Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5818
Gene name
LocationContig_6:25965..27550
Strand-
Gene length (bp)1585
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09362 DUF1996 Domain of unknown function (DUF1996) 5.2E-84 33 284

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999372

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3939
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6175
Ophiocordyceps australis map64 (Brazil) OphauB2|1713
Ophiocordyceps camponoti-floridani Ophcf2|05319
Ophiocordyceps camponoti-rufipedis Ophun1|5818 (this protein)
Ophiocordyceps kimflemingae Ophio5|3770
Ophiocordyceps subramaniannii Hirsu2|784

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5818
MKTSTTLCAAFAASANAFWRMECPGRVGLARIDPIVNPDEISNHVHSIAGSSAFSESSNYTDLINGKCTSCRVTQ
DKSSYWHPALYFKDANTNKYEVVEQVGGMLAYYLLNGEHITAFPPGFRMLSGNTNRNSYSLGDPSHPDPDKSAWA
SMGQTTQDDLAQRAIGFNCLNYGKAPEGTLFRHFLPDKQYLDANCKDGVRFEIMFPSCWKGGDAVDSPNHQDHVA
FPDLVMTGTCPPTHPKRLPGLLYEVIWNTEAFKDRQGKFVLSNGDSTGYAYHGDFMMGWDPAFLQKAVDTCTNDS
GRIEDCPLFDIIDKAEACQCSLEGPMPESVSKEDVKGPMDKLPGGKDSHPIKEKPVSGPVPTLHYTPGHKPTDPA
APLPGDVFKQKAAQAAEAAVVPALMNAEQGPAPTPAPAAAAEDNKSYYSTQYVTNGNVVSKILVEAQTVYVSQYA
EPTPQAEQNRRRAVHMHKHAHFRRRQ*
Coding >Ophun1|5818
ATGAAGACCTCGACTACCCTCTGCGCCGCCTTCGCCGCCAGCGCCAACGCCTTCTGGCGTATGGAGTGCCCCGGC
CGCGTTGGACTGGCCCGCATCGACCCCATTGTTAACCCCGACGAGATCTCCAACCATGTTCACTCGATTGCTGGT
TCCTCCGCCTTCTCGGAGAGCTCCAACTACACCGATCTCATCAACGGCAAGTGCACTTCTTGCCGCGTCACGCAG
GATAAGTCGTCGTACTGGCACCCTGCCCTCTACTTCAAGGACGCGAACACCAACAAGTACGAGGTTGTCGAGCAG
GTTGGCGGCATGCTTGCTTACTACCTACTCAACGGCGAACACATTACCGCCTTCCCGCCCGGCTTCCGCATGCTG
TCTGGAAACACCAACAGGAACTCGTACTCGCTCGGTGACCCCAGCCATCCTGATCCAGACAAGTCGGCCTGGGCC
TCAATGGGTCAGACGACGCAGGACGATCTTGCTCAGCGCGCCATCGGCTTCAACTGCCTCAACTACGGCAAGGCC
CCCGAGGGCACCCTTTTCCGTCACTTCCTCCCCGACAAGCAGTACCTCGACGCCAATTGCAAGGATGGTGTTCGA
TTTGAAATCATGTTTCCCTCGTGCTGGAAGGGCGGTGATGCTGTCGACAGTCCGAACCACCAGGACCACGTCGCC
TTCCCCGACCTCGTCATGACGGGAACCTGCCCCCCGACTCACCCCAAGCGCCTGCCCGGCCTCCTGTACGAGGTC
ATCTGGAACACGGAGGCCTTCAAGGACAGGCAGGGCAAGTTTGTCCTTTCGAACGGTGACTCTACTGGCTACGCC
TACCACGGTGACTTCATGATGGGCTGGGACCCGGCTTTCCTCCAGAAGGCCGTCGACACGTGCACCAACGACTCT
GGCCGGATCGAGGACTGCCCCCTGTTCGACATCATCGACAAGGCGGAAGCCTGCCAGTGCTCCCTGGAAGGCCCC
ATGCCGGAGTCGGTCTCCAAGGAGGACGTCAAGGGCCCCATGGACAAGCTCCCCGGCGGCAAGGACAGCCACCCG
ATCAAGGAGAAGCCGGTGTCCGGGCCCGTGCCGACGCTCCACTACACTCCCGGCCACAAGCCCACGGACCCTGCC
GCTCCCCTCCCCGGCGACGTCTTCAAGCAGAAGGCGGCCCAGGCAGCCGAGGCGGCCGTCGTCCCGGCCCTGATG
AACGCCGAGCAGGGACCGGCTCCGACGCCCGCGCCGGCCGCCGCTGCCGAGGACAACAAGAGCTACTACAGCACC
CAATACGTGACCAACGGCAACGTCGTCAGCAAGATCCTGGTCGAGGCGCAGACGGTCTACGTGTCTCAGTACGCA
GAGCCCACGCCCCAGGCCGAACAGAACCGCCGTCGGGCCGTCCACATGCACAAGCACGCGCACTTCCGCCGCAGG
CAATAA
Transcript >Ophun1|5818
ATGAAGACCTCGACTACCCTCTGCGCCGCCTTCGCCGCCAGCGCCAACGCCTTCTGGCGTATGGAGTGCCCCGGC
CGCGTTGGACTGGCCCGCATCGACCCCATTGTTAACCCCGACGAGATCTCCAACCATGTTCACTCGATTGCTGGT
TCCTCCGCCTTCTCGGAGAGCTCCAACTACACCGATCTCATCAACGGCAAGTGCACTTCTTGCCGCGTCACGCAG
GATAAGTCGTCGTACTGGCACCCTGCCCTCTACTTCAAGGACGCGAACACCAACAAGTACGAGGTTGTCGAGCAG
GTTGGCGGCATGCTTGCTTACTACCTACTCAACGGCGAACACATTACCGCCTTCCCGCCCGGCTTCCGCATGCTG
TCTGGAAACACCAACAGGAACTCGTACTCGCTCGGTGACCCCAGCCATCCTGATCCAGACAAGTCGGCCTGGGCC
TCAATGGGTCAGACGACGCAGGACGATCTTGCTCAGCGCGCCATCGGCTTCAACTGCCTCAACTACGGCAAGGCC
CCCGAGGGCACCCTTTTCCGTCACTTCCTCCCCGACAAGCAGTACCTCGACGCCAATTGCAAGGATGGTGTTCGA
TTTGAAATCATGTTTCCCTCGTGCTGGAAGGGCGGTGATGCTGTCGACAGTCCGAACCACCAGGACCACGTCGCC
TTCCCCGACCTCGTCATGACGGGAACCTGCCCCCCGACTCACCCCAAGCGCCTGCCCGGCCTCCTGTACGAGGTC
ATCTGGAACACGGAGGCCTTCAAGGACAGGCAGGGCAAGTTTGTCCTTTCGAACGGTGACTCTACTGGCTACGCC
TACCACGGTGACTTCATGATGGGCTGGGACCCGGCTTTCCTCCAGAAGGCCGTCGACACGTGCACCAACGACTCT
GGCCGGATCGAGGACTGCCCCCTGTTCGACATCATCGACAAGGCGGAAGCCTGCCAGTGCTCCCTGGAAGGCCCC
ATGCCGGAGTCGGTCTCCAAGGAGGACGTCAAGGGCCCCATGGACAAGCTCCCCGGCGGCAAGGACAGCCACCCG
ATCAAGGAGAAGCCGGTGTCCGGGCCCGTGCCGACGCTCCACTACACTCCCGGCCACAAGCCCACGGACCCTGCC
GCTCCCCTCCCCGGCGACGTCTTCAAGCAGAAGGCGGCCCAGGCAGCCGAGGCGGCCGTCGTCCCGGCCCTGATG
AACGCCGAGCAGGGACCGGCTCCGACGCCCGCGCCGGCCGCCGCTGCCGAGGACAACAAGAGCTACTACAGCACC
CAATACGTGACCAACGGCAACGTCGTCAGCAAGATCCTGGTCGAGGCGCAGACGGTCTACGTGTCTCAGTACGCA
GAGCCCACGCCCCAGGCCGAACAGAACCGCCGTCGGGCCGTCCACATGCACAAGCACGCGCACTTCCGCCGCAGG
CAATAA
Gene >Ophun1|5818
ATGAAGACCTCGACTACCCTCTGCGCCGCCTTCGCCGCCAGCGCCAACGCCTTCTGGCGTATGGAGTGCCCCGGC
CGCGTTGGACTGGCCCGCATCGACCCCATTGTTAACCCCGACGAGATCTCCAACCATGTTCACTCGATTGCTGGT
TCCTCCGGTGAGTCTTTCTCTAGGTAAAATCTCCAGGTTGCCGCTGACTTGCCATAGCCTTCTCGGAGAGCTCCA
ACTACACCGATCTCATCAACGGCAAGTGCACTTCTTGCCGCGTCACGCAGGATAAGTCGTCGTACTGGCACCCTG
CCCTCTACTTCAAGGACGCGAACACCAACAAGTACGAGGTTGTCGAGCAGGTTGGCGGCATGCTTGCGTAGGTTT
CTTCCATGGTCCCGTCACATACTGGTTTCTGACCGACTCCGCTCAGTTACTACCTACTCAACGGCGAACACATTA
CCGCCTTCCCGCCCGGCTTCCGCATGCTGTCTGGAAACACCAACAGGAACTCGTACTCGCTCGGTGACCCCAGCC
ATCCTGATCCAGACAAGTCGGCCTGGGCCTCAATGGGTCAGACGACGCAGGACGATCTTGCTCAGCGCGCCATCG
GCTTCAACTGCCTCAACTACGGCAAGGCCCCCGAGGGCACCCTTTTCCGTCACTTCCTCCCCGACAAGCAGTACC
TCGACGCCAATTGCAAGGATGGTGTTCGATTTGAAATCATGTTTCCCTCGTGCTGGAAGGGCGGTGATGCTGTCG
ACAGTCCGAACCACCAGGACCACGTCGCCTTCCCCGACCTCGTCATGACGGGAACCTGCCCCCCGACTCACCCCA
AGCGCCTGCCCGGCCTCCTGTACGAGGTCATCTGGAACACGGAGGCCTTCAAGGACAGGCAGGGCAAGTTTGTCC
TTTCGAACGGTGACTCTACTGGTAAGCAGACACTTTGAATTCCTGTCCTTGTTTCCGTCTGACGTGCCCAGGCTA
CGCCTACCACGGTGACTTCATGATGGGCTGGGACCCGGCTTTCCTCCAGAAGGCCGTCGACACGTGCACCAACGA
CTCTGGCCGGATCGAGGACTGCCCCCTGTTCGACATCATCGACAAGGCGGAAGCCTGCCAGTGCTCCCTGGAAGG
CCCCATGCCGGAGTCGGTCTCCAAGGAGGACGTCAAGGGCCCCATGGACAAGCTCCCCGGCGGCAAGGACAGCCA
CCCGATCAAGGAGAAGCCGGTGTCCGGGCCCGTGCCGACGCTCCACTACACTCCCGGCCACAAGCCCACGGACCC
TGCCGCTCCCCTCCCCGGCGACGTCTTCAAGCAGAAGGCGGCCCAGGCAGCCGAGGCGGCCGTCGTCCCGGCCCT
GATGAACGCCGAGCAGGGACCGGCTCCGACGCCCGCGCCGGCCGCCGCTGCCGAGGACAACAAGAGCTACTACAG
CACCCAATACGTGACCAACGGCAACGTCGTCAGCAAGATCCTGGTCGAGGCGCAGACGGTCTACGTGTCTCAGTA
CGCAGAGCCCACGCCCCAGGCCGAACAGAACCGCCGTCGGGCCGTCCACATGCACAAGCACGCGCACTTCCGCCG
CAGGCAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail