Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5810
Gene name
LocationContig_6:9820..10807
Strand+
Gene length (bp)987
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6473
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|5810 (this protein)
Ophiocordyceps kimflemingae Ophio5|6366
Ophiocordyceps subramaniannii Hirsu2|10

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5810
MPSYRYYDSDDSASSGEIELRSRPHVRVSPNCGACGFPFNLEEPYRIFIRVDKQTTGPILSADYKQFAGTKLPPH
YFLGAWEDSLYLCGQIDCGQCEYSPDSYAYSTDTGVVHTDCLKLFLSLFPDNSQGSSQGLREGLRQIRLAAAMRS
PWKGAYLDLTPIIDVRVMGTLVPGMRRLPAEIATIIHDLSSPTTLRYCSTLQLFRELSSPNTCSQYKSMPLTNIK
SWERGGQPETQDYDYDLPLIRLVLDSRGLLSITRLRERDSPCVDQYYPSQHFGYVLESAQALSHVVFDFEVSIRF
TM*
Coding >Ophun1|5810
ATGCCTTCATACAGGTATTACGACAGCGACGACAGCGCTAGCAGCGGCGAGATCGAGTTGAGATCGAGGCCGCAC
GTACGGGTGTCTCCCAACTGTGGAGCCTGTGGCTTTCCCTTCAACCTCGAAGAGCCTTACCGAATTTTTATCCGA
GTAGACAAGCAAACCACTGGCCCAATCTTATCTGCCGATTACAAGCAGTTTGCAGGGACCAAGCTGCCCCCTCAC
TACTTTTTGGGCGCGTGGGAAGACAGTCTATACCTATGTGGCCAGATCGACTGCGGCCAGTGCGAATACTCGCCA
GACTCTTACGCGTACTCTACAGATACTGGCGTGGTTCACACGGACTGCCTCAAGCTGTTCCTCAGCCTCTTCCCC
GACAACAGCCAAGGTTCCAGCCAGGGCCTCCGAGAAGGGCTACGCCAGATCCGACTTGCGGCCGCTATGCGTAGT
CCTTGGAAGGGCGCATACCTTGACTTAACCCCAATCATCGATGTCCGGGTCATGGGAACCCTCGTTCCCGGCATG
AGGCGATTGCCTGCTGAGATCGCGACCATAATTCACGATCTCTCGTCGCCAACTACCTTGCGATATTGCAGTACT
CTACAGCTCTTTCGCGAGTTGTCATCCCCGAACACATGCAGTCAATACAAGTCTATGCCTCTAACCAATATCAAG
AGCTGGGAGCGGGGCGGACAACCGGAAACCCAGGACTACGACTACGACCTCCCTTTAATCCGTCTAGTTCTGGAT
TCGCGAGGTTTGCTGTCTATTACGCGGCTTCGGGAGCGGGATTCACCATGCGTCGACCAATACTACCCATCTCAA
CATTTCGGATACGTCCTAGAAAGTGCCCAAGCCTTGTCTCATGTCGTCTTCGACTTTGAGGTAAGTATCCGTTTT
ACCATGTAG
Transcript >Ophun1|5810
ATGCCTTCATACAGGTATTACGACAGCGACGACAGCGCTAGCAGCGGCGAGATCGAGTTGAGATCGAGGCCGCAC
GTACGGGTGTCTCCCAACTGTGGAGCCTGTGGCTTTCCCTTCAACCTCGAAGAGCCTTACCGAATTTTTATCCGA
GTAGACAAGCAAACCACTGGCCCAATCTTATCTGCCGATTACAAGCAGTTTGCAGGGACCAAGCTGCCCCCTCAC
TACTTTTTGGGCGCGTGGGAAGACAGTCTATACCTATGTGGCCAGATCGACTGCGGCCAGTGCGAATACTCGCCA
GACTCTTACGCGTACTCTACAGATACTGGCGTGGTTCACACGGACTGCCTCAAGCTGTTCCTCAGCCTCTTCCCC
GACAACAGCCAAGGTTCCAGCCAGGGCCTCCGAGAAGGGCTACGCCAGATCCGACTTGCGGCCGCTATGCGTAGT
CCTTGGAAGGGCGCATACCTTGACTTAACCCCAATCATCGATGTCCGGGTCATGGGAACCCTCGTTCCCGGCATG
AGGCGATTGCCTGCTGAGATCGCGACCATAATTCACGATCTCTCGTCGCCAACTACCTTGCGATATTGCAGTACT
CTACAGCTCTTTCGCGAGTTGTCATCCCCGAACACATGCAGTCAATACAAGTCTATGCCTCTAACCAATATCAAG
AGCTGGGAGCGGGGCGGACAACCGGAAACCCAGGACTACGACTACGACCTCCCTTTAATCCGTCTAGTTCTGGAT
TCGCGAGGTTTGCTGTCTATTACGCGGCTTCGGGAGCGGGATTCACCATGCGTCGACCAATACTACCCATCTCAA
CATTTCGGATACGTCCTAGAAAGTGCCCAAGCCTTGTCTCATGTCGTCTTCGACTTTGAGGTAAGTATCCGTTTT
ACCATGTAG
Gene >Ophun1|5810
ATGCCTTCATACAGGTATTACGACAGCGACGACAGCGCTAGCAGCGGCGAGATCGAGTTGAGATCGAGGCCGCAC
GTACGGGTGTCTCCCAACTGTGGAGCCTGTGGCTTTCCCTTCAACCTCGAAGAGCCTTACCGAATTTGTGAGCTA
TAATTATCCATCAAGGAAGGGCTCTTCTTCGGACATGACCAGGAGGCTAACTGCATCGCCATATGCAAAGTTATC
CGAGTAGACAAGCAAACCACTGGCCCAATCTTATCTGCCGATTACAAGCAGTTTGCAGGGACCAAGCTGCCCCCT
CACTACTTTTTGGGCGCGTGGGAAGACAGTCTATACCTATGTGGCCAGATCGACTGCGGCCAGTGCGAATACTCG
CCAGACTCTTACGCGTACTCTACAGATACTGGCGTGGTTCACACGGACTGCCTCAAGCTGTTCCTCAGCCTCTTC
CCCGACAACAGCCAAGGTTCCAGCCAGGGCCTCCGAGAAGGGCTACGCCAGATCCGACTTGCGGCCGCTATGCGT
AGTCCTTGGAAGGGCGCATACCTTGACTTAACCCCAATCATCGATGTCCGGGTCATGGGAACCCTCGTTCCCGGC
ATGAGGCGATTGCCTGCTGAGATCGCGACCATAATTCACGATCTCTCGTCGCCAACTACCTTGCGATATTGCAGT
ACTCTACAGCTCTTTCGCGAGTTGTCATCCCCGAACACATGCAGTCAATACAAGTCTATGCCTCTAACCAATATC
AAGAGCTGGGAGCGGGGCGGACAACCGGAAACCCAGGACTACGACTACGACCTCCCTTTAATCCGTCTAGTTCTG
GATTCGCGAGGTTTGCTGTCTATTACGCGGCTTCGGGAGCGGGATTCACCATGCGTCGACCAATACTACCCATCT
CAACATTTCGGATACGTCCTAGAAAGTGCCCAAGCCTTGTCTCATGTCGTCTTCGACTTTGAGGTAAGTATCCGT
TTTACCATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail