=3 SV=1 | 18 | 83 | 3.0E-11 |
sp|Q07Q42|SYC_RHOP5 | Cysteine--tRNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=cysS PE=3 SV=1 | 18 | 84 | 3.0E-11 |
sp|Q1QN87|SYC_NITHX | Cysteine--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=cysS PE=3 SV=1 | 18 | 84 | 3.0E-11 |
sp|A5EWG6|SYC_DICNV | Cysteine--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=cysS PE=3 SV=1 | 1 | 82 | 3.0E-11 |
sp|C1ET19|SYC_BACC3 | Cysteine--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=cysS PE=3 SV=1 | 2 | 79 | 4.0E-11 |
sp|A0R8G1|SYC_BACAH | Cysteine--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=cysS PE=3 SV=1 | 2 | 79 | 4.0E-11 |
sp|B9IZH4|SYC_BACCQ | Cysteine--tRNA ligase OS=Bacillus cereus (strain Q1) GN=cysS PE=3 SV=1 | 2 | 79 | 4.0E-11 |
sp|B7HQS4|SYC_BACC7 | Cysteine--tRNA ligase OS=Bacillus cereus (strain AH187) GN=cysS PE=3 SV=1 | 2 | 79 | 4.0E-11 |
sp|Q73FB7|SYC_BACC1 | Cysteine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysS PE=3 SV=1 | 2 | 79 | 4.0E-11 |
sp|Q81J59|SYC_BACCR | Cysteine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysS PE=3 SV=1 | 2 | 79 | 4.0E-11 |
sp|B7HJ28|SYC_BACC4 | Cysteine--tRNA ligase OS=Bacillus cereus (strain B4264) GN=cysS PE=3 SV=1 | 2 | 79 | 4.0E-11 |
sp|B7ISZ9|SYC_BACC2 | Cysteine--tRNA ligase OS=Bacillus cereus (strain G9842) GN=cysS PE=3 SV=1 | 2 | 79 | 4.0E-11 |
sp|B9JCA5|SYC_AGRRK | Cysteine--tRNA ligase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=cysS PE=3 SV=1 | 4 | 106 | 4.0E-11 |
sp|B2IEE1|SYC_BEII9 | Cysteine--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=cysS PE=3 SV=1 | 2 | 82 | 4.0E-11 |
sp|O29836|SYC_ARCFU | Cysteine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=cysS PE=3 SV=1 | 4 | 85 | 4.0E-11 |
sp|Q5M6F6|SYC_STRT2 | Cysteine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=cysS PE=3 SV=1 | 18 | 79 | 5.0E-11 |
sp|Q5M1W6|SYC_STRT1 | Cysteine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=cysS PE=3 SV=1 | 18 | 79 | 5.0E-11 |
sp|B2HJ21|SYC_MYCMM | Cysteine--tRNA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=cysS PE=3 SV=1 | 3 | 82 | 5.0E-11 |
sp|A0PV27|SYC_MYCUA | Cysteine--tRNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=cysS PE=3 SV=1 | 3 | 82 | 5.0E-11 |
sp|A7GK01|SYC_BACCN | Cysteine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=cysS PE=3 SV=1 | 2 | 79 | 6.0E-11 |
sp|Q96YC3|SYC_SULTO | Cysteine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=cysS PE=3 SV=2 | 2 | 83 | 6.0E-11 |
sp|Q9JXE6|SYC_NEIMB | Cysteine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysS PE=3 SV=1 | 17 | 82 | 6.0E-11 |
sp|B6JHT8|SYC_OLICO | Cysteine--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=cysS PE=3 SV=1 | 2 | 84 | 7.0E-11 |
sp|Q5F5D6|SYC_NEIG1 | Cysteine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=cysS PE=3 SV=1 | 17 | 82 | 7.0E-11 |
sp|Q9JWJ3|SYC_NEIMA | Cysteine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysS PE=3 SV=1 | 17 | 82 | 7.0E-11 |
sp|Q3BSH9|SYC_XANC5 | Cysteine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cysS PE=3 SV=1 | 2 | 85 | 8.0E-11 |
sp|Q74MI1|SYC_NANEQ | Cysteine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=cysS PE=3 SV=1 | 4 | 83 | 8.0E-11 |
sp|Q6FC71|SYC_ACIAD | Cysteine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysS PE=3 SV=1 | 1 | 82 | 9.0E-11 |
sp|Q8P8J0|SYC_XANCP | Cysteine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysS PE=3 SV=1 | 2 | 85 | 9.0E-11 |
sp|Q4UVJ3|SYC_XANC8 | Cysteine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cysS PE=3 SV=1 | 2 | 85 | 9.0E-11 |
sp|Q8PK23|SYC_XANAC | Cysteine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysS PE=3 SV=1 | 2 | 85 | 1.0E-10 |
sp|Q5GZD9|SYC_XANOR | Cysteine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=cysS PE=3 SV=1 | 2 | 85 | 1.0E-10 |
sp|Q2P2E8|SYC_XANOM | Cysteine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cysS PE=3 SV=1 | 2 | 85 | 1.0E-10 |
sp|Q8NMD7|SYC_CORGL | Cysteine--tRNA ligase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=cysS PE=3 SV=1 | 18 | 82 | 1.0E-10 |
sp|A4QH41|SYC_CORGB | Cysteine--tRNA ligase OS=Corynebacterium glutamicum (strain R) GN=cysS PE=3 SV=1 | 18 | 82 | 1.0E-10 |
sp|A8LLR2|SYC_DINSH | Cysteine--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=cysS PE=3 SV=1 | 18 | 82 | 1.0E-10 |
sp|Q8DWA9|SYC_STRMU | Cysteine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=cysS PE=3 SV=1 | 4 | 79 | 1.0E-10 |
sp|Q0AM03|SYC_MARMM | Cysteine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=cysS PE=3 SV=1 | 18 | 83 | 2.0E-10 |
sp|A3MS54|SYC_PYRCJ | Cysteine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=cysS PE=3 SV=1 | 18 | 99 | 2.0E-10 |
sp|Q3STA1|SYC_NITWN | Cysteine--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=cysS PE=3 SV=1 | 18 | 84 | 2.0E-10 |
sp|B1VS94|SYC_STRGG | Cysteine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=cysS PE=3 SV=1 | 18 | 85 | 2.0E-10 |
sp|Q0BXB7|SYC_HYPNA | Cysteine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-10 |
sp|A4F6W7|SYC_SACEN | Cysteine--tRNA ligase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=cysS PE=3 SV=2 | 18 | 82 | 3.0E-10 |
sp|Q5UP36|SYC_MIMIV | Cysteine--tRNA ligase OS=Acanthamoeba polyphaga mimivirus GN=CARS PE=3 SV=1 | 29 | 96 | 3.0E-10 |
sp|A0QAB5|SYC_MYCA1 | Cysteine--tRNA ligase OS=Mycobacterium avium (strain 104) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-10 |
sp|Q743W3|SYC_MYCPA | Cysteine--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysS PE=3 SV=1 | 4 | 82 | 3.0E-10 |
sp|B0T101|SYC_CAUSK | Cysteine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=cysS PE=3 SV=1 | 18 | 82 | 3.0E-10 |
sp|A8F596|SYC_PSELT | Cysteine--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=cysS PE=3 SV=1 | 18 | 82 | 4.0E-10 |
sp|Q9AAY2|SYC_CAUCR | Cysteine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cysS PE=3 SV=1 | 2 | 82 | 5.0E-10 |
sp|B8GZS3|SYC_CAUCN | Cysteine--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cysS PE=3 SV=1 | 2 | 82 | 5.0E-10 |
sp|Q6DJ95|SYCM_XENTR | Probable cysteine--tRNA ligase, mitochondrial OS=Xenopus tropicalis GN=cars2 PE=2 SV=1 | 4 | 96 | 6.0E-10 |
sp|A1RTJ7|SYC_PYRIL | Cysteine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=cysS PE=3 SV=1 | 29 | 99 | 8.0E-10 |
sp|Q6NFC3|SYC_CORDI | Cysteine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=cysS PE=3 SV=1 | 18 | 82 | 9.0E-10 |
sp|Q2RWK2|SYC_RHORT | Cysteine--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=cysS PE=3 SV=1 | 2 | 82 | 9.0E-10 |
sp|Q97WE6|SYC_SULSO | Cysteine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=cysS PE=3 SV=1 | 4 | 83 | 1.0E-09 |
sp|A4WH15|SYC_PYRAR | Cysteine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=cysS PE=3 SV=1 | 29 | 99 | 1.0E-09 |
sp|Q0VML5|SYC_ALCBS | Cysteine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=cysS PE=3 SV=1 | 2 | 79 | 2.0E-09 |
sp|Q82GD0|SYC_STRAW | Cysteine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=cysS PE=3 SV=1 | 18 | 82 | 2.0E-09 |
sp|Q8ZYD8|SYC_PYRAE | Cysteine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=cysS PE=3 SV=1 | 29 | 85 | 2.0E-09 |
sp|A6LJ41|SYC_THEM4 | Cysteine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=cysS PE=3 SV=1 | 2 | 82 | 3.0E-09 |
sp|Q5HBK5|SYC_EHRRW | Cysteine--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=cysS PE=3 SV=1 | 6 | 79 | 4.0E-09 |
sp|Q5FHI9|SYC_EHRRG | Cysteine--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=cysS PE=3 SV=1 | 6 | 79 | 4.0E-09 |
sp|Q4JCA6|SYC_SULAC | Cysteine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=cysS PE=3 SV=1 | 1 | 82 | 5.0E-09 |
sp|Q87EL7|SYC_XYLFT | Cysteine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysS PE=3 SV=2 | 2 | 85 | 5.0E-09 |
sp|Q9PEN3|SYC_XYLFA | Cysteine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=cysS PE=3 SV=2 | 2 | 85 | 5.0E-09 |
sp|Q8FMI8|SYC_COREF | Cysteine--tRNA ligase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=cysS PE=3 SV=2 | 18 | 82 | 6.0E-09 |
sp|Q21JG6|SYC_SACD2 | Cysteine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysS PE=3 SV=1 | 2 | 83 | 2.0E-08 |
sp|C1BAC4|SYC_RHOOB | Cysteine--tRNA ligase OS=Rhodococcus opacus (strain B4) GN=cysS PE=3 SV=1 | 18 | 82 | 2.0E-08 |
sp|C5BI15|SYC_TERTT | Cysteine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysS PE=3 SV=1 | 2 | 79 | 3.0E-08 |
sp|Q0S888|SYC_RHOJR | Cysteine--tRNA ligase OS=Rhodococcus jostii (strain RHA1) GN=cysS PE=3 SV=1 | 18 | 82 | 3.0E-08 |
sp|B4RE90|SYC_PHEZH | Cysteine--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=cysS PE=3 SV=1 | 18 | 82 | 9.0E-08 |
sp|A7HWJ0|SYC_PARL1 | Cysteine--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=cysS PE=3 SV=1 | 2 | 83 | 1.0E-07 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 16 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|5821 MVSLKIHNSLQPGNPVPFKPIEAGKVSWYACGPTVYDKSHLGHARNYVSTDIIRRILMHYFGFRVRFVMNMTDVD DKIIIKARRQRLLELEKKKTHSPQELRALASAAFQAYAKSNLPLLAADGTQLDEKNYNARRDAAYQKVLAGSTLS GEGKPGDGEAKIKMHLGNMDAAARALADDAVFPGADEVLLPYLDSLYKETIDTRDQSMFTDLTKSMEDLFTQDMD NLNVLRPDVITRVTEYMPQIVKFVEQIVDKGFAYEAQGSVYFDIAAFEKAGNTYTRLRPDGRNDKSLQDEGEGSL SKNLAGKKGAGDFALWKRSKAGEPFWPSKWGDGRPGWHIECSVMASDILGSRMDIHSGGIDLAFPHHDNELAQSE AFFCEGGEHTWVNYFLHMGHLSISGSKMSKSLKNFQTIQDALATSYTARSMRIVFLMGKWNDGVEISPDMRAQAD NWEATISNFFTNTKAWLAEADDKPTPIDNDVNNLSLEDKKLIADLDQAKKEVEAALVNSFDTPRAMLIMLKLVNS TNAQLKDKQGAINLSQVEAIARWITKMVGIFGLDANAQPPYDGLGWVSSLAADVDAETAVKPYAAVLDKVRADVA SLSLSNDRLSTLIAIDPSAESRAASEKGTRDIEKLSLPYLRAVSHIRDELRRTLSTQPPTTKKQILSLTDAIRDD HLSRLGVYLDDRPDSQPALIKFVPAADLLAAREEKAAREADKARQKEEARLARERADKEARDKARVPPEDMFRGD ERYGEWDEQGLPTRMRDGSDVPKSQMKALKKMWEKQKRVHEELKAKGGL* |
Coding | >Ophun1|5821 ATGGTGTCGCTCAAGATCCATAACTCGTTGCAGCCCGGCAATCCTGTGCCCTTTAAGCCCATTGAAGCTGGCAAG GTGTCGTGGTATGCTTGCGGACCGACAGTCTACGACAAGAGCCACCTGGGTCATGCGCGGAACTACGTCTCGACG GACATAATTCGTCGCATCTTAATGCATTACTTTGGTTTTCGCGTTCGTTTCGTCATGAACATGACGGATGTCGAC GACAAGATCATCATCAAGGCGAGGAGGCAACGACTGCTGGAGCTCGAGAAGAAGAAGACGCACTCGCCACAAGAG CTGAGGGCCTTGGCCTCCGCTGCTTTCCAAGCCTACGCCAAATCCAACCTTCCCCTGCTGGCCGCGGACGGTACC CAGCTGGACGAGAAAAACTACAATGCGCGTCGAGACGCTGCCTATCAAAAGGTGCTGGCGGGGAGCACGCTGTCT GGGGAGGGCAAGCCCGGCGATGGAGAGGCCAAGATCAAGATGCACCTTGGCAACATGGACGCGGCGGCCCGGGCG CTCGCCGACGACGCCGTGTTTCCGGGTGCCGATGAGGTCCTCCTCCCCTACCTCGACTCACTCTATAAAGAGACG ATCGATACCCGAGACCAGTCCATGTTCACGGACCTCACAAAGAGCATGGAGGATCTATTTACACAAGACATGGAT AATCTCAACGTGCTGAGGCCGGATGTCATTACCAGAGTGACGGAGTACATGCCGCAGATTGTCAAGTTTGTCGAG CAGATTGTCGACAAAGGCTTCGCGTACGAGGCCCAAGGATCCGTCTACTTCGACATTGCTGCCTTCGAAAAGGCC GGCAACACGTACACTCGACTGCGGCCCGACGGACGCAACGACAAATCGCTGCAGGACGAGGGCGAGGGCTCGCTG TCCAAGAACCTGGCCGGCAAGAAAGGCGCCGGCGACTTTGCCCTGTGGAAGAGGTCCAAGGCAGGCGAGCCTTTT TGGCCGAGCAAATGGGGCGACGGTCGGCCGGGATGGCATATTGAGTGCTCCGTCATGGCTTCGGACATTCTCGGC TCTCGCATGGACATTCACTCTGGCGGCATCGACCTCGCGTTTCCCCATCACGATAATGAGCTGGCTCAGAGCGAA GCCTTCTTCTGCGAGGGGGGCGAGCATACTTGGGTCAACTACTTCCTCCACATGGGGCATCTCTCCATCTCGGGC TCCAAAATGTCCAAGTCGCTCAAGAACTTCCAGACGATCCAGGATGCGCTGGCGACGTCGTACACGGCCCGGAGC ATGCGCATCGTCTTTCTGATGGGCAAGTGGAACGACGGCGTCGAGATATCGCCCGACATGAGGGCTCAGGCCGAC AACTGGGAGGCCACCATCAGCAACTTCTTTACCAACACCAAAGCCTGGCTGGCCGAGGCCGATGACAAGCCAACA CCCATCGACAACGACGTCAACAACCTATCCCTCGAAGACAAGAAGCTCATCGCAGACCTCGATCAGGCAAAAAAA GAGGTCGAAGCCGCGCTCGTCAACTCGTTCGATACACCGCGGGCAATGCTCATCATGCTCAAACTAGTCAACTCG ACAAACGCCCAGCTCAAAGACAAGCAGGGCGCCATCAACCTAAGCCAAGTCGAAGCCATCGCCCGCTGGATCACA AAGATGGTCGGCATCTTCGGGCTCGACGCCAATGCCCAGCCTCCCTACGACGGCCTGGGCTGGGTCTCCTCCCTG GCGGCCGACGTCGACGCCGAGACAGCAGTGAAGCCATACGCAGCGGTCCTAGACAAAGTCAGGGCCGACGTCGCG AGCCTGTCGCTATCGAACGATAGACTATCGACACTCATCGCCATAGACCCAAGCGCCGAGTCGCGCGCCGCGTCA GAAAAGGGAACGCGCGACATAGAGAAGCTCTCCCTCCCATACCTCCGCGCCGTGTCTCACATCCGCGACGAACTC CGCCGCACCCTCTCAACCCAACCCCCAACAACCAAGAAGCAAATCCTCTCCCTCACAGACGCCATCCGCGACGAC CACCTCAGCCGTCTGGGCGTCTACCTCGACGACCGCCCCGACAGCCAGCCCGCCCTCATCAAGTTCGTCCCGGCC GCAGATCTCCTCGCCGCGCGGGAGGAAAAGGCCGCGAGGGAGGCAGACAAGGCGCGGCAGAAGGAGGAGGCTAGG CTGGCGCGCGAGAGGGCTGACAAGGAGGCCAGAGACAAGGCTAGGGTTCCGCCAGAGGACATGTTTCGGGGGGAC GAGCGGTATGGAGAGTGGGATGAGCAGGGATTGCCGACGAGGATGAGGGATGGGAGTGACGTGCCCAAGAGTCAG ATGAAGGCGCTGAAGAAGATGTGGGAGAAGCAGAAGAGGGTGCATGAGGAGTTGAAGGCGAAGGGGGGGTTGTAG |
Transcript | >Ophun1|5821 ATGGTGTCGCTCAAGATCCATAACTCGTTGCAGCCCGGCAATCCTGTGCCCTTTAAGCCCATTGAAGCTGGCAAG GTGTCGTGGTATGCTTGCGGACCGACAGTCTACGACAAGAGCCACCTGGGTCATGCGCGGAACTACGTCTCGACG GACATAATTCGTCGCATCTTAATGCATTACTTTGGTTTTCGCGTTCGTTTCGTCATGAACATGACGGATGTCGAC GACAAGATCATCATCAAGGCGAGGAGGCAACGACTGCTGGAGCTCGAGAAGAAGAAGACGCACTCGCCACAAGAG CTGAGGGCCTTGGCCTCCGCTGCTTTCCAAGCCTACGCCAAATCCAACCTTCCCCTGCTGGCCGCGGACGGTACC CAGCTGGACGAGAAAAACTACAATGCGCGTCGAGACGCTGCCTATCAAAAGGTGCTGGCGGGGAGCACGCTGTCT GGGGAGGGCAAGCCCGGCGATGGAGAGGCCAAGATCAAGATGCACCTTGGCAACATGGACGCGGCGGCCCGGGCG CTCGCCGACGACGCCGTGTTTCCGGGTGCCGATGAGGTCCTCCTCCCCTACCTCGACTCACTCTATAAAGAGACG ATCGATACCCGAGACCAGTCCATGTTCACGGACCTCACAAAGAGCATGGAGGATCTATTTACACAAGACATGGAT AATCTCAACGTGCTGAGGCCGGATGTCATTACCAGAGTGACGGAGTACATGCCGCAGATTGTCAAGTTTGTCGAG CAGATTGTCGACAAAGGCTTCGCGTACGAGGCCCAAGGATCCGTCTACTTCGACATTGCTGCCTTCGAAAAGGCC GGCAACACGTACACTCGACTGCGGCCCGACGGACGCAACGACAAATCGCTGCAGGACGAGGGCGAGGGCTCGCTG TCCAAGAACCTGGCCGGCAAGAAAGGCGCCGGCGACTTTGCCCTGTGGAAGAGGTCCAAGGCAGGCGAGCCTTTT TGGCCGAGCAAATGGGGCGACGGTCGGCCGGGATGGCATATTGAGTGCTCCGTCATGGCTTCGGACATTCTCGGC TCTCGCATGGACATTCACTCTGGCGGCATCGACCTCGCGTTTCCCCATCACGATAATGAGCTGGCTCAGAGCGAA GCCTTCTTCTGCGAGGGGGGCGAGCATACTTGGGTCAACTACTTCCTCCACATGGGGCATCTCTCCATCTCGGGC TCCAAAATGTCCAAGTCGCTCAAGAACTTCCAGACGATCCAGGATGCGCTGGCGACGTCGTACACGGCCCGGAGC ATGCGCATCGTCTTTCTGATGGGCAAGTGGAACGACGGCGTCGAGATATCGCCCGACATGAGGGCTCAGGCCGAC AACTGGGAGGCCACCATCAGCAACTTCTTTACCAACACCAAAGCCTGGCTGGCCGAGGCCGATGACAAGCCAACA CCCATCGACAACGACGTCAACAACCTATCCCTCGAAGACAAGAAGCTCATCGCAGACCTCGATCAGGCAAAAAAA GAGGTCGAAGCCGCGCTCGTCAACTCGTTCGATACACCGCGGGCAATGCTCATCATGCTCAAACTAGTCAACTCG ACAAACGCCCAGCTCAAAGACAAGCAGGGCGCCATCAACCTAAGCCAAGTCGAAGCCATCGCCCGCTGGATCACA AAGATGGTCGGCATCTTCGGGCTCGACGCCAATGCCCAGCCTCCCTACGACGGCCTGGGCTGGGTCTCCTCCCTG GCGGCCGACGTCGACGCCGAGACAGCAGTGAAGCCATACGCAGCGGTCCTAGACAAAGTCAGGGCCGACGTCGCG AGCCTGTCGCTATCGAACGATAGACTATCGACACTCATCGCCATAGACCCAAGCGCCGAGTCGCGCGCCGCGTCA GAAAAGGGAACGCGCGACATAGAGAAGCTCTCCCTCCCATACCTCCGCGCCGTGTCTCACATCCGCGACGAACTC CGCCGCACCCTCTCAACCCAACCCCCAACAACCAAGAAGCAAATCCTCTCCCTCACAGACGCCATCCGCGACGAC CACCTCAGCCGTCTGGGCGTCTACCTCGACGACCGCCCCGACAGCCAGCCCGCCCTCATCAAGTTCGTCCCGGCC GCAGATCTCCTCGCCGCGCGGGAGGAAAAGGCCGCGAGGGAGGCAGACAAGGCGCGGCAGAAGGAGGAGGCTAGG CTGGCGCGCGAGAGGGCTGACAAGGAGGCCAGAGACAAGGCTAGGGTTCCGCCAGAGGACATGTTTCGGGGGGAC GAGCGGTATGGAGAGTGGGATGAGCAGGGATTGCCGACGAGGATGAGGGATGGGAGTGACGTGCCCAAGAGTCAG ATGAAGGCGCTGAAGAAGATGTGGGAGAAGCAGAAGAGGGTGCATGAGGAGTTGAAGGCGAAGGGGGGGTTGTAG |
Gene | >Ophun1|5821 ATGGTGTCGCTCAAGATCCATAACTCGTTGCAGCCCGGCAATCCTGTGCCCTTTAAGCCCATTGAAGCTGGCAAG GTGTCGTGGTATGCTTGCGGACCGACAGTCTACGACAAGAGCCACCTGGGTCATGCGCGGAACTACGTCTCGACG GACATAATTCGTCGCATCTTAATGCATTACTTTGGTTTTCGCGTTCGTTTCGTCATGAACATGACGGATGTCGAC GACAAGGTGAGTGAAACAAGAGATATTGTCGACTTGATTATTGATTCAAGGCTGACACAGCAACCAGATCATCAT CAAGGCGAGGAGGCAACGACTGCTGGAGCTCGAGAAGAAGAAGACGCACTCGCCACAAGAGCTGAGGGCCTTGGC CTCCGCTGCTTTCCAAGCCTACGCCAAATCCAACCTTCCCCTGCTGGCCGCGGACGGTACCCAGCTGGACGAGAA AAACTACAATGCGCGTCGAGACGCTGCCTATCAAAAGGTGCTGGCGGGGAGCACGCTGTCTGGGGAGGGCAAGCC CGGCGATGGAGAGGCCAAGATCAAGATGCACCTTGGCAACATGGACGCGGCGGCCCGGGCGCTCGCCGACGACGC CGTGTTTCCGGGTGCCGATGAGGTCCTCCTCCCCTACCTCGACTCACTCTATAAAGAGACGATCGATACCCGAGA CCAGTCCATGTTCACGGACCTCACAAAGAGCATGGAGGATCTATTTACACAAGACATGGATAATCTCAACGTGCT GAGGCCGGATGTCATTACCAGAGTGACGGAGTACATGCCGCAGATTGTCAAGTTTGTCGAGCAGATTGTCGACAA AGGCTTCGCGTACGAGGCCCAAGGATCCGTCTACTTCGACATTGCTGCCTTCGAAAAGGCCGGCAACACGTACAC TCGACTGCGGCCCGACGGACGCAACGACAAATCGCTGCAGGACGAGGGCGAGGGCTCGCTGTCCAAGAACCTGGC CGGCAAGAAAGGCGCCGGCGACTTTGCCCTGTGGAAGAGGTCCAAGGCAGGCGAGCCTTTTTGGCCGAGCAAATG GGGCGACGGTCGGCCGGGATGGCATATTGAGTGCTCCGTCATGGCTTCGGACATTCTCGGCTCTCGCATGGACAT TCACTCTGGCGGCATCGACCTCGCGTTTCCCCATCACGATAATGAGCTGGCTCAGAGCGAAGCCTTCTTCTGCGA GGGGGGCGAGCATACTTGGGTCAACTACTTCCTCCACATGGGGCATCTCTCCATCTCGGGCTCCAAAATGTCCAA GTCGCTCAAGAACTTCCAGACGATCCAGGATGCGCTGGCGACGTCGTACACGGCCCGGAGCATGCGCATCGTCTT TCTGATGGGCAAGTGGAACGACGGCGTCGAGATATCGCCCGACATGAGGGCTCAGGCCGACAACTGGGAGGCCAC CATCAGCGTACGTCATTTCTCCCTGGTTCTCATAGCTGTGCCGTCTGACGTCTTTGATAGAACTTCTTTACCAAC ACCAAAGCCTGGCTGGCCGAGGCCGATGACAAGCCAACACCCATCGACAACGACGTCAACAACCTATCCCTCGAA GACAAGAAGCTCATCGCAGACCTCGATCAGGCAAAAAAAGAGGTCGAAGCCGCGCTCGTCAACTCGTTCGATACA CCGCGGGCAATGCTCATCATGCTCAAACTAGTCAACTCGACAAACGCCCAGCTCAAAGACAAGCAGGGCGCCATC AACCTAAGCCAAGTCGAAGCCATCGCCCGCTGGATCACAAAGATGGTCGGCATCTTCGGGCTCGACGCCAATGCC CAGCCTCCCTACGACGGCCTGGGCTGGGTCTCCTCCCTGGCGGCCGACGTCGACGCCGAGACAGCAGTGAAGCCA TACGCAGCGGTCCTAGACAAAGTCAGGGCCGACGTCGCGAGCCTGTCGCTATCGAACGATAGACTATCGACACTC ATCGCCATAGACCCAAGCGCCGAGTCGCGCGCCGCGTCAGAAAAGGGAACGCGCGACATAGAGAAGCTCTCCCTC CCATACCTCCGCGCCGTGTCTCACATCCGCGACGAACTCCGCCGCACCCTCTCAACCCAACCCCCAACAACCAAG AAGCAAATCCTCTCCCTCACAGACGCCATCCGCGACGACCACCTCAGCCGTCTGGGCGTCTACCTCGACGACCGC CCCGACAGCCAGCCCGCCCTCATCAAGTTCGTCCCGGCCGCAGATCTCCTCGCCGCGCGGGAGGAAAAGGCCGCG AGGGAGGCAGACAAGGCGCGGCAGAAGGAGGAGGCTAGGCTGGCGCGCGAGAGGGCTGACAAGGAGGCCAGAGAC AAGGCTAGGGTTCCGCCAGAGGACATGTTTCGGGGGGACGAGCGGTATGGAGAGTGGGATGAGCAGGGATTGCCG ACGAGGATGAGGGATGGGAGTGACGTGCCCAAGAGTCAGATGAAGGCGCTGAAGAAGATGTGGGAGAAGCAGAAG AGGGTGCATGAGGAGTTGAAGGCGAAGGGGGGGTTGTAG |