Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5805
Gene name
LocationContig_599:6305..11456
Strand+
Gene length (bp)5151
Transcript length (bp)4287
Coding sequence length (bp)4287
Protein length (aa) 1429

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10344 Fmp27 Mitochondrial protein from FMP27 7.6E-199 247 1119
PF10293 DUF2405 Domain of unknown function (DUF2405) 1.3E-47 1135 1292

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6LA55|YF49_SCHPO UPF0648 protein C3H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.09c PE=3 SV=2 563 1290 1.0E-30
sp|Q06179|FMP27_YEAST Protein FMP27, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FMP27 PE=1 SV=1 1128 1428 7.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 238 260 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5805
MGSAESPDEAPRRRRRGFMAPRVMDLAGPVFKAGTLTGVTGAITGVGIAIAFDKRPVGSGFAMGCEWFALGSTYW
LFRSLAIASMGGEEQVTTREKVMASGLAGSAGGAVAGLMRGPQAILPCVVFYGLLTSGGQTMINLVASRPPQPLK
EKRSWLESSWMPFRKVTDEEYMERLGEKILRVEADIAICDERIARLKGGGRGGENYLLPEAIAHPIETALVGPFA
LGAAAMALLNPTFLLGLIVLLYLSSFVLFAVIRIVTGVSIQRIGYLSLRRLAYTPRDGVVIEIRSLGLNVHRPTF
AQPTWVSLALNELVVTVDARGQKASKAGGRGDDEDDTSTAPSTPDLKARRDRSSHENIWSKAAKLRQAVKQLHQY
IGWLRLVDVVATNTTVNMVGVGHAQLGSLTIAVDTRRKMVGRSRISQKLRSGDDSLRQAEWIMTLRSLLFTAEGG
ESLEVLDHALFNVHGSLHETLGGLRDVTIALKLGRVSVPYDDLMLCVAKMRTHRQQKEKEEEMNEKKQDMAGEKK
QSKAVPAITTPTTGETDDEDKNEKLMQTVTDSREFFSAILRNIKEVQFAVSFAGLTKKITSIKAATNPMVLTASM
KEVGVDFHRLDPKSPAHRMYFSSKDIAHEALAAALSISIDLDDGQRGPQRFFYVPMATTTARTTLPSKTVQLAHE
SALEERNANILFANSVVTSPSVDLDPVHLPLLIALLRPKPKPAPTQHGPRQQLISRLLPKASLKLSMHEPVVRMR
LKPLQPTTDADDFDLIISSISSVSLDVESSHSPVEDLHYFLDGSLRLQSHRLYYQTSAGDFFDLMTTDSLDVKTH
LAATPDVCVDMTGGIQSFSVSMARQEITDGLRQIVQQLHVDAEPEKAMTTARDGKTAPRRRHNFLRAVPEWLTSY
HFEASDFNIEVAGVDEDIADEMRGVSLHLDSISAEYRAHKLDEPQRRLTRRRAHSRLVSNQSDSDVATPRKKPQT
AGDGRRLVLLARGLEAHMVEAVDQLEIEPFVRLPRLELVLSAVSDGLGPMFHVQATVRTILLQYSLYRHYAVGVA
ILTLRKALMQTERDAPKPRRPSATSPPPLPPASAPPGTTELVTVDVRASLVQVKANMPHEPAMMLHVYGIEAGRH
RWSTPYLATKLVRLFVEPPRMRNVWARVLSVHAGRIDLRESRHKTTMGGYAEEKMLDVVTEAVRLAVPHEVIVDQ
IIDNVINTAKAVQQLHHRFRTGSNEFVLEKKPESAKLLPKTSIRSRNVLLELEDGAFEWKLGIIYRTGRAEQVQR
QVRDEAFSLKVAKVRDEASGRGSKGRSRSVMSRGRGAGTSATATTSAQTGAWFRSRSLDRGRTATPTASGSTTTA
PLLAMPRYDPDGDSLGVPGQAKVSEEDARAQLDAYNALAWQRRIDLAYEASRQAARRMREAYWGDSQVPEDVELP
TSP*
Coding >Ophun1|5805
ATGGGCTCGGCCGAATCCCCGGATGAGGCGCCCCGGCGTCGGCGGCGAGGCTTCATGGCCCCACGCGTCATGGAC
CTCGCCGGACCCGTCTTCAAGGCCGGCACGCTGACCGGAGTTACCGGAGCTATAACCGGCGTCGGCATCGCCATC
GCCTTTGACAAGCGGCCCGTCGGCAGCGGCTTTGCCATGGGCTGCGAATGGTTCGCCCTGGGATCTACATACTGG
CTATTCAGATCGCTGGCCATTGCGTCAATGGGGGGTGAAGAGCAAGTTACGACCAGGGAAAAGGTCATGGCCAGC
GGGCTGGCTGGTTCTGCTGGGGGTGCCGTCGCCGGCCTGATGCGCGGTCCTCAGGCCATTCTTCCCTGTGTCGTC
TTCTACGGCCTGCTGACCAGCGGCGGCCAGACGATGATCAACCTCGTGGCTAGCCGTCCACCTCAACCACTAAAG
GAGAAGCGCAGCTGGCTCGAGTCCAGCTGGATGCCCTTTCGTAAAGTGACGGACGAAGAGTACATGGAGAGACTC
GGCGAGAAGATCCTGCGGGTCGAGGCAGACATTGCCATCTGCGACGAGAGAATTGCGCGGCTCAAGGGGGGGGGA
CGAGGCGGAGAGAACTATCTGCTCCCCGAGGCGATAGCTCATCCCATCGAAACAGCTCTCGTCGGTCCCTTTGCC
CTCGGCGCCGCCGCCATGGCTCTGCTGAACCCGACCTTTCTATTGGGCCTGATTGTGCTGCTCTACCTGTCGTCC
TTTGTCCTCTTTGCCGTCATCCGCATCGTCACGGGCGTCTCCATCCAGCGCATCGGATATCTGTCCCTTCGGCGA
CTGGCCTACACGCCTCGCGATGGCGTCGTCATTGAGATTCGAAGCCTCGGTCTCAACGTCCATCGACCTACCTTT
GCGCAACCGACCTGGGTCAGCCTGGCGCTCAATGAGCTGGTCGTTACCGTCGACGCGCGAGGTCAGAAGGCGTCC
AAGGCCGGCGGTCGCGGTGACGATGAAGACGATACCAGCACCGCCCCGTCGACACCGGACTTGAAGGCGCGTCGT
GACCGGTCCAGCCACGAAAACATCTGGTCCAAGGCGGCCAAGCTCCGGCAGGCCGTCAAACAGCTACACCAATAC
ATCGGCTGGCTTCGCTTGGTGGACGTGGTAGCGACCAATACGACGGTCAACATGGTGGGCGTCGGTCACGCCCAG
CTCGGCAGCCTGACGATAGCCGTCGACACGAGGCGCAAGATGGTCGGACGCTCGCGCATCTCGCAGAAGCTGCGC
TCGGGCGACGACAGCCTCCGACAGGCCGAGTGGATCATGACACTGCGAAGCCTCCTATTTACGGCCGAGGGTGGC
GAGTCGCTCGAGGTGTTGGACCATGCCCTCTTCAACGTCCACGGCTCCCTGCACGAGACTCTGGGAGGCCTTCGC
GACGTCACCATTGCACTCAAGCTGGGAAGGGTCAGCGTGCCGTACGACGACTTGATGCTGTGCGTCGCCAAGATG
CGGACGCACCGGCAGCAAAAGGAGAAGGAGGAGGAGATGAATGAGAAGAAGCAGGATATGGCGGGAGAGAAGAAG
CAGTCCAAAGCTGTGCCAGCGATAACAACGCCGACGACGGGTGAAACAGACGACGAGGACAAGAATGAGAAGCTG
ATGCAGACGGTGACGGACTCGCGCGAATTCTTCAGCGCCATCCTCCGAAACATCAAGGAGGTTCAGTTCGCCGTC
TCGTTCGCCGGCTTGACCAAGAAGATCACGTCCATCAAGGCGGCCACCAACCCAATGGTTCTCACGGCATCGATG
AAGGAAGTGGGCGTCGACTTTCACCGGCTGGACCCCAAGTCGCCAGCTCACCGCATGTACTTTTCGTCAAAGGAC
ATTGCGCACGAGGCGCTGGCAGCGGCCTTGTCCATCTCCATTGATCTTGACGACGGCCAGCGAGGCCCCCAGCGG
TTCTTCTACGTGCCAATGGCGACGACAACAGCCCGGACGACGTTGCCATCCAAGACGGTACAGCTGGCTCACGAG
AGCGCCCTCGAGGAGCGCAACGCCAACATTCTCTTCGCCAACTCGGTGGTGACGTCGCCGTCAGTCGACCTCGAT
CCCGTTCATCTTCCACTCCTCATCGCTCTTCTCCGACCCAAGCCGAAGCCGGCGCCGACGCAACACGGGCCTCGG
CAGCAGCTCATCTCGCGACTGCTCCCCAAGGCCAGCCTCAAGCTGTCGATGCATGAGCCCGTGGTTCGCATGCGA
CTGAAGCCGCTGCAGCCGACGACCGACGCCGACGACTTTGACCTCATCATCTCGTCCATCTCGTCCGTCTCTCTC
GACGTAGAGTCGTCTCACTCTCCCGTCGAGGACCTACACTACTTCCTCGACGGCTCGCTACGCCTCCAGTCGCAC
CGGCTGTACTACCAGACGAGCGCCGGCGACTTCTTTGACTTGATGACGACGGACTCGCTCGACGTCAAGACACAT
CTGGCCGCGACGCCCGACGTCTGTGTCGACATGACGGGCGGTATCCAGTCCTTCTCCGTCAGCATGGCGCGTCAG
GAGATCACAGACGGGCTTCGACAAATTGTGCAGCAGCTTCACGTCGACGCCGAGCCGGAAAAGGCCATGACGACG
GCTCGCGATGGAAAGACGGCACCGCGTCGGCGACACAACTTCTTACGAGCCGTTCCCGAGTGGCTGACGAGCTAT
CACTTTGAGGCTTCAGACTTTAACATCGAGGTGGCTGGCGTCGACGAGGACATTGCCGACGAGATGCGCGGCGTC
TCGCTCCATCTCGACTCCATCTCGGCTGAATACCGCGCTCACAAGCTGGACGAGCCACAGCGACGGCTGACACGG
CGTCGGGCGCATAGCCGGCTGGTCAGTAACCAGTCCGATTCGGACGTGGCGACGCCTCGCAAGAAGCCTCAGACA
GCCGGTGACGGACGTCGTCTCGTCCTTCTAGCCCGTGGTCTCGAGGCGCATATGGTTGAGGCGGTCGATCAGCTC
GAGATTGAGCCGTTTGTGCGGCTTCCACGCCTCGAGCTCGTCCTATCGGCCGTCAGCGACGGACTCGGCCCCATG
TTCCATGTCCAGGCGACGGTTCGAACCATCCTGCTGCAGTACTCGCTGTATCGTCACTACGCCGTCGGTGTGGCC
ATCTTGACGCTGCGCAAGGCTCTGATGCAAACCGAACGCGACGCTCCGAAGCCGCGACGACCCTCAGCAACATCG
CCGCCGCCGTTGCCGCCCGCCAGCGCGCCGCCCGGAACGACTGAGCTCGTCACCGTCGATGTCCGGGCTTCGCTG
GTGCAGGTCAAGGCCAACATGCCTCACGAGCCGGCCATGATGCTTCACGTATACGGAATCGAGGCTGGCCGTCAT
CGCTGGTCGACGCCTTATCTGGCCACCAAGCTGGTCCGCCTCTTTGTCGAGCCGCCGCGGATGCGCAATGTCTGG
GCTCGGGTGCTCAGCGTCCACGCCGGCCGTATCGACCTCCGCGAGTCCCGGCACAAGACAACCATGGGCGGCTAC
GCCGAGGAGAAGATGCTGGACGTGGTGACTGAGGCGGTCCGGCTGGCGGTGCCGCACGAGGTCATCGTCGACCAG
ATTATAGACAACGTCATCAACACGGCCAAGGCGGTCCAGCAGCTACACCATCGTTTCCGGACCGGCTCCAACGAG
TTCGTTCTAGAAAAGAAGCCCGAGTCCGCCAAGCTGCTTCCCAAGACGTCGATCCGGTCTCGCAACGTGCTGCTG
GAGCTCGAGGACGGCGCCTTTGAGTGGAAGCTCGGCATCATCTATCGCACTGGTCGCGCCGAGCAGGTGCAGCGT
CAGGTTCGTGACGAGGCCTTTAGCCTCAAGGTCGCCAAGGTCCGCGACGAGGCATCGGGCCGGGGCAGCAAGGGC
CGATCGCGGTCCGTCATGTCCCGGGGCCGGGGAGCGGGGACATCGGCGACGGCGACGACATCGGCCCAGACGGGT
GCCTGGTTCCGGAGCCGAAGCCTGGACCGGGGCCGGACGGCGACACCCACGGCGTCTGGCTCGACGACGACGGCG
CCCCTGTTGGCGATGCCGCGTTACGACCCGGACGGAGACAGTCTCGGCGTGCCCGGACAGGCCAAGGTGTCGGAG
GAAGATGCCCGGGCGCAGCTGGATGCGTACAACGCGCTGGCGTGGCAGAGGCGCATCGATCTCGCCTACGAGGCC
TCGAGGCAGGCGGCCCGACGGATGCGCGAGGCCTACTGGGGCGACAGTCAGGTTCCCGAGGACGTCGAGCTCCCA
ACTTCGCCATGA
Transcript >Ophun1|5805
ATGGGCTCGGCCGAATCCCCGGATGAGGCGCCCCGGCGTCGGCGGCGAGGCTTCATGGCCCCACGCGTCATGGAC
CTCGCCGGACCCGTCTTCAAGGCCGGCACGCTGACCGGAGTTACCGGAGCTATAACCGGCGTCGGCATCGCCATC
GCCTTTGACAAGCGGCCCGTCGGCAGCGGCTTTGCCATGGGCTGCGAATGGTTCGCCCTGGGATCTACATACTGG
CTATTCAGATCGCTGGCCATTGCGTCAATGGGGGGTGAAGAGCAAGTTACGACCAGGGAAAAGGTCATGGCCAGC
GGGCTGGCTGGTTCTGCTGGGGGTGCCGTCGCCGGCCTGATGCGCGGTCCTCAGGCCATTCTTCCCTGTGTCGTC
TTCTACGGCCTGCTGACCAGCGGCGGCCAGACGATGATCAACCTCGTGGCTAGCCGTCCACCTCAACCACTAAAG
GAGAAGCGCAGCTGGCTCGAGTCCAGCTGGATGCCCTTTCGTAAAGTGACGGACGAAGAGTACATGGAGAGACTC
GGCGAGAAGATCCTGCGGGTCGAGGCAGACATTGCCATCTGCGACGAGAGAATTGCGCGGCTCAAGGGGGGGGGA
CGAGGCGGAGAGAACTATCTGCTCCCCGAGGCGATAGCTCATCCCATCGAAACAGCTCTCGTCGGTCCCTTTGCC
CTCGGCGCCGCCGCCATGGCTCTGCTGAACCCGACCTTTCTATTGGGCCTGATTGTGCTGCTCTACCTGTCGTCC
TTTGTCCTCTTTGCCGTCATCCGCATCGTCACGGGCGTCTCCATCCAGCGCATCGGATATCTGTCCCTTCGGCGA
CTGGCCTACACGCCTCGCGATGGCGTCGTCATTGAGATTCGAAGCCTCGGTCTCAACGTCCATCGACCTACCTTT
GCGCAACCGACCTGGGTCAGCCTGGCGCTCAATGAGCTGGTCGTTACCGTCGACGCGCGAGGTCAGAAGGCGTCC
AAGGCCGGCGGTCGCGGTGACGATGAAGACGATACCAGCACCGCCCCGTCGACACCGGACTTGAAGGCGCGTCGT
GACCGGTCCAGCCACGAAAACATCTGGTCCAAGGCGGCCAAGCTCCGGCAGGCCGTCAAACAGCTACACCAATAC
ATCGGCTGGCTTCGCTTGGTGGACGTGGTAGCGACCAATACGACGGTCAACATGGTGGGCGTCGGTCACGCCCAG
CTCGGCAGCCTGACGATAGCCGTCGACACGAGGCGCAAGATGGTCGGACGCTCGCGCATCTCGCAGAAGCTGCGC
TCGGGCGACGACAGCCTCCGACAGGCCGAGTGGATCATGACACTGCGAAGCCTCCTATTTACGGCCGAGGGTGGC
GAGTCGCTCGAGGTGTTGGACCATGCCCTCTTCAACGTCCACGGCTCCCTGCACGAGACTCTGGGAGGCCTTCGC
GACGTCACCATTGCACTCAAGCTGGGAAGGGTCAGCGTGCCGTACGACGACTTGATGCTGTGCGTCGCCAAGATG
CGGACGCACCGGCAGCAAAAGGAGAAGGAGGAGGAGATGAATGAGAAGAAGCAGGATATGGCGGGAGAGAAGAAG
CAGTCCAAAGCTGTGCCAGCGATAACAACGCCGACGACGGGTGAAACAGACGACGAGGACAAGAATGAGAAGCTG
ATGCAGACGGTGACGGACTCGCGCGAATTCTTCAGCGCCATCCTCCGAAACATCAAGGAGGTTCAGTTCGCCGTC
TCGTTCGCCGGCTTGACCAAGAAGATCACGTCCATCAAGGCGGCCACCAACCCAATGGTTCTCACGGCATCGATG
AAGGAAGTGGGCGTCGACTTTCACCGGCTGGACCCCAAGTCGCCAGCTCACCGCATGTACTTTTCGTCAAAGGAC
ATTGCGCACGAGGCGCTGGCAGCGGCCTTGTCCATCTCCATTGATCTTGACGACGGCCAGCGAGGCCCCCAGCGG
TTCTTCTACGTGCCAATGGCGACGACAACAGCCCGGACGACGTTGCCATCCAAGACGGTACAGCTGGCTCACGAG
AGCGCCCTCGAGGAGCGCAACGCCAACATTCTCTTCGCCAACTCGGTGGTGACGTCGCCGTCAGTCGACCTCGAT
CCCGTTCATCTTCCACTCCTCATCGCTCTTCTCCGACCCAAGCCGAAGCCGGCGCCGACGCAACACGGGCCTCGG
CAGCAGCTCATCTCGCGACTGCTCCCCAAGGCCAGCCTCAAGCTGTCGATGCATGAGCCCGTGGTTCGCATGCGA
CTGAAGCCGCTGCAGCCGACGACCGACGCCGACGACTTTGACCTCATCATCTCGTCCATCTCGTCCGTCTCTCTC
GACGTAGAGTCGTCTCACTCTCCCGTCGAGGACCTACACTACTTCCTCGACGGCTCGCTACGCCTCCAGTCGCAC
CGGCTGTACTACCAGACGAGCGCCGGCGACTTCTTTGACTTGATGACGACGGACTCGCTCGACGTCAAGACACAT
CTGGCCGCGACGCCCGACGTCTGTGTCGACATGACGGGCGGTATCCAGTCCTTCTCCGTCAGCATGGCGCGTCAG
GAGATCACAGACGGGCTTCGACAAATTGTGCAGCAGCTTCACGTCGACGCCGAGCCGGAAAAGGCCATGACGACG
GCTCGCGATGGAAAGACGGCACCGCGTCGGCGACACAACTTCTTACGAGCCGTTCCCGAGTGGCTGACGAGCTAT
CACTTTGAGGCTTCAGACTTTAACATCGAGGTGGCTGGCGTCGACGAGGACATTGCCGACGAGATGCGCGGCGTC
TCGCTCCATCTCGACTCCATCTCGGCTGAATACCGCGCTCACAAGCTGGACGAGCCACAGCGACGGCTGACACGG
CGTCGGGCGCATAGCCGGCTGGTCAGTAACCAGTCCGATTCGGACGTGGCGACGCCTCGCAAGAAGCCTCAGACA
GCCGGTGACGGACGTCGTCTCGTCCTTCTAGCCCGTGGTCTCGAGGCGCATATGGTTGAGGCGGTCGATCAGCTC
GAGATTGAGCCGTTTGTGCGGCTTCCACGCCTCGAGCTCGTCCTATCGGCCGTCAGCGACGGACTCGGCCCCATG
TTCCATGTCCAGGCGACGGTTCGAACCATCCTGCTGCAGTACTCGCTGTATCGTCACTACGCCGTCGGTGTGGCC
ATCTTGACGCTGCGCAAGGCTCTGATGCAAACCGAACGCGACGCTCCGAAGCCGCGACGACCCTCAGCAACATCG
CCGCCGCCGTTGCCGCCCGCCAGCGCGCCGCCCGGAACGACTGAGCTCGTCACCGTCGATGTCCGGGCTTCGCTG
GTGCAGGTCAAGGCCAACATGCCTCACGAGCCGGCCATGATGCTTCACGTATACGGAATCGAGGCTGGCCGTCAT
CGCTGGTCGACGCCTTATCTGGCCACCAAGCTGGTCCGCCTCTTTGTCGAGCCGCCGCGGATGCGCAATGTCTGG
GCTCGGGTGCTCAGCGTCCACGCCGGCCGTATCGACCTCCGCGAGTCCCGGCACAAGACAACCATGGGCGGCTAC
GCCGAGGAGAAGATGCTGGACGTGGTGACTGAGGCGGTCCGGCTGGCGGTGCCGCACGAGGTCATCGTCGACCAG
ATTATAGACAACGTCATCAACACGGCCAAGGCGGTCCAGCAGCTACACCATCGTTTCCGGACCGGCTCCAACGAG
TTCGTTCTAGAAAAGAAGCCCGAGTCCGCCAAGCTGCTTCCCAAGACGTCGATCCGGTCTCGCAACGTGCTGCTG
GAGCTCGAGGACGGCGCCTTTGAGTGGAAGCTCGGCATCATCTATCGCACTGGTCGCGCCGAGCAGGTGCAGCGT
CAGGTTCGTGACGAGGCCTTTAGCCTCAAGGTCGCCAAGGTCCGCGACGAGGCATCGGGCCGGGGCAGCAAGGGC
CGATCGCGGTCCGTCATGTCCCGGGGCCGGGGAGCGGGGACATCGGCGACGGCGACGACATCGGCCCAGACGGGT
GCCTGGTTCCGGAGCCGAAGCCTGGACCGGGGCCGGACGGCGACACCCACGGCGTCTGGCTCGACGACGACGGCG
CCCCTGTTGGCGATGCCGCGTTACGACCCGGACGGAGACAGTCTCGGCGTGCCCGGACAGGCCAAGGTGTCGGAG
GAAGATGCCCGGGCGCAGCTGGATGCGTACAACGCGCTGGCGTGGCAGAGGCGCATCGATCTCGCCTACGAGGCC
TCGAGGCAGGCGGCCCGACGGATGCGCGAGGCCTACTGGGGCGACAGTCAGGTTCCCGAGGACGTCGAGCTCCCA
ACTTCGCCATGA
Gene >Ophun1|5805
ATGGGCTCGGCCGAATCCCCGGATGAGGCGCCCCGGCGTCGGCGGCGAGGCTTCATGGCCCCACGCGTCATGGAC
CTCGCCGGACCCGTCTTCAAGGCCGGCACGCTGACCGGTAGGTACGCATACTATCCCGAGCCGAGCCTCCTGACG
TCCATTCAGGAGTTACCGGAGCTATAACCGGCGTCGGCATCGCCATCGCCTTTGACAAGCGGCCCGTCGGCAGCG
GCTTTGCCATGGGCTGCGAATGGTTCGCCCTGGGATCTACATACTGGCGTGCGTCTCGCTTCTCTCCTACACTGC
GCCTTCAGCTTACCGGAGTCCACGGCAGTATTCAGATCGCTGGCCATTGCGTCAATGGGGGGTGAAGAGCAAGTT
ACGACCAGGGAAAAGGTCATGGCCAGCGGGCTGGCTGGTTCTGCTGGGGGTGCCGTCGCCGGCCTGATGCGTAGG
CTCTCCTCCGACACCGGCATTTTCGACTGTGTCTGACGTCTTCTAGGCGGTCCTCAGGCCATTCTTCCCTGTGTC
GTCTTCTACGGCCTGCTGACCAGCGGCGGCCAGACGATGATCAACCTCGTGGCTAGCCGTCCACCTCAACCACTA
AAGGAGAAGCGCAGCTGGCTCGAGTCCAGCTGGATGCCCTTTCGTAAAGTGACGGACGAAGAGTACATGGAGAGA
CTCGGCGAGAAGATCCTGCGGGTCGAGGCAGACATTGCCATCTGCGACGAGAGAATTGCGCGGCTCAAGGGGGGG
GGACGAGGCGGAGAGAAGTGAGAGTAGGTAGGTAGATAGAGTGAGGGTAGAGTGAGGGTAGTACAGGGTAGGCCG
TGCATCCCGGACGACCCATGCCGTCGGCCCGGGGTGCCCAACATGAAGCCCCGGCATGAGCAGGGCGTAACGTGG
CGGAGGAAGCGGACGTATCAGAGGGCGAGCGCATAATAAGCCTTTCGGCCATGGACCAGCGAGCGTTCCTCCGCA
CATCCGGTCTTTCCGGCCTTGGTCCTCGATGTAGGCCTGTGTGGTGGTGTAGAAGAAAAGTCTGTCAGAGCCTTG
TCGGTACTTGCTGCACGGTAAAGAGTGACTTTGAGACTAGCGCAGTCACACGCGCCAACAGTAGTACCTTCCGTA
GTCGGGCCATGTACCCGCATCGCTCTCGCCAACATCCCGAGGCTCTTCCACTCCACCCATCGTCATCGAGCCTCG
CAACCTCGTGCCAGCCACGAACAGCAGACGGAGCGCCTCTCGGACCCTATTTTGACGGCCCGCTCTTCCAAGCTT
CCCGCCGCTGGATAAAGCCGAGACTGCCGTCATGGGACTTGCGAAGACGTCGTCTGAAGCTATCTGCTCCCCGAG
GCGATAGCTCATCCCATGTACGAACACTTCCAGTTGATGATCGCTCCCAGTGCCTCGCCCGCATACTGATGCTGC
TTAGCGAAACAGCTCTCGTCGGTCCCTTTGCCCTCGGCGCCGCCGCCATGGCTCTGCTGAACCCGACCTTTCTAT
TGGGCCTGATTGTGCTGCTCTACCTGTCGTCCTTTGTCCTCTTTGCCGTCATCCGCATCGTCACGGGCGTCTCCA
TCCAGCGCATCGGATATCTGTCCCTTCGGCGACTGGCCTACACGCCTCGCGATGGCGTCGTCATTGAGATTCGAA
GCCTCGGTCTCAACGTCCATCGACCTACCTTTGCGCAACCGACCTGGGTCAGCCTGGCGCTCAATGAGCTGGTCG
TTACCGTCGACGCGCGAGGTCAGAAGGCGTCCAAGGCCGGCGGTCGCGGTGACGATGAAGACGATACCAGCACCG
CCCCGTCGACACCGGACTTGAAGGCGCGTCGTGACCGGTCCAGCCACGAAAACATCTGGTCCAAGGCGGCCAAGC
TCCGGCAGGCCGTCAAACAGCTACACCAATACATCGGCTGGCTTCGCTTGGTGGACGTGGTAGCGACCAATACGA
CGGTCAACATGGTGGGCGTCGGTCACGCCCAGCTCGGCAGCCTGACGATAGCCGTCGACACGAGGCGCAAGATGG
TCGGACGCTCGCGCATCTCGCAGAAGCTGCGCTCGGGCGACGACAGCCTCCGACAGGCCGAGTGGATCATGACAC
TGCGAAGCCTCCTATTTACGGCCGAGGGTGGCGAGTCGCTCGAGGTGTTGGACCATGCCCTCTTCAACGTCCACG
GCTCCCTGCACGAGACTCTGGGAGGCCTTCGCGACGTCACCATTGCACTCAAGCTGGGAAGGGTCAGCGTGCCGT
ACGACGACTTGATGCTGTGCGTCGCCAAGATGCGGACGCACCGGCAGCAAAAGGAGAAGGAGGAGGAGATGAATG
AGAAGAAGCAGGATATGGCGGGAGAGAAGAAGCAGTCCAAAGCTGTGCCAGCGATAACAACGCCGACGACGGGTG
AAACAGACGACGAGGACAAGAATGAGAAGCTGATGCAGACGGTGACGGACTCGCGCGAATTCTTCAGCGCCATCC
TCCGAAACATCAAGGAGGTTCAGTTCGCCGTCTCGTTCGCCGGCTTGACCAAGAAGATCACGTCCATCAAGGCGG
CCACCAACCCAATGGTTCTCACGGCATCGATGAAGGAAGTGGGCGTCGACTTTCACCGGCTGGACCCCAAGTCGC
CAGCTCACCGCATGTACTTTTCGTCAAAGGACATTGCGCACGAGGCGCTGGCAGCGGCCTTGTCCATCTCCATTG
ATCTTGACGACGGCCAGCGAGGCCCCCAGCGGTTCTTCTACGTGCCAATGGCGACGACAACAGCCCGGACGACGT
TGCCATCCAAGACGGTACAGCTGGCTCACGAGAGCGCCCTCGAGGAGCGCAACGCCAACATTCTCTTCGCCAACT
CGGTGGTGACGTCGCCGTCAGTCGACCTCGATCCCGTTCATCTTCCACTCCTCATCGCTCTTCTCCGACCCAAGC
CGAAGCCGGCGCCGACGCAACACGGGCCTCGGCAGCAGCTCATCTCGCGACTGCTCCCCAAGGCCAGCCTCAAGC
TGTCGATGCATGAGCCCGTGGTTCGCATGCGACTGAAGCCGCTGCAGCCGACGACCGACGCCGACGACTTTGACC
TCATCATCTCGTCCATCTCGTCCGTCTCTCTCGACGTAGAGTCGTCTCACTCTCCCGTCGAGGACCTACACTACT
TCCTCGACGGCTCGCTACGCCTCCAGTCGCACCGGCTGTACTACCAGACGAGCGCCGGCGACTTCTTTGACTTGA
TGACGACGGACTCGCTCGACGTCAAGACACATCTGGCCGCGACGCCCGACGTCTGTGTCGACATGACGGGCGGTA
TCCAGTCCTTCTCCGTCAGCATGGCGCGTCAGGAGATCACAGACGGGCTTCGACAAATTGTGCAGCAGCTTCACG
TCGACGCCGAGCCGGAAAAGGCCATGACGACGGCTCGCGATGGAAAGACGGCACCGCGTCGGCGACACAACTTCT
TACGAGCCGTTCCCGAGTGGCTGACGAGCTATCACTTTGAGGCTTCAGACTTTAACATCGAGGTGGCTGGCGTCG
ACGAGGACATTGCCGACGAGATGCGCGGCGTCTCGCTCCATCTCGACTCCATCTCGGCTGAATACCGCGCTCACA
AGCTGGACGAGCCACAGCGACGGCTGACACGGCGTCGGGCGCATAGCCGGCTGGTCAGTAACCAGTCCGATTCGG
ACGTGGCGACGCCTCGCAAGAAGCCTCAGACAGCCGGTGACGGACGTCGTCTCGTCCTTCTAGCCCGTGGTCTCG
AGGCGCATATGGTTGAGGCGGTCGATCAGCTCGAGATTGAGCCGTTTGTGCGGCTTCCACGCCTCGAGCTCGTCC
TATCGGCCGTCAGCGACGGACTCGGCCCCATGTTCCATGTCCAGGCGACGGTTCGAACCATCCTGCTGCAGTACT
CGCTGTATCGTCACTACGCCGTCGGTGTGGCCATCTTGACGCTGCGCAAGGCTCTGATGCAAACCGAACGCGACG
CTCCGAAGCCGCGACGACCCTCAGCAACATCGCCGCCGCCGTTGCCGCCCGCCAGCGCGCCGCCCGGAACGACTG
AGCTCGTCACCGTCGATGTCCGGGCTTCGCTGGTGCAGGTCAAGGCCAACATGCCTCACGAGCCGGCCATGATGC
TTCACGTATACGGAATCGAGGCTGGCCGTCATCGCTGGTCGACGCCTTATCTGGCCACCAAGCTGGTCCGCCTCT
TTGTCGAGCCGCCGCGGATGCGCAATGTCTGGGCTCGGGTGCTCAGCGTCCACGCCGGCCGTATCGACCTCCGCG
AGTCCCGGCACAAGACAACCATGGGCGGCTACGCCGAGGAGAAGATGCTGGACGTGGTGACTGAGGCGGTCCGGC
TGGCGGTGCCGCACGAGGTCATCGTCGACCAGATTATAGACAACGTCATCAACACGGCCAAGGCGGTCCAGCAGC
TACACCATCGTTTCCGGACCGGCTCCAACGAGTTCGTTCTAGAAAAGAAGCCCGAGTCCGCCAAGCTGCTTCCCA
AGACGTCGATCCGGTCTCGCAACGTGCTGCTGGAGCTCGAGGACGGCGCCTTTGAGTGGAAGCTCGGCATCATCT
ATCGCACTGGTCGCGCCGAGCAGGTGCAGCGTCAGGTTCGTGACGAGGCCTTTAGCCTCAAGGTCGCCAAGGTCC
GCGACGAGGCATCGGGCCGGGGCAGCAAGGGCCGATCGCGGTCCGTCATGTCCCGGGGCCGGGGAGCGGGGACAT
CGGCGACGGCGACGACATCGGCCCAGACGGGTGCCTGGTTCCGGAGCCGAAGCCTGGACCGGGGCCGGACGGCGA
CACCCACGGCGTCTGGCTCGACGACGACGGCGCCCCTGTTGGCGATGCCGCGTTACGACCCGGACGGAGACAGTC
TCGGCGTGCCCGGACAGGCCAAGGTGTCGGAGGAAGATGCCCGGGCGCAGCTGGATGCGTACAACGCGCTGGCGT
GGCAGAGGCGCATCGATCTCGCCTACGAGGCCTCGAGGCAGGCGGCCCGACGGATGCGCGAGGCCTACTGGGGCG
ACAGTCAGGTTCCCGAGGACGTCGAGCTGTCGGATAAGATGCTCGAGGTGCCGCAGCGGCCGGCCCTCATGGCCA
TTGTGCTGGCCGACTTTCACGCCATGGTCGACAAGCCCAACTTCGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail