Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|580
Gene name
LocationContig_118:21596..26748
Strand+
Gene length (bp)5152
Transcript length (bp)4431
Coding sequence length (bp)4431
Protein length (aa) 1477

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00752 XPG_N XPG N-terminal domain 8.9E-32 1 96
PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain 9.8E-29 1312 1422
PF00867 XPG_I XPG I-region 2.1E-25 910 991
PF01096 TFIIS_C Transcription factor S-II (TFIIS) 1.2E-16 1437 1474
PF08711 Med26 TFIIS helical bundle-like domain 7.9E-09 1206 1256

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28706|RAD13_SCHPO DNA repair protein rad13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad13 PE=2 SV=2 1 384 2.0E-115
sp|P28706|RAD13_SCHPO DNA repair protein rad13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad13 PE=2 SV=2 843 1196 5.0E-105
sp|P07276|RAD2_YEAST DNA repair protein RAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD2 PE=1 SV=2 834 1165 1.0E-80
sp|P07276|RAD2_YEAST DNA repair protein RAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD2 PE=1 SV=2 1 362 3.0E-70
sp|Q9ATY5|UVH3_ARATH DNA repair protein UVH3 OS=Arabidopsis thaliana GN=UVH3 PE=2 SV=1 874 1161 2.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28706|RAD13_SCHPO DNA repair protein rad13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad13 PE=2 SV=2 1 384 2.0E-115
sp|P28706|RAD13_SCHPO DNA repair protein rad13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad13 PE=2 SV=2 843 1196 5.0E-105
sp|P07276|RAD2_YEAST DNA repair protein RAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD2 PE=1 SV=2 834 1165 1.0E-80
sp|P07276|RAD2_YEAST DNA repair protein RAD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD2 PE=1 SV=2 1 362 3.0E-70
sp|Q9ATY5|UVH3_ARATH DNA repair protein UVH3 OS=Arabidopsis thaliana GN=UVH3 PE=2 SV=1 874 1161 2.0E-65
sp|P49373|TFS2_SCHPO Transcription elongation factor S-II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfs1 PE=3 SV=1 1178 1476 2.0E-64
sp|P35689|ERCC5_MOUSE DNA repair protein complementing XP-G cells homolog OS=Mus musculus GN=Ercc5 PE=1 SV=4 876 1133 1.0E-63
sp|P28715|ERCC5_HUMAN DNA repair protein complementing XP-G cells OS=Homo sapiens GN=ERCC5 PE=1 SV=3 879 1193 2.0E-62
sp|P14629|ERCC5_XENLA DNA repair protein complementing XP-G cells homolog OS=Xenopus laevis GN=ercc5 PE=2 SV=1 889 1133 2.0E-57
sp|P07273|TFS2_YEAST Transcription elongation factor S-II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DST1 PE=1 SV=4 1178 1476 4.0E-46
sp|P23193|TCEA1_HUMAN Transcription elongation factor A protein 1 OS=Homo sapiens GN=TCEA1 PE=1 SV=2 1201 1476 6.0E-33
sp|Q15560|TCEA2_HUMAN Transcription elongation factor A protein 2 OS=Homo sapiens GN=TCEA2 PE=1 SV=1 1178 1476 2.0E-32
sp|Q148K0|TCEA2_BOVIN Transcription elongation factor A protein 2 OS=Bos taurus GN=TCEA2 PE=2 SV=1 1178 1476 4.0E-32
sp|P10711|TCEA1_MOUSE Transcription elongation factor A protein 1 OS=Mus musculus GN=Tcea1 PE=1 SV=2 1201 1476 8.0E-32
sp|Q9ATY5|UVH3_ARATH DNA repair protein UVH3 OS=Arabidopsis thaliana GN=UVH3 PE=2 SV=1 1 132 1.0E-31
sp|P14629|ERCC5_XENLA DNA repair protein complementing XP-G cells homolog OS=Xenopus laevis GN=ercc5 PE=2 SV=1 1 286 1.0E-31
sp|Q4KLL0|TCEA1_RAT Transcription elongation factor A protein 1 OS=Rattus norvegicus GN=Tcea1 PE=1 SV=1 1201 1476 1.0E-31
sp|Q29RL9|TCEA1_BOVIN Transcription elongation factor A protein 1 OS=Bos taurus GN=TCEA1 PE=2 SV=1 1201 1476 3.0E-31
sp|Q63799|TCEA2_RAT Transcription elongation factor A protein 2 OS=Rattus norvegicus GN=Tcea2 PE=2 SV=1 1178 1476 1.0E-30
sp|Q9QVN7|TCEA2_MOUSE Transcription elongation factor A protein 2 OS=Mus musculus GN=Tcea2 PE=2 SV=2 1178 1476 3.0E-30
sp|P28715|ERCC5_HUMAN DNA repair protein complementing XP-G cells OS=Homo sapiens GN=ERCC5 PE=1 SV=3 1 288 9.0E-29
sp|P35689|ERCC5_MOUSE DNA repair protein complementing XP-G cells homolog OS=Mus musculus GN=Ercc5 PE=1 SV=4 1 288 3.0E-27
sp|Q2KI09|TCEA3_BOVIN Transcription elongation factor A protein 3 OS=Bos taurus GN=TCEA3 PE=2 SV=1 1178 1476 3.0E-25
sp|P52652|TFS2_CAEEL Putative transcription elongation factor S-II OS=Caenorhabditis elegans GN=T24H10.1 PE=3 SV=1 1198 1476 3.0E-25
sp|P23881|TCEA3_MOUSE Transcription elongation factor A protein 3 OS=Mus musculus GN=Tcea3 PE=1 SV=3 1312 1476 4.0E-25
sp|P20232|TFS2_DROME Transcription elongation factor S-II OS=Drosophila melanogaster GN=TfIIS PE=2 SV=1 1353 1476 1.0E-24
sp|A7UW97|FEN1_NEUCR Flap endonuclease 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dnr-8 PE=3 SV=2 857 1133 1.0E-24
sp|A8J2Z9|FEN1_CHLRE Flap endonuclease 1 OS=Chlamydomonas reinhardtii GN=FEN1 PE=3 SV=1 901 1106 2.0E-24
sp|B8NV37|FEN1_ASPFN Flap endonuclease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=fen1 PE=3 SV=1 894 1106 2.0E-24
sp|A0CXT3|FEN11_PARTE Flap endonuclease 1-1 OS=Paramecium tetraurelia GN=FEN1-1 PE=3 SV=1 894 1134 4.0E-24
sp|B6QT52|FEN1_TALMQ Flap endonuclease 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=fen1 PE=3 SV=2 864 1106 8.0E-24
sp|Q0CBS0|FEN1_ASPTN Flap endonuclease 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fen1 PE=3 SV=2 857 1106 1.0E-23
sp|B8MNF2|FEN1_TALSN Flap endonuclease 1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=fen1 PE=3 SV=2 864 1106 2.0E-23
sp|D1ZT73|FEN1_SORMK Flap endonuclease 1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=FEN1 PE=3 SV=1 857 1133 2.0E-23
sp|A0CYG2|FEN12_PARTE Flap endonuclease 1-2 OS=Paramecium tetraurelia GN=FEN1-2 PE=3 SV=1 894 1134 3.0E-23
sp|A1D8A4|FEN1_NEOFI Flap endonuclease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fen1 PE=3 SV=1 894 1106 3.0E-23
sp|A4VDN2|FEN1_TETTS Flap endonuclease 1 OS=Tetrahymena thermophila (strain SB210) GN=FEN1 PE=3 SV=1 885 1133 3.0E-23
sp|A5ABU3|FEN1_ASPNC Flap endonuclease 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fen1 PE=3 SV=1 857 1106 5.0E-23
sp|B0XZ33|FEN1_ASPFC Flap endonuclease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=fen1 PE=3 SV=2 894 1106 6.0E-23
sp|Q4WWJ1|FEN1_ASPFU Flap endonuclease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fen1 PE=3 SV=2 894 1106 6.0E-23
sp|C4JDR3|FEN1_UNCRE Flap endonuclease 1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=FEN1 PE=3 SV=2 857 1133 7.0E-23
sp|Q5B9L6|FEN1_EMENI Flap endonuclease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fen1 PE=3 SV=1 857 1106 8.0E-23
sp|Q9ZVH8|RDO2_ARATH Transcription elongation factor TFIIS OS=Arabidopsis thaliana GN=TFIIS PE=1 SV=1 1331 1476 1.0E-22
sp|A1CJ75|FEN1_ASPCL Flap endonuclease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fen1 PE=3 SV=2 894 1106 1.0E-22
sp|C7Z125|FEN1_NECH7 Flap endonuclease 1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=FEN1 PE=3 SV=1 857 1106 1.0E-22
sp|B2VTT3|FEN1_PYRTR Flap endonuclease 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=fen1 PE=3 SV=2 901 1133 2.0E-22
sp|O75764|TCEA3_HUMAN Transcription elongation factor A protein 3 OS=Homo sapiens GN=TCEA3 PE=1 SV=2 1312 1476 2.0E-22
sp|Q54YG9|TCEA1_DICDI Transcription elongation factor A protein 1 OS=Dictyostelium discoideum GN=tcea1 PE=3 SV=1 1194 1476 2.0E-22
sp|A7TJ59|FEN1_VANPO Flap endonuclease 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FEN1 PE=3 SV=1 858 1133 5.0E-22
sp|C5FZT5|FEN1_ARTOC Flap endonuclease 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=FEN1 PE=3 SV=1 894 1106 7.0E-22
sp|C5DGG4|FEN1_LACTC Flap endonuclease 1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=FEN1 PE=3 SV=1 886 1133 3.0E-21
sp|A8XL25|FEN1_CAEBR Flap endonuclease 1 OS=Caenorhabditis briggsae GN=crn-1 PE=3 SV=1 859 1133 3.0E-21
sp|Q17RS7|GEN_HUMAN Flap endonuclease GEN homolog 1 OS=Homo sapiens GN=GEN1 PE=1 SV=2 898 1086 3.0E-21
sp|Q8BMI4|GEN_MOUSE Flap endonuclease GEN homolog 1 OS=Mus musculus GN=Gen1 PE=1 SV=2 901 1023 4.0E-21
sp|Q7Q323|FEN1_ANOGA Flap endonuclease 1 OS=Anopheles gambiae GN=Fen1 PE=3 SV=2 858 1133 5.0E-21
sp|Q54NU0|FEN1_DICDI Flap endonuclease 1 OS=Dictyostelium discoideum GN=repG PE=3 SV=1 901 1106 5.0E-21
sp|C6HQJ2|FEN1_AJECH Flap endonuclease 1 OS=Ajellomyces capsulatus (strain H143) GN=FEN1 PE=3 SV=2 901 1106 5.0E-21
sp|C5JVG7|FEN1_AJEDS Flap endonuclease 1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=FEN1 PE=3 SV=2 901 1106 6.0E-21
sp|C5GPA7|FEN1_AJEDR Flap endonuclease 1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=FEN1 PE=3 SV=2 901 1106 6.0E-21
sp|A6QV55|FEN1_AJECN Flap endonuclease 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FEN1 PE=3 SV=1 901 1106 1.0E-20
sp|A4QS18|FEN1_MAGO7 Flap endonuclease 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FEN1 PE=3 SV=2 901 1106 1.0E-20
sp|A5E121|FEN1_LODEL Flap endonuclease 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FEN1 PE=3 SV=1 901 1106 1.0E-20
sp|Q0UZR3|FEN1_PHANO Flap endonuclease 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FEN1 PE=3 SV=3 901 1133 1.0E-20
sp|Q8W5R1|GENL2_ORYSJ Flap endonuclease GEN-like 2 OS=Oryza sativa subsp. japonica GN=SEND1 PE=2 SV=1 888 1119 2.0E-20
sp|D3BN56|FEN1_POLPA Flap endonuclease 1 OS=Polysphondylium pallidum GN=repG PE=3 SV=1 844 1133 2.0E-20
sp|B4GIM3|FEN1_DROPE Flap endonuclease 1 OS=Drosophila persimilis GN=Fen1 PE=3 SV=1 867 1106 3.0E-20
sp|B5DUR8|FEN1_DROPS Flap endonuclease 1 OS=Drosophila pseudoobscura pseudoobscura GN=Fen1 PE=3 SV=1 867 1106 3.0E-20
sp|C8BKD0|FEN1_SHEEP Flap endonuclease 1 OS=Ovis aries GN=FEN1 PE=2 SV=1 893 1160 3.0E-20
sp|C4QZ20|FEN1_PICPG Flap endonuclease 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=FEN1 PE=3 SV=1 875 1133 4.0E-20
sp|B0DSN9|FEN11_LACBS Flap endonuclease 1-A OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=FEN11 PE=3 SV=1 901 1106 5.0E-20
sp|A3M056|FEN1_PICST Flap endonuclease 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FEN1 PE=3 SV=2 901 1105 7.0E-20
sp|Q9N3T2|FEN1_CAEEL Flap endonuclease 1 OS=Caenorhabditis elegans GN=crn-1 PE=1 SV=1 875 1134 7.0E-20
sp|B3NP61|FEN1_DROER Flap endonuclease 1 OS=Drosophila erecta GN=Fen1 PE=3 SV=1 867 1133 7.0E-20
sp|Q6C116|FEN1_YARLI Flap endonuclease 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FEN1 PE=3 SV=1 901 1106 9.0E-20
sp|Q6BLF4|FEN1_DEBHA Flap endonuclease 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FEN1 PE=3 SV=2 894 1106 1.0E-19
sp|B4MR84|FEN1_DROWI Flap endonuclease 1 OS=Drosophila willistoni GN=Fen1 PE=3 SV=1 867 1106 1.0E-19
sp|B4P5U9|FEN1_DROYA Flap endonuclease 1 OS=Drosophila yakuba GN=Fen1 PE=3 SV=1 867 1133 1.0E-19
sp|C3ZBT0|FEN1_BRAFL Flap endonuclease 1 OS=Branchiostoma floridae GN=FEN1 PE=3 SV=1 893 1133 1.0E-19
sp|Q75DS8|FEN1_ASHGO Flap endonuclease 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FEN1 PE=3 SV=2 858 1133 1.0E-19
sp|Q5A6K8|FEN1_CANAL Flap endonuclease 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD27 PE=3 SV=1 901 1106 1.0E-19
sp|C4YLS2|FEN1_CANAW Flap endonuclease 1 OS=Candida albicans (strain WO-1) GN=RAD27 PE=3 SV=1 901 1106 2.0E-19
sp|Q5XIP6|FEN1_RAT Flap endonuclease 1 OS=Rattus norvegicus GN=Fen1 PE=2 SV=1 846 1133 2.0E-19
sp|C5M2X8|FEN1_CANTT Flap endonuclease 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RAD27 PE=3 SV=1 901 1106 2.0E-19
sp|C6TEX6|FEN1_SOYBN Flap endonuclease 1 OS=Glycine max GN=FEN1 PE=2 SV=1 846 1133 2.0E-19
sp|B9WLQ5|FEN1_CANDC Flap endonuclease 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RAD27 PE=3 SV=1 901 1106 2.0E-19
sp|Q7K7A9|FEN1_DROME Flap endonuclease 1 OS=Drosophila melanogaster GN=Fen1 PE=2 SV=1 867 1133 2.0E-19
sp|B0UXL7|FEN1B_DANRE Probable flap endonuclease 1 homolog OS=Danio rerio GN=si:dkeyp-13a3.3 PE=2 SV=1 901 1133 2.0E-19
sp|C4YBJ8|FEN1_CLAL4 Flap endonuclease 1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=FEN1 PE=3 SV=2 901 1106 3.0E-19
sp|B6HEM2|FEN1_PENRW Flap endonuclease 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=fen1 PE=3 SV=1 894 1106 3.0E-19
sp|C5DZA9|FEN1_ZYGRC Flap endonuclease 1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=FEN1 PE=3 SV=1 901 1133 4.0E-19
sp|B4KNM1|FEN1_DROMO Flap endonuclease 1 OS=Drosophila mojavensis GN=Fen1 PE=3 SV=1 867 1133 5.0E-19
sp|B4QIG6|FEN1_DROSI Flap endonuclease 1 OS=Drosophila simulans GN=Fen1 PE=3 SV=1 867 1133 8.0E-19
sp|B4HTA1|FEN1_DROSE Flap endonuclease 1 OS=Drosophila sechellia GN=Fen1 PE=3 SV=1 867 1133 8.0E-19
sp|Q4R5U5|FEN1_MACFA Flap endonuclease 1 OS=Macaca fascicularis GN=FEN1 PE=2 SV=1 893 1160 1.0E-18
sp|A9S0B8|FEN11_PHYPA Flap endonuclease 1-A OS=Physcomitrella patens subsp. patens GN=FEN1-A PE=3 SV=1 893 1157 2.0E-18
sp|P39748|FEN1_HUMAN Flap endonuclease 1 OS=Homo sapiens GN=FEN1 PE=1 SV=1 893 1160 2.0E-18
sp|P39750|FEN1_SCHPO Flap endonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad2 PE=1 SV=1 893 1106 2.0E-18
sp|B4LM90|FEN1_DROVI Flap endonuclease 1 OS=Drosophila virilis GN=Fen1 PE=3 SV=1 867 1106 2.0E-18
sp|Q013G9|FEN1_OSTTA Flap endonuclease 1 OS=Ostreococcus tauri GN=FEN1 PE=3 SV=2 901 1134 2.0E-18
sp|Q5ZLN4|FEN1_CHICK Flap endonuclease 1 OS=Gallus gallus GN=FEN1 PE=2 SV=1 893 1133 2.0E-18
sp|B8AW67|FEN11_ORYSI Flap endonuclease 1-A OS=Oryza sativa subsp. indica GN=FEN1a PE=3 SV=1 870 1133 3.0E-18
sp|A9VB27|FEN1_MONBE Flap endonuclease 1 OS=Monosiga brevicollis GN=FEN1 PE=3 SV=1 883 1105 3.0E-18
sp|Q178M1|FEN1_AEDAE Flap endonuclease 1 OS=Aedes aegypti GN=Fen1 PE=3 SV=1 886 1133 3.0E-18
sp|Q58DH8|FEN1_BOVIN Flap endonuclease 1 OS=Bos taurus GN=FEN1 PE=2 SV=1 893 1133 3.0E-18
sp|P39749|FEN1_MOUSE Flap endonuclease 1 OS=Mus musculus GN=Fen1 PE=1 SV=1 846 1133 3.0E-18
sp|B3MDA3|FEN1_DROAN Flap endonuclease 1 OS=Drosophila ananassae GN=Fen1 PE=3 SV=1 867 1106 4.0E-18
sp|P26793|FEN1_YEAST Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD27 PE=1 SV=1 901 1133 4.0E-18
sp|C8ZC62|FEN1_YEAS8 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RAD27 PE=3 SV=1 901 1133 4.0E-18
sp|A6ZZK4|FEN1_YEAS7 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RAD27 PE=3 SV=1 901 1133 4.0E-18
sp|C7GVJ8|FEN1_YEAS2 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RAD27 PE=3 SV=1 901 1133 4.0E-18
sp|B3LQY3|FEN1_YEAS1 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RAD27 PE=3 SV=1 901 1133 4.0E-18
sp|Q9SXQ6|FEN11_ORYSJ Flap endonuclease 1-A OS=Oryza sativa subsp. japonica GN=FEN-1a PE=2 SV=1 870 1133 4.0E-18
sp|A7RRJ0|FEN1_NEMVE Flap endonuclease 1 OS=Nematostella vectensis GN=FEN1 PE=3 SV=1 860 1133 4.0E-18
sp|D3TQJ5|FEN1_GLOMM Flap endonuclease 1 OS=Glossina morsitans morsitans GN=Fen1 PE=2 SV=1 846 1133 4.0E-18
sp|Q4P1V1|FEN1_USTMA Flap endonuclease 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FEN1 PE=3 SV=1 901 1106 5.0E-18
sp|B6JYI7|FEN1_SCHJY Flap endonuclease 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rad2 PE=3 SV=1 894 1106 8.0E-18
sp|C4M6G8|FEN1_ENTHI Flap endonuclease 1 OS=Entamoeba histolytica GN=FEN1 PE=3 SV=1 881 1124 8.0E-18
sp|Q12UT1|FEN_METBU Flap endonuclease 1 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fen PE=3 SV=1 878 1133 9.0E-18
sp|A9U328|FEN12_PHYPA Flap endonuclease 1-B OS=Physcomitrella patens subsp. patens GN=FEN1-B PE=3 SV=1 901 1106 1.0E-17
sp|Q8TXU4|FEN_METKA Flap endonuclease 1 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=fen PE=1 SV=1 881 1133 1.0E-17
sp|A7IA59|FEN_METB6 Flap endonuclease 1 OS=Methanoregula boonei (strain 6A8) GN=fen PE=3 SV=1 889 1133 1.0E-17
sp|B4J6M4|FEN1_DROGR Flap endonuclease 1 OS=Drosophila grimshawi GN=Fen1 PE=3 SV=1 867 1106 1.0E-17
sp|O27670|FEN_METTH Flap endonuclease 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=fen PE=3 SV=1 905 1110 1.0E-17
sp|C5YUK3|FEN11_SORBI Flap endonuclease 1-A OS=Sorghum bicolor GN=FEN1-A PE=3 SV=1 901 1133 1.0E-17
sp|A8NQC2|FEN1_COPC7 Flap endonuclease 1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=FEN1 PE=3 SV=3 889 1020 1.0E-17
sp|B1H158|FEN1_XENTR Flap endonuclease 1 OS=Xenopus tropicalis GN=fen1 PE=2 SV=1 882 1133 2.0E-17
sp|Q6CLH4|FEN1_KLULA Flap endonuclease 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FEN1 PE=3 SV=1 901 1133 2.0E-17
sp|A5DCF5|FEN1_PICGU Flap endonuclease 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FEN1 PE=3 SV=3 861 1106 3.0E-17
sp|P61942|FEN_NANEQ Flap endonuclease 1 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fen PE=3 SV=1 858 1011 3.0E-17
sp|Q6FM28|FEN1_CANGA Flap endonuclease 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FEN1 PE=3 SV=1 883 1133 3.0E-17
sp|A6UX46|FEN_META3 Flap endonuclease 1 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=fen PE=3 SV=1 863 1133 3.0E-17
sp|A4S1G4|FEN1_OSTLU Flap endonuclease 1 OS=Ostreococcus lucimarinus (strain CCE9901) GN=FEN1 PE=3 SV=1 901 1134 4.0E-17
sp|Q9LPD2|GENL1_ARATH Flap endonuclease GEN-like 1 OS=Arabidopsis thaliana GN=GEN1 PE=2 SV=3 899 1011 4.0E-17
sp|B9EMY6|FEN1_SALSA Flap endonuclease 1 OS=Salmo salar GN=fen1 PE=2 SV=1 893 1133 4.0E-17
sp|B4FHY0|FEN1_MAIZE Flap endonuclease 1 OS=Zea mays GN=FEN1 PE=2 SV=1 901 1133 4.0E-17
sp|B6AFP1|FEN1_CRYMR Flap endonuclease 1 OS=Cryptosporidium muris (strain RN66) GN=FEN1 PE=3 SV=1 893 1133 5.0E-17
sp|B0EN90|FEN1_ENTDS Flap endonuclease 1 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=FEN1 PE=3 SV=1 881 1124 5.0E-17
sp|P70040|FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis GN=fen1-a PE=1 SV=1 901 1133 5.0E-17
sp|Q8PYF6|FEN_METMA Flap endonuclease 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fen PE=3 SV=1 891 1106 6.0E-17
sp|Q9V0P9|FEN_PYRAB Flap endonuclease 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fen PE=3 SV=1 891 1133 7.0E-17
sp|C1E3X9|FEN1_MICSR Flap endonuclease 1 OS=Micromonas sp. (strain RCC299 / NOUM17) GN=FEN1 PE=3 SV=1 894 1134 7.0E-17
sp|B3RVF0|FEN1_TRIAD Flap endonuclease 1 OS=Trichoplax adhaerens GN=FEN1 PE=3 SV=1 901 1144 7.0E-17
sp|Q4FYU7|FEN1_LEIMA Flap endonuclease 1 OS=Leishmania major GN=FEN1 PE=3 SV=1 894 1133 8.0E-17
sp|Q6TNU4|FEN1A_DANRE Flap endonuclease 1 OS=Danio rerio GN=fen1 PE=2 SV=1 893 1133 9.0E-17
sp|O65251|FEN1_ARATH Flap endonuclease 1 OS=Arabidopsis thaliana GN=FEN1 PE=2 SV=2 846 1133 9.0E-17
sp|Q76F73|FEN1_COPCI Flap endonuclease 1 OS=Coprinopsis cinerea GN=FEN1 PE=2 SV=1 889 1020 9.0E-17
sp|P0CS60|FEN1_CRYNJ Flap endonuclease 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FEN1 PE=3 SV=1 901 1021 1.0E-16
sp|P0CS61|FEN1_CRYNB Flap endonuclease 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FEN1 PE=3 SV=1 901 1021 1.0E-16
sp|C6A1U9|FEN_THESM Flap endonuclease 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fen PE=3 SV=1 883 1106 1.0E-16
sp|C1BM18|FEN1_OSMMO Flap endonuclease 1 OS=Osmerus mordax GN=fen1 PE=2 SV=1 893 1133 1.0E-16
sp|Q5I4H3|FEN1_XIPMA Flap endonuclease 1 OS=Xiphophorus maculatus GN=fen1 PE=2 SV=1 893 1133 1.0E-16
sp|D2V434|FEN1_NAEGR Flap endonuclease 1 OS=Naegleria gruberi GN=FEN1 PE=3 SV=1 905 1133 2.0E-16
sp|P70054|FEN1B_XENLA Flap endonuclease 1-B OS=Xenopus laevis GN=fen1-b PE=1 SV=1 882 1133 2.0E-16
sp|Q58839|FEN_METJA Flap endonuclease 1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fen PE=1 SV=1 859 1040 2.0E-16
sp|Q46D63|FEN_METBF Flap endonuclease 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fen PE=3 SV=1 891 1133 2.0E-16
sp|A8AAC1|FEN_IGNH4 Flap endonuclease 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fen PE=3 SV=1 863 1011 2.0E-16
sp|Q64MA3|GENL1_ORYSJ Flap endonuclease GEN-like 1 OS=Oryza sativa subsp. japonica GN=RAD PE=2 SV=1 899 1011 3.0E-16
sp|O50123|FEN_PYRHO Flap endonuclease 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fen PE=1 SV=1 891 1133 3.0E-16
sp|C5WU23|FEN12_SORBI Flap endonuclease 1-B OS=Sorghum bicolor GN=FEN1-B PE=3 SV=2 893 1130 3.0E-16
sp|A5UL52|FEN_METS3 Flap endonuclease 1 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fen PE=3 SV=1 868 1007 5.0E-16
sp|A4I2L4|FEN1_LEIIN Flap endonuclease 1 OS=Leishmania infantum GN=FEN1 PE=3 SV=1 860 1133 5.0E-16
sp|C4QZ20|FEN1_PICPG Flap endonuclease 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=FEN1 PE=3 SV=1 1 96 7.0E-16
sp|D0MY34|FEN1_PHYIT Flap endonuclease 1 OS=Phytophthora infestans (strain T30-4) GN=FEN1 PE=3 SV=1 901 1133 8.0E-16
sp|A8M9L3|FEN_CALMQ Flap endonuclease 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=fen PE=3 SV=1 881 1134 1.0E-15
sp|O93634|FEN_PYRFU Flap endonuclease 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fen PE=1 SV=1 883 1133 1.0E-15
sp|B6YWX4|FEN_THEON Flap endonuclease 1 OS=Thermococcus onnurineus (strain NA1) GN=fen PE=3 SV=1 873 1134 1.0E-15
sp|Q8TIY5|FEN_METAC Flap endonuclease 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fen PE=3 SV=1 894 1108 1.0E-15
sp|Q4UFP0|FEN1_THEAN Flap endonuclease 1 OS=Theileria annulata GN=FEN1 PE=3 SV=1 893 1115 1.0E-15
sp|Q0W6I0|FEN_METAR Flap endonuclease 1 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=fen PE=3 SV=1 870 1110 1.0E-15
sp|B0E412|FEN12_LACBS Flap endonuclease 1-B OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=FEN12 PE=3 SV=1 889 1022 2.0E-15
sp|Q7K734|FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) GN=FEN1 PE=3 SV=1 894 1213 3.0E-15
sp|A4HFE4|FEN1_LEIBR Flap endonuclease 1 OS=Leishmania braziliensis GN=FEN1 PE=3 SV=1 894 1133 3.0E-15
sp|A0RU95|FEN_CENSY Flap endonuclease 1 OS=Cenarchaeum symbiosum (strain A) GN=fen PE=3 SV=1 883 1133 3.0E-15
sp|Q8SS91|FEN1_ENCCU Flap endonuclease 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=FEN1 PE=3 SV=1 874 1010 3.0E-15
sp|P0CS60|FEN1_CRYNJ Flap endonuclease 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FEN1 PE=3 SV=1 1 95 4.0E-15
sp|P0CS61|FEN1_CRYNB Flap endonuclease 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FEN1 PE=3 SV=1 1 95 4.0E-15
sp|C9ZKW4|FEN1_TRYB9 Flap endonuclease 1 OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=FEN1 PE=3 SV=1 901 1133 5.0E-15
sp|Q57WW6|FEN1_TRYB2 Flap endonuclease 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=FEN1 PE=3 SV=1 901 1133 5.0E-15
sp|C3KJE6|FEN1_ANOFI Flap endonuclease 1 OS=Anoplopoma fimbria GN=fen1 PE=2 SV=1 893 1133 5.0E-15
sp|Q4N3S6|FEN1_THEPA Flap endonuclease 1 OS=Theileria parva GN=FEN1 PE=3 SV=1 893 1115 6.0E-15
sp|Q75LI2|FEN12_ORYSJ Flap endonuclease 1-B OS=Oryza sativa subsp. japonica GN=FEN-1b PE=2 SV=1 901 1106 6.0E-15
sp|B8AMS4|FEN12_ORYSI Flap endonuclease 1-B OS=Oryza sativa subsp. indica GN=FEN1b PE=3 SV=1 901 1106 6.0E-15
sp|B7XHS8|FEN1_ENTBH Flap endonuclease 1 OS=Enterocytozoon bieneusi (strain H348) GN=FEN1 PE=3 SV=1 868 1017 7.0E-15
sp|A3MY15|FEN_PYRCJ Flap endonuclease 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fen PE=3 SV=1 860 1011 8.0E-15
sp|Q980U8|FEN_SULSO Flap endonuclease 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fen PE=1 SV=2 894 1011 9.0E-15
sp|Q8ZYN2|FEN_PYRAE Flap endonuclease 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fen PE=3 SV=1 874 1110 1.0E-14
sp|Q9GZ01|FEN1_PLAFA Flap endonuclease 1 OS=Plasmodium falciparum GN=FEN1 PE=2 SV=1 894 1213 1.0E-14
sp|Q5JGN0|FEN_THEKO Flap endonuclease 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fen PE=3 SV=1 883 1134 1.0E-14
sp|Q3IPG8|FEN_NATPD Flap endonuclease 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=fen PE=3 SV=1 870 1010 2.0E-14
sp|A4WNC4|FEN_PYRAR Flap endonuclease 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fen PE=3 SV=1 881 1011 2.0E-14
sp|B3L014|FEN1_PLAKH Flap endonuclease 1 OS=Plasmodium knowlesi (strain H) GN=FEN1 PE=3 SV=1 894 1133 2.0E-14
sp|Q6L2I9|FEN_PICTO Flap endonuclease 1 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=fen PE=3 SV=1 894 1133 2.0E-14
sp|Q2FNC9|FEN_METHJ Flap endonuclease 1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=fen PE=3 SV=1 898 1125 4.0E-14
sp|A1RSC7|FEN_PYRIL Flap endonuclease 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fen PE=3 SV=1 874 1133 5.0E-14
sp|Q4DKQ5|FEN1_TRYCC Flap endonuclease 1 OS=Trypanosoma cruzi (strain CL Brener) GN=FEN1 PE=3 SV=1 901 1133 6.0E-14
sp|C5A639|FEN_THEGJ Flap endonuclease 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fen PE=3 SV=1 883 1106 7.0E-14
sp|O29975|FEN_ARCFU Flap endonuclease 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fen PE=1 SV=1 863 1011 8.0E-14
sp|A7TJ59|FEN1_VANPO Flap endonuclease 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FEN1 PE=3 SV=1 1 96 1.0E-13
sp|B9EMY6|FEN1_SALSA Flap endonuclease 1 OS=Salmo salar GN=fen1 PE=2 SV=1 1 95 1.0E-13
sp|P70054|FEN1B_XENLA Flap endonuclease 1-B OS=Xenopus laevis GN=fen1-b PE=1 SV=1 1 95 1.0E-13
sp|C3KJE6|FEN1_ANOFI Flap endonuclease 1 OS=Anoplopoma fimbria GN=fen1 PE=2 SV=1 1 95 1.0E-13
sp|A3FPN7|FEN1_CRYPI Flap endonuclease 1 OS=Cryptosporidium parvum (strain Iowa II) GN=FEN1 PE=3 SV=1 1 96 1.0E-13
sp|A3FPN7|FEN1_CRYPI Flap endonuclease 1 OS=Cryptosporidium parvum (strain Iowa II) GN=FEN1 PE=3 SV=1 893 1122 1.0E-13
sp|B7G7Y7|FEN1_PHATC Flap endonuclease 1 OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=FEN1 PE=3 SV=1 901 1010 1.0E-13
sp|B7G7Y7|FEN1_PHATC Flap endonuclease 1 OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=FEN1 PE=3 SV=1 1 129 1.0E-13
sp|B1H158|FEN1_XENTR Flap endonuclease 1 OS=Xenopus tropicalis GN=fen1 PE=2 SV=1 1 95 2.0E-13
sp|P70040|FEN1A_XENLA Flap endonuclease 1-A OS=Xenopus laevis GN=fen1-a PE=1 SV=1 1 95 2.0E-13
sp|Q6TNU4|FEN1A_DANRE Flap endonuclease 1 OS=Danio rerio GN=fen1 PE=2 SV=1 1 95 2.0E-13
sp|B8GIA0|FEN_METPE Flap endonuclease 1 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fen PE=3 SV=1 886 1008 2.0E-13
sp|Q9M2Z3|GENL2_ARATH Flap endonuclease GEN-like 2 OS=Arabidopsis thaliana GN=GEN2 PE=2 SV=2 888 1008 2.0E-13
sp|A1RWY2|FEN_THEPD Flap endonuclease 1 OS=Thermofilum pendens (strain Hrk 5) GN=fen PE=3 SV=1 894 1110 2.0E-13
sp|A8B672|FEN1_GIAIC Flap endonuclease 1 OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=FEN1 PE=3 SV=1 834 1008 2.0E-13
sp|Q5V5T7|FEN_HALMA Flap endonuclease 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=fen PE=3 SV=1 868 1010 2.0E-13
sp|Q6BLF4|FEN1_DEBHA Flap endonuclease 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FEN1 PE=3 SV=2 1 96 3.0E-13
sp|Q4P1V1|FEN1_USTMA Flap endonuclease 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FEN1 PE=3 SV=1 1 91 3.0E-13
sp|A8NQC2|FEN1_COPC7 Flap endonuclease 1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=FEN1 PE=3 SV=3 1 91 3.0E-13
sp|Q76F73|FEN1_COPCI Flap endonuclease 1 OS=Coprinopsis cinerea GN=FEN1 PE=2 SV=1 1 91 3.0E-13
sp|A3CWV2|FEN_METMJ Flap endonuclease 1 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fen PE=3 SV=1 899 1133 3.0E-13
sp|A8QCH0|FEN1_BRUMA Flap endonuclease 1 OS=Brugia malayi GN=FEN1 PE=3 SV=1 893 1133 3.0E-13
sp|A5KAL1|FEN1_PLAVS Flap endonuclease 1 OS=Plasmodium vivax (strain Salvador I) GN=FEN1 PE=3 SV=1 894 1133 3.0E-13
sp|Q6C116|FEN1_YARLI Flap endonuclease 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FEN1 PE=3 SV=1 1 96 4.0E-13
sp|B3RVF0|FEN1_TRIAD Flap endonuclease 1 OS=Trichoplax adhaerens GN=FEN1 PE=3 SV=1 1 96 4.0E-13
sp|Q5I4H3|FEN1_XIPMA Flap endonuclease 1 OS=Xiphophorus maculatus GN=fen1 PE=2 SV=1 1 95 4.0E-13
sp|C1BM18|FEN1_OSMMO Flap endonuclease 1 OS=Osmerus mordax GN=fen1 PE=2 SV=1 1 95 5.0E-13
sp|Q9YFY5|FEN_AERPE Flap endonuclease 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fen PE=3 SV=3 891 1134 6.0E-13
sp|Q75DS8|FEN1_ASHGO Flap endonuclease 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FEN1 PE=3 SV=2 1 96 8.0E-13
sp|B1L6R9|FEN_KORCO Flap endonuclease 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=fen PE=3 SV=1 883 1110 8.0E-13
sp|Q5XIP6|FEN1_RAT Flap endonuclease 1 OS=Rattus norvegicus GN=Fen1 PE=2 SV=1 1 95 9.0E-13
sp|B9WLQ5|FEN1_CANDC Flap endonuclease 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=RAD27 PE=3 SV=1 1 96 9.0E-13
sp|Q2NFD4|FEN_METST Flap endonuclease 1 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fen PE=3 SV=1 898 1011 9.0E-13
sp|Q5UQW7|YL386_MIMIV Putative endonuclease L386 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L386 PE=3 SV=1 883 1020 9.0E-13
sp|Q5A6K8|FEN1_CANAL Flap endonuclease 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD27 PE=3 SV=1 1 96 1.0E-12
sp|C4YLS2|FEN1_CANAW Flap endonuclease 1 OS=Candida albicans (strain WO-1) GN=RAD27 PE=3 SV=1 1 96 1.0E-12
sp|C5M2X8|FEN1_CANTT Flap endonuclease 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RAD27 PE=3 SV=1 1 107 1.0E-12
sp|Q6FM28|FEN1_CANGA Flap endonuclease 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FEN1 PE=3 SV=1 1 96 1.0E-12
sp|A2BMI0|FEN_HYPBU Flap endonuclease 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=fen PE=3 SV=1 891 1008 1.0E-12
sp|D3BN56|FEN1_POLPA Flap endonuclease 1 OS=Polysphondylium pallidum GN=repG PE=3 SV=1 1 96 2.0E-12
sp|C8BKD0|FEN1_SHEEP Flap endonuclease 1 OS=Ovis aries GN=FEN1 PE=2 SV=1 1 95 2.0E-12
sp|P26793|FEN1_YEAST Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD27 PE=1 SV=1 1 95 2.0E-12
sp|C8ZC62|FEN1_YEAS8 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RAD27 PE=3 SV=1 1 95 2.0E-12
sp|A6ZZK4|FEN1_YEAS7 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=RAD27 PE=3 SV=1 1 95 2.0E-12
sp|C7GVJ8|FEN1_YEAS2 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain JAY291) GN=RAD27 PE=3 SV=1 1 95 2.0E-12
sp|B3LQY3|FEN1_YEAS1 Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RAD27 PE=3 SV=1 1 95 2.0E-12
sp|Q4UFP0|FEN1_THEAN Flap endonuclease 1 OS=Theileria annulata GN=FEN1 PE=3 SV=1 1 170 2.0E-12
sp|Q4R5U5|FEN1_MACFA Flap endonuclease 1 OS=Macaca fascicularis GN=FEN1 PE=2 SV=1 1 95 3.0E-12
sp|P39748|FEN1_HUMAN Flap endonuclease 1 OS=Homo sapiens GN=FEN1 PE=1 SV=1 1 95 3.0E-12
sp|Q58DH8|FEN1_BOVIN Flap endonuclease 1 OS=Bos taurus GN=FEN1 PE=2 SV=1 1 95 3.0E-12
sp|A8M9L3|FEN_CALMQ Flap endonuclease 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=fen PE=3 SV=1 1 106 3.0E-12
sp|Q8ZYN2|FEN_PYRAE Flap endonuclease 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=fen PE=3 SV=1 1 130 3.0E-12
sp|B1YC46|FEN_PYRNV Flap endonuclease 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fen PE=3 SV=1 894 1135 3.0E-12
sp|B0DSN9|FEN11_LACBS Flap endonuclease 1-A OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=FEN11 PE=3 SV=1 1 91 4.0E-12
sp|A3M056|FEN1_PICST Flap endonuclease 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FEN1 PE=3 SV=2 1 112 4.0E-12
sp|Q976H6|FEN_SULTO Flap endonuclease 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fen PE=3 SV=2 882 1058 4.0E-12
sp|A0B9M7|FEN_METTP Flap endonuclease 1 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=fen PE=3 SV=1 859 1010 4.0E-12
sp|C3ZBT0|FEN1_BRAFL Flap endonuclease 1 OS=Branchiostoma floridae GN=FEN1 PE=3 SV=1 1 96 5.0E-12
sp|Q6CLH4|FEN1_KLULA Flap endonuclease 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FEN1 PE=3 SV=1 1 96 6.0E-12
sp|C5DGG4|FEN1_LACTC Flap endonuclease 1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=FEN1 PE=3 SV=1 1 109 8.0E-12
sp|C5DZA9|FEN1_ZYGRC Flap endonuclease 1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=FEN1 PE=3 SV=1 1 109 8.0E-12
sp|A5E121|FEN1_LODEL Flap endonuclease 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FEN1 PE=3 SV=1 1 96 9.0E-12
sp|P39750|FEN1_SCHPO Flap endonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad2 PE=1 SV=1 1 101 9.0E-12
sp|A5DCF5|FEN1_PICGU Flap endonuclease 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FEN1 PE=3 SV=3 1 96 1.0E-11
sp|Q18HK0|FEN_HALWD Flap endonuclease 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=fen PE=3 SV=1 864 1010 1.0E-11
sp|A3DMG2|FEN_STAMF Flap endonuclease 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fen PE=3 SV=1 893 1017 1.0E-11
sp|P39875|EXO1_YEAST Exodeoxyribonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EXO1 PE=1 SV=2 893 1011 1.0E-11
sp|B3NP61|FEN1_DROER Flap endonuclease 1 OS=Drosophila erecta GN=Fen1 PE=3 SV=1 1 96 2.0E-11
sp|B4P5U9|FEN1_DROYA Flap endonuclease 1 OS=Drosophila yakuba GN=Fen1 PE=3 SV=1 1 96 2.0E-11
sp|B4LM90|FEN1_DROVI Flap endonuclease 1 OS=Drosophila virilis GN=Fen1 PE=3 SV=1 1 96 2.0E-11
sp|Q5ZLN4|FEN1_CHICK Flap endonuclease 1 OS=Gallus gallus GN=FEN1 PE=2 SV=1 1 95 2.0E-11
sp|B3MDA3|FEN1_DROAN Flap endonuclease 1 OS=Drosophila ananassae GN=Fen1 PE=3 SV=1 1 96 2.0E-11
sp|A7RRJ0|FEN1_NEMVE Flap endonuclease 1 OS=Nematostella vectensis GN=FEN1 PE=3 SV=1 1 96 2.0E-11
sp|B0EN90|FEN1_ENTDS Flap endonuclease 1 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760) GN=FEN1 PE=3 SV=1 1 92 2.0E-11
sp|A2SQC6|FEN_METLZ Flap endonuclease 1 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=fen PE=3 SV=1 891 1010 2.0E-11
sp|A8J2Z9|FEN1_CHLRE Flap endonuclease 1 OS=Chlamydomonas reinhardtii GN=FEN1 PE=3 SV=1 1 95 3.0E-11
sp|Q54NU0|FEN1_DICDI Flap endonuclease 1 OS=Dictyostelium discoideum GN=repG PE=3 SV=1 1 101 3.0E-11
sp|B4GIM3|FEN1_DROPE Flap endonuclease 1 OS=Drosophila persimilis GN=Fen1 PE=3 SV=1 1 96 3.0E-11
sp|B5DUR8|FEN1_DROPS Flap endonuclease 1 OS=Drosophila pseudoobscura pseudoobscura GN=Fen1 PE=3 SV=1 1 96 3.0E-11
sp|B4MR84|FEN1_DROWI Flap endonuclease 1 OS=Drosophila willistoni GN=Fen1 PE=3 SV=1 1 96 3.0E-11
sp|Q7K7A9|FEN1_DROME Flap endonuclease 1 OS=Drosophila melanogaster GN=Fen1 PE=2 SV=1 1 96 3.0E-11
sp|B4KNM1|FEN1_DROMO Flap endonuclease 1 OS=Drosophila mojavensis GN=Fen1 PE=3 SV=1 1 96 3.0E-11
sp|B4QIG6|FEN1_DROSI Flap endonuclease 1 OS=Drosophila simulans GN=Fen1 PE=3 SV=1 1 96 3.0E-11
sp|B4HTA1|FEN1_DROSE Flap endonuclease 1 OS=Drosophila sechellia GN=Fen1 PE=3 SV=1 1 96 3.0E-11
sp|C4M6G8|FEN1_ENTHI Flap endonuclease 1 OS=Entamoeba histolytica GN=FEN1 PE=3 SV=1 1 92 3.0E-11
sp|P53695|EXO1_SCHPO Exodeoxyribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo1 PE=1 SV=1 893 1012 3.0E-11
sp|Q9VRJ0|GEN_DROME Flap endonuclease GEN OS=Drosophila melanogaster GN=Gen PE=1 SV=1 898 1023 3.0E-11
sp|Q8N8B7|TEANC_HUMAN Transcription elongation factor A N-terminal and central domain-containing protein OS=Homo sapiens GN=TCEANC PE=1 SV=2 1280 1476 3.0E-11
sp|C4YBJ8|FEN1_CLAL4 Flap endonuclease 1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=FEN1 PE=3 SV=2 1 96 4.0E-11
sp|B6AFP1|FEN1_CRYMR Flap endonuclease 1 OS=Cryptosporidium muris (strain RN66) GN=FEN1 PE=3 SV=1 1 96 4.0E-11
sp|B0E412|FEN12_LACBS Flap endonuclease 1-B OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=FEN12 PE=3 SV=1 1 91 4.0E-11
sp|Q97B98|FEN_THEVO Flap endonuclease 1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=fen PE=3 SV=1 860 1010 4.0E-11
sp|Q4JAN1|FEN_SULAC Flap endonuclease 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fen PE=3 SV=2 876 1011 5.0E-11
sp|Q8SS91|FEN1_ENCCU Flap endonuclease 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=FEN1 PE=3 SV=1 15 95 6.0E-11
sp|A8QCH0|FEN1_BRUMA Flap endonuclease 1 OS=Brugia malayi GN=FEN1 PE=3 SV=1 25 103 6.0E-11
sp|A9A4B0|FEN_NITMS Flap endonuclease 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=fen PE=3 SV=1 888 1010 6.0E-11
sp|A9VB27|FEN1_MONBE Flap endonuclease 1 OS=Monosiga brevicollis GN=FEN1 PE=3 SV=1 1 96 7.0E-11
sp|Q7Q323|FEN1_ANOGA Flap endonuclease 1 OS=Anopheles gambiae GN=Fen1 PE=3 SV=2 1 96 8.0E-11
sp|B4J6M4|FEN1_DROGR Flap endonuclease 1 OS=Drosophila grimshawi GN=Fen1 PE=3 SV=1 1 96 8.0E-11
sp|D3TQJ5|FEN1_GLOMM Flap endonuclease 1 OS=Glossina morsitans morsitans GN=Fen1 PE=2 SV=1 1 96 9.0E-11
sp|O65251|FEN1_ARATH Flap endonuclease 1 OS=Arabidopsis thaliana GN=FEN1 PE=2 SV=2 1 95 1.0E-10
sp|A8AAC1|FEN_IGNH4 Flap endonuclease 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=fen PE=3 SV=1 1 104 1.0E-10
sp|A8B672|FEN1_GIAIC Flap endonuclease 1 OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=FEN1 PE=3 SV=1 1 97 1.0E-10
sp|Q9GMV6|TEANC_MACFA Transcription elongation factor A N-terminal and central domain-containing protein OS=Macaca fascicularis GN=TCEANC PE=2 SV=1 1314 1476 1.0E-10
sp|A7AX58|FEN1_BABBO Flap endonuclease 1 OS=Babesia bovis GN=FEN1 PE=3 SV=1 903 1134 1.0E-10
sp|Q178M1|FEN1_AEDAE Flap endonuclease 1 OS=Aedes aegypti GN=Fen1 PE=3 SV=1 1 96 2.0E-10
sp|B6JYI7|FEN1_SCHJY Flap endonuclease 1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=rad2 PE=3 SV=1 1 96 2.0E-10
sp|D0MY34|FEN1_PHYIT Flap endonuclease 1 OS=Phytophthora infestans (strain T30-4) GN=FEN1 PE=3 SV=1 1 96 2.0E-10
sp|Q7K734|FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) GN=FEN1 PE=3 SV=1 1 96 2.0E-10
sp|B3L014|FEN1_PLAKH Flap endonuclease 1 OS=Plasmodium knowlesi (strain H) GN=FEN1 PE=3 SV=1 1 96 2.0E-10
sp|A5KAL1|FEN1_PLAVS Flap endonuclease 1 OS=Plasmodium vivax (strain Salvador I) GN=FEN1 PE=3 SV=1 1 96 2.0E-10
sp|Q9V0P9|FEN_PYRAB Flap endonuclease 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=fen PE=3 SV=1 19 96 3.0E-10
sp|B7XHS8|FEN1_ENTBH Flap endonuclease 1 OS=Enterocytozoon bieneusi (strain H348) GN=FEN1 PE=3 SV=1 26 129 3.0E-10
sp|P0C8F6|TFS2_ASFM2 Transcription factor S-II-related protein OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-147 PE=2 SV=1 1384 1473 3.0E-10
sp|A8XL25|FEN1_CAEBR Flap endonuclease 1 OS=Caenorhabditis briggsae GN=crn-1 PE=3 SV=1 1 95 4.0E-10
sp|Q9GZ01|FEN1_PLAFA Flap endonuclease 1 OS=Plasmodium falciparum GN=FEN1 PE=2 SV=1 1 96 4.0E-10
sp|A1RWY2|FEN_THEPD Flap endonuclease 1 OS=Thermofilum pendens (strain Hrk 5) GN=fen PE=3 SV=1 1 91 4.0E-10
sp|Q4JAN1|FEN_SULAC Flap endonuclease 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=fen PE=3 SV=2 6 93 4.0E-10
sp|Q29FC1|GEN_DROPS Flap endonuclease GEN OS=Drosophila pseudoobscura pseudoobscura GN=Gen PE=3 SV=1 898 1023 6.0E-10
sp|Q0W6I0|FEN_METAR Flap endonuclease 1 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=fen PE=3 SV=1 1 99 7.0E-10
sp|A4QS18|FEN1_MAGO7 Flap endonuclease 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FEN1 PE=3 SV=2 1 96 8.0E-10
sp|D2V434|FEN1_NAEGR Flap endonuclease 1 OS=Naegleria gruberi GN=FEN1 PE=3 SV=1 1 96 8.0E-10
sp|Q4N3S6|FEN1_THEPA Flap endonuclease 1 OS=Theileria parva GN=FEN1 PE=3 SV=1 28 242 8.0E-10
sp|A3MY15|FEN_PYRCJ Flap endonuclease 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=fen PE=3 SV=1 1 106 8.0E-10
sp|P0C8F8|TFS2_ASFWA Transcription factor S-II-related protein OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-150 PE=2 SV=1 1384 1473 8.0E-10
sp|P0C8F7|TFS2_ASFP4 Transcription factor S-II-related protein OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-152 PE=2 SV=1 1384 1473 9.0E-10
sp|P27948|TFS2_ASFB7 Transcription factor S-II-related protein OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=BA71V-140 PE=2 SV=1 1384 1473 9.0E-10
sp|Q9N3T2|FEN1_CAEEL Flap endonuclease 1 OS=Caenorhabditis elegans GN=crn-1 PE=1 SV=1 1 95 1.0E-09
sp|B8AW67|FEN11_ORYSI Flap endonuclease 1-A OS=Oryza sativa subsp. indica GN=FEN1a PE=3 SV=1 1 96 1.0E-09
sp|P39749|FEN1_MOUSE Flap endonuclease 1 OS=Mus musculus GN=Fen1 PE=1 SV=1 1 95 1.0E-09
sp|Q9SXQ6|FEN11_ORYSJ Flap endonuclease 1-A OS=Oryza sativa subsp. japonica GN=FEN-1a PE=2 SV=1 1 96 1.0E-09
sp|Q46D63|FEN_METBF Flap endonuclease 1 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=fen PE=3 SV=1 15 96 1.0E-09
sp|Q9YFY5|FEN_AERPE Flap endonuclease 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=fen PE=3 SV=3 1 95 1.0E-09
sp|A2BMI0|FEN_HYPBU Flap endonuclease 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=fen PE=3 SV=1 1 93 1.0E-09
sp|B1YC46|FEN_PYRNV Flap endonuclease 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=fen PE=3 SV=1 1 110 1.0E-09
sp|Q9HJD4|FEN_THEAC Flap endonuclease 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=fen PE=3 SV=1 861 1010 1.0E-09
sp|Q12086|DIN7_YEAST DNA damage-inducible protein DIN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIN7 PE=2 SV=1 862 1011 1.0E-09
sp|D1ZT73|FEN1_SORMK Flap endonuclease 1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=FEN1 PE=3 SV=1 1 96 2.0E-09
sp|A1CJ75|FEN1_ASPCL Flap endonuclease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fen1 PE=3 SV=2 1 94 2.0E-09
sp|C1E3X9|FEN1_MICSR Flap endonuclease 1 OS=Micromonas sp. (strain RCC299 / NOUM17) GN=FEN1 PE=3 SV=1 1 96 2.0E-09
sp|C6A1U9|FEN_THESM Flap endonuclease 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=fen PE=3 SV=1 19 96 2.0E-09
sp|O50123|FEN_PYRHO Flap endonuclease 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=fen PE=1 SV=1 17 96 2.0E-09
sp|Q4DKQ5|FEN1_TRYCC Flap endonuclease 1 OS=Trypanosoma cruzi (strain CL Brener) GN=FEN1 PE=3 SV=1 1 96 2.0E-09
sp|O29975|FEN_ARCFU Flap endonuclease 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=fen PE=1 SV=1 19 95 2.0E-09
sp|P0C8F5|TFS2_ASFK5 Transcription factor S-II-related protein OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-151 PE=2 SV=1 1384 1473 2.0E-09
sp|B8C6S5|FEN1_THAPS Flap endonuclease 1 OS=Thalassiosira pseudonana GN=FEN1 PE=3 SV=1 1 95 2.0E-09
sp|A1D8A4|FEN1_NEOFI Flap endonuclease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fen1 PE=3 SV=1 1 94 3.0E-09
sp|B0XZ33|FEN1_ASPFC Flap endonuclease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=fen1 PE=3 SV=2 1 94 3.0E-09
sp|Q4WWJ1|FEN1_ASPFU Flap endonuclease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fen1 PE=3 SV=2 1 94 3.0E-09
sp|C5JVG7|FEN1_AJEDS Flap endonuclease 1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=FEN1 PE=3 SV=2 1 95 3.0E-09
sp|C5GPA7|FEN1_AJEDR Flap endonuclease 1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=FEN1 PE=3 SV=2 1 95 3.0E-09
sp|Q12UT1|FEN_METBU Flap endonuclease 1 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=fen PE=3 SV=1 19 96 3.0E-09
sp|P61942|FEN_NANEQ Flap endonuclease 1 OS=Nanoarchaeum equitans (strain Kin4-M) GN=fen PE=3 SV=1 1 96 3.0E-09
sp|Q8PYF6|FEN_METMA Flap endonuclease 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=fen PE=3 SV=1 15 100 3.0E-09
sp|A0RU95|FEN_CENSY Flap endonuclease 1 OS=Cenarchaeum symbiosum (strain A) GN=fen PE=3 SV=1 16 117 3.0E-09
sp|A4WNC4|FEN_PYRAR Flap endonuclease 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=fen PE=3 SV=1 1 104 3.0E-09
sp|Q0CBS0|FEN1_ASPTN Flap endonuclease 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fen1 PE=3 SV=2 1 95 4.0E-09
sp|C4JDR3|FEN1_UNCRE Flap endonuclease 1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=FEN1 PE=3 SV=2 1 96 4.0E-09
sp|Q5B9L6|FEN1_EMENI Flap endonuclease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fen1 PE=3 SV=1 1 96 4.0E-09
sp|C6TEX6|FEN1_SOYBN Flap endonuclease 1 OS=Glycine max GN=FEN1 PE=2 SV=1 1 108 4.0E-09
sp|A9S0B8|FEN11_PHYPA Flap endonuclease 1-A OS=Physcomitrella patens subsp. patens GN=FEN1-A PE=3 SV=1 1 103 4.0E-09
sp|B8GIA0|FEN_METPE Flap endonuclease 1 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=fen PE=3 SV=1 28 104 4.0E-09
sp|Q8L6Z7|EXO1_ARATH Exonuclease 1 OS=Arabidopsis thaliana GN=EXO1 PE=2 SV=2 891 1030 4.0E-09
sp|A7UW97|FEN1_NEUCR Flap endonuclease 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dnr-8 PE=3 SV=2 1 96 5.0E-09
sp|C6HQJ2|FEN1_AJECH Flap endonuclease 1 OS=Ajellomyces capsulatus (strain H143) GN=FEN1 PE=3 SV=2 1 95 5.0E-09
sp|A6QV55|FEN1_AJECN Flap endonuclease 1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FEN1 PE=3 SV=1 1 95 5.0E-09
sp|C5YUK3|FEN11_SORBI Flap endonuclease 1-A OS=Sorghum bicolor GN=FEN1-A PE=3 SV=1 1 101 5.0E-09
sp|Q8TIY5|FEN_METAC Flap endonuclease 1 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=fen PE=3 SV=1 15 96 5.0E-09
sp|A7AX58|FEN1_BABBO Flap endonuclease 1 OS=Babesia bovis GN=FEN1 PE=3 SV=1 1 96 5.0E-09
sp|B4FHY0|FEN1_MAIZE Flap endonuclease 1 OS=Zea mays GN=FEN1 PE=2 SV=1 1 104 6.0E-09
sp|A1RSC7|FEN_PYRIL Flap endonuclease 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=fen PE=3 SV=1 1 104 6.0E-09
sp|Q29FC1|GEN_DROPS Flap endonuclease GEN OS=Drosophila pseudoobscura pseudoobscura GN=Gen PE=3 SV=1 1 91 6.0E-09
sp|C7Z125|FEN1_NECH7 Flap endonuclease 1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=FEN1 PE=3 SV=1 1 96 7.0E-09
sp|A4S1G4|FEN1_OSTLU Flap endonuclease 1 OS=Ostreococcus lucimarinus (strain CCE9901) GN=FEN1 PE=3 SV=1 1 95 8.0E-09
sp|A5ABU3|FEN1_ASPNC Flap endonuclease 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fen1 PE=3 SV=1 1 95 9.0E-09
sp|B8NV37|FEN1_ASPFN Flap endonuclease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=fen1 PE=3 SV=1 1 94 1.0E-08
sp|Q0UZR3|FEN1_PHANO Flap endonuclease 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FEN1 PE=3 SV=3 1 95 1.0E-08
sp|B8MNF2|FEN1_TALSN Flap endonuclease 1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=fen1 PE=3 SV=2 1 95 2.0E-08
sp|B6HEM2|FEN1_PENRW Flap endonuclease 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=fen1 PE=3 SV=1 1 94 2.0E-08
sp|Q013G9|FEN1_OSTTA Flap endonuclease 1 OS=Ostreococcus tauri GN=FEN1 PE=3 SV=2 1 95 2.0E-08
sp|Q4FYU7|FEN1_LEIMA Flap endonuclease 1 OS=Leishmania major GN=FEN1 PE=3 SV=1 1 130 2.0E-08
sp|A4I2L4|FEN1_LEIIN Flap endonuclease 1 OS=Leishmania infantum GN=FEN1 PE=3 SV=1 1 130 2.0E-08
sp|Q2FNC9|FEN_METHJ Flap endonuclease 1 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=fen PE=3 SV=1 28 96 2.0E-08
sp|A9A4B0|FEN_NITMS Flap endonuclease 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=fen PE=3 SV=1 1 93 2.0E-08
sp|B6QT52|FEN1_TALMQ Flap endonuclease 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=fen1 PE=3 SV=2 1 95 3.0E-08
sp|Q8BMI4|GEN_MOUSE Flap endonuclease GEN homolog 1 OS=Mus musculus GN=Gen1 PE=1 SV=2 1 97 3.0E-08
sp|Q980U8|FEN_SULSO Flap endonuclease 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=fen PE=1 SV=2 6 109 3.0E-08
sp|Q7RME3|FEN1_PLAYO Flap endonuclease 1 OS=Plasmodium yoelii yoelii GN=FEN1 PE=3 SV=1 1 96 3.0E-08
sp|Q4Z015|FEN1_PLABA Flap endonuclease 1 OS=Plasmodium berghei (strain Anka) GN=FEN1 PE=3 SV=1 842 1011 3.0E-08
sp|A9U328|FEN12_PHYPA Flap endonuclease 1-B OS=Physcomitrella patens subsp. patens GN=FEN1-B PE=3 SV=1 1 96 4.0E-08
sp|Q75LI2|FEN12_ORYSJ Flap endonuclease 1-B OS=Oryza sativa subsp. japonica GN=FEN-1b PE=2 SV=1 27 104 4.0E-08
sp|B8AMS4|FEN12_ORYSI Flap endonuclease 1-B OS=Oryza sativa subsp. indica GN=FEN1b PE=3 SV=1 27 104 4.0E-08
sp|Q9M2Z3|GENL2_ARATH Flap endonuclease GEN-like 2 OS=Arabidopsis thaliana GN=GEN2 PE=2 SV=2 1 103 4.0E-08
sp|Q4Z015|FEN1_PLABA Flap endonuclease 1 OS=Plasmodium berghei (strain Anka) GN=FEN1 PE=3 SV=1 1 96 4.0E-08
sp|Q6GZN0|095R_FRG3G Putative RAD2-like endonuclease 095R OS=Frog virus 3 (isolate Goorha) GN=FV3-095R PE=3 SV=1 909 1008 4.0E-08
sp|A4VDN2|FEN1_TETTS Flap endonuclease 1 OS=Tetrahymena thermophila (strain SB210) GN=FEN1 PE=3 SV=1 1 96 5.0E-08
sp|Q17RS7|GEN_HUMAN Flap endonuclease GEN homolog 1 OS=Homo sapiens GN=GEN1 PE=1 SV=2 1 97 5.0E-08
sp|Q4XXP8|FEN1_PLACH Flap endonuclease 1 OS=Plasmodium chabaudi GN=FEN1 PE=3 SV=1 1 96 5.0E-08
sp|B2VTT3|FEN1_PYRTR Flap endonuclease 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=fen1 PE=3 SV=2 1 95 6.0E-08
sp|A4HFE4|FEN1_LEIBR Flap endonuclease 1 OS=Leishmania braziliensis GN=FEN1 PE=3 SV=1 1 94 6.0E-08
sp|Q7RME3|FEN1_PLAYO Flap endonuclease 1 OS=Plasmodium yoelii yoelii GN=FEN1 PE=3 SV=1 870 1011 6.0E-08
sp|A3DMG2|FEN_STAMF Flap endonuclease 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=fen PE=3 SV=1 1 96 7.0E-08
sp|Q9VRJ0|GEN_DROME Flap endonuclease GEN OS=Drosophila melanogaster GN=Gen PE=1 SV=1 1 91 7.0E-08
sp|Q4XXP8|FEN1_PLACH Flap endonuclease 1 OS=Plasmodium chabaudi GN=FEN1 PE=3 SV=1 870 1011 8.0E-08
sp|A3CWV2|FEN_METMJ Flap endonuclease 1 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=fen PE=3 SV=1 28 106 9.0E-08
sp|Q8W5R1|GENL2_ORYSJ Flap endonuclease GEN-like 2 OS=Oryza sativa subsp. japonica GN=SEND1 PE=2 SV=1 1 91 1.0E-07
sp|Q3US16|TEANC_MOUSE Transcription elongation factor A N-terminal and central domain-containing protein OS=Mus musculus GN=Tceanc PE=2 SV=1 1262 1473 1.0E-07
sp|O93634|FEN_PYRFU Flap endonuclease 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=fen PE=1 SV=1 19 85 2.0E-07
sp|C9ZKW4|FEN1_TRYB9 Flap endonuclease 1 OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972) GN=FEN1 PE=3 SV=1 1 96 2.0E-07
sp|Q57WW6|FEN1_TRYB2 Flap endonuclease 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=FEN1 PE=3 SV=1 1 96 2.0E-07
sp|C5A639|FEN_THEGJ Flap endonuclease 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=fen PE=3 SV=1 19 85 2.0E-07
sp|Q976H6|FEN_SULTO Flap endonuclease 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=fen PE=3 SV=2 6 91 2.0E-07
sp|Q9Y2Y1|RPC10_HUMAN DNA-directed RNA polymerase III subunit RPC10 OS=Homo sapiens GN=POLR3K PE=1 SV=2 1433 1474 2.0E-07
sp|Q91FF5|VF369_IIV6 Probable RAD2-like endonuclease 369L OS=Invertebrate iridescent virus 6 GN=IIV6-369L PE=3 SV=1 864 1008 2.0E-07
sp|A0CYG2|FEN12_PARTE Flap endonuclease 1-2 OS=Paramecium tetraurelia GN=FEN1-2 PE=3 SV=1 1 122 3.0E-07
sp|Q9CQZ7|RPC10_MOUSE DNA-directed RNA polymerase III subunit RPC10 OS=Mus musculus GN=Polr3k PE=3 SV=1 1438 1474 3.0E-07
sp|Q9QZ11|EXO1_MOUSE Exonuclease 1 OS=Mus musculus GN=Exo1 PE=2 SV=2 894 1008 6.0E-07
sp|A0CXT3|FEN11_PARTE Flap endonuclease 1-1 OS=Paramecium tetraurelia GN=FEN1-1 PE=3 SV=1 1 122 7.0E-07
sp|Q5JGN0|FEN_THEKO Flap endonuclease 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=fen PE=3 SV=1 19 85 7.0E-07
sp|Q9UQ84|EXO1_HUMAN Exonuclease 1 OS=Homo sapiens GN=EXO1 PE=1 SV=2 894 1008 9.0E-07
sp|A7IA59|FEN_METB6 Flap endonuclease 1 OS=Methanoregula boonei (strain 6A8) GN=fen PE=3 SV=1 28 96 1.0E-06
sp|B6YWX4|FEN_THEON Flap endonuclease 1 OS=Thermococcus onnurineus (strain NA1) GN=fen PE=3 SV=1 19 85 1.0E-06
sp|Q2NFD4|FEN_METST Flap endonuclease 1 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=fen PE=3 SV=1 16 91 1.0E-06
sp|B1L6R9|FEN_KORCO Flap endonuclease 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=fen PE=3 SV=1 19 96 2.0E-06
sp|Q60GC1|EXO1_ORYSJ Exonuclease 1 OS=Oryza sativa subsp. japonica GN=EXO1 PE=2 SV=1 891 1027 2.0E-06
sp|Q9HQ27|FEN_HALSA Flap endonuclease 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=fen PE=3 SV=1 905 1010 2.0E-06
sp|B0R5F5|FEN_HALS3 Flap endonuclease 1 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=fen PE=3 SV=1 905 1010 2.0E-06
sp|P53695|EXO1_SCHPO Exodeoxyribonuclease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=exo1 PE=1 SV=1 1 96 3.0E-06
sp|A2SQC6|FEN_METLZ Flap endonuclease 1 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=fen PE=3 SV=1 28 100 6.0E-06
sp|A5UL52|FEN_METS3 Flap endonuclease 1 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=fen PE=3 SV=1 1 96 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0006351 transcription, DNA-templated Yes
GO:0004518 nuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046872 metal ion binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0046914 transition metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043167 ion binding No
GO:0090304 nucleic acid metabolic process No
GO:0032774 RNA biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Transcription factor TFIIS

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup739
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2758
Ophiocordyceps australis map64 (Brazil) OphauB2|4423
Ophiocordyceps camponoti-floridani Ophcf2|03374
Ophiocordyceps camponoti-rufipedis Ophun1|580 (this protein)
Ophiocordyceps kimflemingae Ophio5|798
Ophiocordyceps subramaniannii Hirsu2|197
Ophiocordyceps subramaniannii Hirsu2|198

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|580
MGVNGLWTVIQPCARPTNLATLNRKRLAVDASIWIYQFLKAVRDKEGNALRNSHIVGFFRRICKLLWYGILPVFI
FDGGAPALKRATIQKRQRRREGRRDDAVRTAGKLLAVQMQRAAVDEEERRKRELGGDVSAREALLQQEDAAESSD
LVYQAELNMSQREKTQSRRFFKQDAYHLPELDRDIASMGKPEDPRIMSVEELDEYARQFNDGQDINLYDFSKIDF
DGDFFKSLPPADRYNILNAARLRSRLRMGYSKDQLEEMFPDRMAFSRFQIERVRERNNLTQRLMFEVGMTDTDLT
LPVNARIAGDKDREYLLVKNEGAEGGWALGVVSKEKDIGQAHKPIDVDAIQVQYQTKDDEEDEDEDEDFEDVPIE
GLNRLPKPRLPEAPSQQFAQDIAAARQHIYLDNQVRAAGEEASGEGSLFVGGNTGEASAILEKDADQESRLDEED
DINQAIALSLRNQHELDEEQSRGDAPDEAPDEASSKKPKWTQRAAEASRPIHGASGSMIAHVVNNRSNAAVRRRD
VEEEDSDSEDDMQTVLARARNAKPAPAERSVAAMSNAFGGPLPFPKLDWKTSVFARKDAQQDQVPKRDVAREEAG
GAEEEGAEEETAAEVEGGGFEVSPQKQDDAPKELPPWLADDTDIRESLKKQHDVEREINAEDREEAEEEERLQRK
EMERRLIEIESSSDDDGDVEIIEAPYSAKRPTGDLNRGKQSVEDSFSTGTVSEIEPTEPLETEMNDARHTSVASA
QADALVDETPSLVEGNPPPADEAEPSGEKPSQTEEDLFSASASPEPVFEDVPAAATATVVQEEPLPNGEDVSDDD
LFGDAESEDFSEPEDQELMMQMAEEAEEHARFASQLNQKSAAQNKEDYEKELRALRNQQKKDRRDADEVTQVMVG
ECQALLRLFGIPYVTAPMEAEAQCAELVRLGIVDGIVTDDSDTFLFGGTRVYKNMFNSNKFVECYLGVDVEKELS
LSREQLISLAQLLGSDYTEGLSGVGPVTAVEILSEFPGRDGLEHFREWWTSVQSLSRPKEADSSSPFRIKFRKSQ
ATKLFLPPGFPSQAVYDAYQHPEVDDSAEPFQWGVPDLQGLRRFLMSTIGWSQERTDEVLVPVIRDMNRREAEGT
QSNITQFFGGGVGAGAREAFAPRQRARGSKRMAAAVDRLRANVAASEIIKAAMDQRELEARIKALTKSVAANEPA
ENAIRLLDTLKKEAAPTEEMLRATRAGVYVGKLRANPNKEIARAATELVVKWKKLVEQEKNSKMQKAKKGSPALP
VASPPAVAAAPLGAKKAFAGDPEKRKFDTDGIDIKRTGSTLRDQCIGLVYNGLAFRSTEAPSDVVSKASAIEKAV
LEIYGSPENADYKKKIRSLFANLKNKSNRELGLRVMSGDITPEQFATMTDEELKSEDQRKKDQELERENMKKAQV
PMAEKSISDSLECGRCKKKRVSYTQAQTRSADEPMTTFCECMGCGHRWKFS*
Coding >Ophun1|580
ATGGGTGTCAACGGACTCTGGACCGTCATCCAGCCCTGCGCGCGCCCAACGAACCTCGCCACCCTCAACCGCAAG
CGCCTCGCCGTCGATGCCTCCATTTGGATATATCAGTTTCTCAAGGCCGTGCGCGATAAGGAGGGCAATGCTCTA
CGGAACTCGCATATTGTCGGCTTCTTCCGCCGCATCTGCAAGCTCCTCTGGTACGGCATCTTGCCCGTCTTCATC
TTCGACGGTGGCGCCCCTGCCCTTAAGCGAGCCACCATTCAGAAGCGGCAGCGAAGACGAGAGGGTCGGCGGGAC
GATGCCGTTCGGACGGCGGGGAAACTGCTGGCGGTGCAGATGCAGCGTGCCGCCGTCGACGAGGAGGAACGACGC
AAGAGGGAGCTGGGCGGCGACGTTTCCGCTCGAGAGGCACTGCTGCAGCAAGAGGATGCCGCTGAATCCAGTGAT
CTCGTCTATCAGGCCGAGCTCAACATGTCGCAGCGGGAAAAGACACAATCCAGGCGCTTCTTCAAACAGGATGCC
TATCACCTACCCGAGCTCGATCGCGACATCGCCTCCATGGGCAAGCCCGAAGACCCGCGCATCATGAGCGTCGAA
GAGCTGGATGAATATGCGCGCCAGTTCAACGACGGTCAGGACATTAATCTCTACGACTTTAGCAAGATTGATTTT
GACGGCGACTTCTTCAAGAGCCTGCCGCCCGCGGATCGCTACAATATCCTCAATGCCGCGCGGTTGAGGAGCCGC
CTCAGGATGGGCTACAGCAAGGATCAGCTCGAGGAGATGTTTCCGGACCGCATGGCCTTTTCTAGGTTTCAGATT
GAGAGAGTCCGGGAACGAAATAACTTGACGCAGCGGCTCATGTTCGAGGTCGGCATGACGGACACGGATCTGACC
TTGCCGGTCAACGCGCGCATCGCCGGAGATAAAGATCGCGAGTACCTCCTAGTCAAGAACGAGGGCGCCGAAGGG
GGGTGGGCGTTGGGCGTTGTGAGCAAGGAAAAGGATATTGGGCAGGCTCACAAGCCCATCGACGTAGACGCTATC
CAGGTTCAATACCAAACCAAAGACGACGAGGAGGATGAAGACGAGGACGAAGACTTTGAGGACGTGCCGATAGAG
GGACTCAATCGCCTGCCGAAACCGAGGCTACCCGAGGCACCGAGCCAGCAGTTTGCGCAGGACATTGCGGCGGCT
AGACAGCATATCTATCTCGACAATCAGGTACGCGCTGCCGGGGAGGAGGCCAGTGGCGAGGGGTCTCTTTTCGTC
GGTGGCAACACTGGTGAGGCGAGTGCGATTCTTGAGAAAGATGCGGACCAGGAGTCGCGTCTCGATGAAGAGGAC
GATATCAACCAGGCCATCGCCTTGTCTTTGAGAAACCAGCACGAATTGGACGAGGAGCAAAGCAGGGGAGATGCA
CCCGATGAAGCACCCGATGAAGCATCCTCGAAAAAGCCGAAATGGACGCAAAGAGCTGCCGAGGCGTCGAGACCC
ATTCACGGAGCCAGCGGTTCCATGATCGCCCACGTTGTCAACAATCGATCCAACGCTGCGGTGAGACGTCGAGAC
GTCGAGGAAGAGGACAGTGACAGCGAGGACGATATGCAAACCGTTTTGGCTAGGGCCAGGAATGCGAAGCCTGCT
CCAGCAGAGCGCAGTGTTGCTGCGATGAGCAACGCTTTCGGTGGGCCACTTCCCTTTCCTAAACTCGACTGGAAA
ACCTCTGTCTTTGCCAGGAAAGACGCCCAACAAGATCAAGTCCCCAAGAGAGACGTTGCGCGAGAAGAGGCCGGA
GGAGCAGAAGAGGAGGGAGCAGAAGAGGAGACAGCAGCTGAAGTCGAGGGCGGCGGCTTTGAAGTTTCACCGCAA
AAGCAAGACGACGCTCCAAAGGAATTACCCCCTTGGTTGGCGGACGACACTGATATTAGGGAGTCTCTCAAGAAG
CAGCATGATGTGGAGAGAGAGATTAATGCTGAAGATAGGGAGGAGGCTGAGGAGGAGGAGCGACTGCAGCGGAAA
GAGATGGAGCGGCGGCTTATTGAGATCGAGTCTTCATCTGACGACGACGGCGATGTGGAAATCATCGAGGCACCC
TATTCGGCTAAGCGGCCTACTGGAGACCTCAACAGGGGGAAGCAATCTGTTGAAGATAGCTTTTCGACGGGAACT
GTCTCCGAAATCGAGCCAACGGAACCGCTGGAAACCGAGATGAACGACGCGAGGCATACAAGTGTTGCCAGTGCG
CAGGCGGATGCTTTGGTAGATGAGACGCCATCTTTGGTGGAGGGAAACCCGCCTCCAGCGGACGAAGCAGAGCCA
TCGGGAGAAAAGCCATCTCAAACAGAGGAGGATCTGTTCTCGGCATCGGCGTCGCCCGAACCCGTGTTTGAGGAC
GTTCCCGCGGCTGCTACGGCGACTGTCGTGCAGGAAGAACCCCTCCCAAATGGAGAGGATGTTTCGGACGACGAT
TTATTCGGGGACGCAGAGTCGGAGGACTTTAGCGAACCCGAAGACCAGGAGCTCATGATGCAGATGGCCGAAGAG
GCCGAAGAGCACGCCCGCTTCGCCAGCCAGCTGAACCAAAAGTCGGCGGCGCAAAACAAGGAGGACTACGAAAAG
GAGCTGCGAGCGCTGCGAAACCAACAGAAGAAGGACCGGCGAGACGCGGACGAGGTGACACAGGTCATGGTAGGC
GAGTGTCAAGCGCTACTCCGTCTCTTCGGCATCCCGTACGTGACGGCACCGATGGAGGCCGAGGCGCAGTGCGCG
GAGCTGGTCAGGCTGGGCATCGTCGACGGCATCGTCACCGACGACTCGGACACGTTTCTCTTTGGCGGCACGCGG
GTGTACAAGAACATGTTTAACAGCAACAAGTTTGTCGAGTGCTACCTGGGCGTCGATGTCGAAAAGGAACTGTCG
CTCTCGCGCGAGCAGCTGATTTCACTGGCTCAGCTGCTCGGATCCGACTACACCGAAGGCCTGTCGGGCGTGGGC
CCCGTCACGGCGGTCGAGATCCTATCCGAGTTCCCCGGAAGGGACGGGCTCGAGCATTTTCGGGAGTGGTGGACG
TCTGTACAGAGCCTGAGCCGGCCCAAAGAGGCGGACTCGTCGTCTCCTTTCCGCATCAAGTTCCGAAAGTCGCAG
GCCACCAAGCTCTTTCTGCCTCCGGGCTTCCCTTCCCAAGCGGTGTACGATGCCTATCAACATCCCGAGGTGGAC
GACAGCGCGGAACCGTTTCAATGGGGTGTTCCGGATTTACAAGGGCTGCGGCGCTTCCTCATGTCGACGATTGGG
TGGAGCCAAGAGCGGACGGATGAGGTGCTGGTGCCGGTGATCCGTGACATGAACAGGCGAGAGGCAGAAGGCACG
CAGAGCAATATCACGCAGTTCTTTGGAGGCGGTGTCGGGGCTGGCGCTAGGGAGGCGTTTGCGCCGAGGCAGAGG
GCCAGGGGGAGCAAGCGGATGGCGGCTGCGGTGGATAGGCTGAGGGCAAATGTTGCGGCTTCTGAAATCATCAAG
GCCGCCATGGACCAACGCGAGCTGGAGGCGCGCATCAAGGCGCTGACCAAGTCGGTCGCTGCGAACGAACCGGCC
GAGAATGCCATCAGGCTGCTGGATACGCTGAAGAAGGAGGCTGCTCCGACGGAGGAGATGTTACGAGCCACCCGC
GCCGGCGTCTACGTCGGCAAACTGCGTGCGAACCCCAACAAAGAAATCGCTCGAGCTGCTACGGAACTCGTCGTC
AAGTGGAAGAAACTCGTCGAGCAGGAAAAGAACTCCAAGATGCAAAAGGCAAAGAAGGGCTCCCCGGCTCTCCCC
GTGGCGTCGCCCCCGGCTGTGGCAGCAGCTCCCCTGGGCGCCAAGAAGGCCTTCGCCGGCGACCCAGAGAAGCGC
AAGTTCGACACGGACGGCATCGACATTAAGCGGACGGGCTCGACCCTTCGCGATCAGTGCATCGGACTCGTCTAC
AACGGCCTCGCCTTTCGCTCGACCGAGGCCCCCTCGGACGTCGTCTCCAAGGCCAGCGCCATCGAAAAGGCCGTG
CTCGAAATCTACGGCAGCCCCGAAAACGCAGATTACAAGAAGAAGATACGGTCTCTTTTTGCTAACCTCAAGAAC
AAGTCGAACCGGGAGCTCGGCCTGCGCGTCATGTCGGGCGACATAACGCCTGAGCAATTCGCCACCATGACCGAC
GAGGAACTCAAGAGCGAGGACCAGCGCAAGAAGGACCAGGAGCTCGAAAGGGAGAATATGAAGAAGGCGCAGGTG
CCCATGGCCGAGAAGAGCATCAGTGACAGCCTCGAGTGCGGCCGCTGTAAGAAGAAGCGCGTCAGCTACACGCAG
GCCCAGACACGGAGTGCCGACGAGCCCATGACGACCTTTTGCGAATGCATGGGTTGCGGTCACCGTTGGAAGTTC
TCGTGA
Transcript >Ophun1|580
ATGGGTGTCAACGGACTCTGGACCGTCATCCAGCCCTGCGCGCGCCCAACGAACCTCGCCACCCTCAACCGCAAG
CGCCTCGCCGTCGATGCCTCCATTTGGATATATCAGTTTCTCAAGGCCGTGCGCGATAAGGAGGGCAATGCTCTA
CGGAACTCGCATATTGTCGGCTTCTTCCGCCGCATCTGCAAGCTCCTCTGGTACGGCATCTTGCCCGTCTTCATC
TTCGACGGTGGCGCCCCTGCCCTTAAGCGAGCCACCATTCAGAAGCGGCAGCGAAGACGAGAGGGTCGGCGGGAC
GATGCCGTTCGGACGGCGGGGAAACTGCTGGCGGTGCAGATGCAGCGTGCCGCCGTCGACGAGGAGGAACGACGC
AAGAGGGAGCTGGGCGGCGACGTTTCCGCTCGAGAGGCACTGCTGCAGCAAGAGGATGCCGCTGAATCCAGTGAT
CTCGTCTATCAGGCCGAGCTCAACATGTCGCAGCGGGAAAAGACACAATCCAGGCGCTTCTTCAAACAGGATGCC
TATCACCTACCCGAGCTCGATCGCGACATCGCCTCCATGGGCAAGCCCGAAGACCCGCGCATCATGAGCGTCGAA
GAGCTGGATGAATATGCGCGCCAGTTCAACGACGGTCAGGACATTAATCTCTACGACTTTAGCAAGATTGATTTT
GACGGCGACTTCTTCAAGAGCCTGCCGCCCGCGGATCGCTACAATATCCTCAATGCCGCGCGGTTGAGGAGCCGC
CTCAGGATGGGCTACAGCAAGGATCAGCTCGAGGAGATGTTTCCGGACCGCATGGCCTTTTCTAGGTTTCAGATT
GAGAGAGTCCGGGAACGAAATAACTTGACGCAGCGGCTCATGTTCGAGGTCGGCATGACGGACACGGATCTGACC
TTGCCGGTCAACGCGCGCATCGCCGGAGATAAAGATCGCGAGTACCTCCTAGTCAAGAACGAGGGCGCCGAAGGG
GGGTGGGCGTTGGGCGTTGTGAGCAAGGAAAAGGATATTGGGCAGGCTCACAAGCCCATCGACGTAGACGCTATC
CAGGTTCAATACCAAACCAAAGACGACGAGGAGGATGAAGACGAGGACGAAGACTTTGAGGACGTGCCGATAGAG
GGACTCAATCGCCTGCCGAAACCGAGGCTACCCGAGGCACCGAGCCAGCAGTTTGCGCAGGACATTGCGGCGGCT
AGACAGCATATCTATCTCGACAATCAGGTACGCGCTGCCGGGGAGGAGGCCAGTGGCGAGGGGTCTCTTTTCGTC
GGTGGCAACACTGGTGAGGCGAGTGCGATTCTTGAGAAAGATGCGGACCAGGAGTCGCGTCTCGATGAAGAGGAC
GATATCAACCAGGCCATCGCCTTGTCTTTGAGAAACCAGCACGAATTGGACGAGGAGCAAAGCAGGGGAGATGCA
CCCGATGAAGCACCCGATGAAGCATCCTCGAAAAAGCCGAAATGGACGCAAAGAGCTGCCGAGGCGTCGAGACCC
ATTCACGGAGCCAGCGGTTCCATGATCGCCCACGTTGTCAACAATCGATCCAACGCTGCGGTGAGACGTCGAGAC
GTCGAGGAAGAGGACAGTGACAGCGAGGACGATATGCAAACCGTTTTGGCTAGGGCCAGGAATGCGAAGCCTGCT
CCAGCAGAGCGCAGTGTTGCTGCGATGAGCAACGCTTTCGGTGGGCCACTTCCCTTTCCTAAACTCGACTGGAAA
ACCTCTGTCTTTGCCAGGAAAGACGCCCAACAAGATCAAGTCCCCAAGAGAGACGTTGCGCGAGAAGAGGCCGGA
GGAGCAGAAGAGGAGGGAGCAGAAGAGGAGACAGCAGCTGAAGTCGAGGGCGGCGGCTTTGAAGTTTCACCGCAA
AAGCAAGACGACGCTCCAAAGGAATTACCCCCTTGGTTGGCGGACGACACTGATATTAGGGAGTCTCTCAAGAAG
CAGCATGATGTGGAGAGAGAGATTAATGCTGAAGATAGGGAGGAGGCTGAGGAGGAGGAGCGACTGCAGCGGAAA
GAGATGGAGCGGCGGCTTATTGAGATCGAGTCTTCATCTGACGACGACGGCGATGTGGAAATCATCGAGGCACCC
TATTCGGCTAAGCGGCCTACTGGAGACCTCAACAGGGGGAAGCAATCTGTTGAAGATAGCTTTTCGACGGGAACT
GTCTCCGAAATCGAGCCAACGGAACCGCTGGAAACCGAGATGAACGACGCGAGGCATACAAGTGTTGCCAGTGCG
CAGGCGGATGCTTTGGTAGATGAGACGCCATCTTTGGTGGAGGGAAACCCGCCTCCAGCGGACGAAGCAGAGCCA
TCGGGAGAAAAGCCATCTCAAACAGAGGAGGATCTGTTCTCGGCATCGGCGTCGCCCGAACCCGTGTTTGAGGAC
GTTCCCGCGGCTGCTACGGCGACTGTCGTGCAGGAAGAACCCCTCCCAAATGGAGAGGATGTTTCGGACGACGAT
TTATTCGGGGACGCAGAGTCGGAGGACTTTAGCGAACCCGAAGACCAGGAGCTCATGATGCAGATGGCCGAAGAG
GCCGAAGAGCACGCCCGCTTCGCCAGCCAGCTGAACCAAAAGTCGGCGGCGCAAAACAAGGAGGACTACGAAAAG
GAGCTGCGAGCGCTGCGAAACCAACAGAAGAAGGACCGGCGAGACGCGGACGAGGTGACACAGGTCATGGTAGGC
GAGTGTCAAGCGCTACTCCGTCTCTTCGGCATCCCGTACGTGACGGCACCGATGGAGGCCGAGGCGCAGTGCGCG
GAGCTGGTCAGGCTGGGCATCGTCGACGGCATCGTCACCGACGACTCGGACACGTTTCTCTTTGGCGGCACGCGG
GTGTACAAGAACATGTTTAACAGCAACAAGTTTGTCGAGTGCTACCTGGGCGTCGATGTCGAAAAGGAACTGTCG
CTCTCGCGCGAGCAGCTGATTTCACTGGCTCAGCTGCTCGGATCCGACTACACCGAAGGCCTGTCGGGCGTGGGC
CCCGTCACGGCGGTCGAGATCCTATCCGAGTTCCCCGGAAGGGACGGGCTCGAGCATTTTCGGGAGTGGTGGACG
TCTGTACAGAGCCTGAGCCGGCCCAAAGAGGCGGACTCGTCGTCTCCTTTCCGCATCAAGTTCCGAAAGTCGCAG
GCCACCAAGCTCTTTCTGCCTCCGGGCTTCCCTTCCCAAGCGGTGTACGATGCCTATCAACATCCCGAGGTGGAC
GACAGCGCGGAACCGTTTCAATGGGGTGTTCCGGATTTACAAGGGCTGCGGCGCTTCCTCATGTCGACGATTGGG
TGGAGCCAAGAGCGGACGGATGAGGTGCTGGTGCCGGTGATCCGTGACATGAACAGGCGAGAGGCAGAAGGCACG
CAGAGCAATATCACGCAGTTCTTTGGAGGCGGTGTCGGGGCTGGCGCTAGGGAGGCGTTTGCGCCGAGGCAGAGG
GCCAGGGGGAGCAAGCGGATGGCGGCTGCGGTGGATAGGCTGAGGGCAAATGTTGCGGCTTCTGAAATCATCAAG
GCCGCCATGGACCAACGCGAGCTGGAGGCGCGCATCAAGGCGCTGACCAAGTCGGTCGCTGCGAACGAACCGGCC
GAGAATGCCATCAGGCTGCTGGATACGCTGAAGAAGGAGGCTGCTCCGACGGAGGAGATGTTACGAGCCACCCGC
GCCGGCGTCTACGTCGGCAAACTGCGTGCGAACCCCAACAAAGAAATCGCTCGAGCTGCTACGGAACTCGTCGTC
AAGTGGAAGAAACTCGTCGAGCAGGAAAAGAACTCCAAGATGCAAAAGGCAAAGAAGGGCTCCCCGGCTCTCCCC
GTGGCGTCGCCCCCGGCTGTGGCAGCAGCTCCCCTGGGCGCCAAGAAGGCCTTCGCCGGCGACCCAGAGAAGCGC
AAGTTCGACACGGACGGCATCGACATTAAGCGGACGGGCTCGACCCTTCGCGATCAGTGCATCGGACTCGTCTAC
AACGGCCTCGCCTTTCGCTCGACCGAGGCCCCCTCGGACGTCGTCTCCAAGGCCAGCGCCATCGAAAAGGCCGTG
CTCGAAATCTACGGCAGCCCCGAAAACGCAGATTACAAGAAGAAGATACGGTCTCTTTTTGCTAACCTCAAGAAC
AAGTCGAACCGGGAGCTCGGCCTGCGCGTCATGTCGGGCGACATAACGCCTGAGCAATTCGCCACCATGACCGAC
GAGGAACTCAAGAGCGAGGACCAGCGCAAGAAGGACCAGGAGCTCGAAAGGGAGAATATGAAGAAGGCGCAGGTG
CCCATGGCCGAGAAGAGCATCAGTGACAGCCTCGAGTGCGGCCGCTGTAAGAAGAAGCGCGTCAGCTACACGCAG
GCCCAGACACGGAGTGCCGACGAGCCCATGACGACCTTTTGCGAATGCATGGGTTGCGGTCACCGTTGGAAGTTC
TCGTGA
Gene >Ophun1|580
ATGGGTGTCAACGGACTCTGGACCGTCATCCAGCCCTGCGCGCGCCCAACGAACCTCGCCACCCTCAACCGCAAG
CGCCTCGCCGTCGATGCCTCCATTTGGATATATCAGTTTCTCAAGGCCGTGCGCGATAAGGAGGGCAATGCTCTA
CGGAACTCGCATATTGTCGGCTTCTTCCGCCGCATCTGCAAGCTCCTCTGGTACGGCATCTTGCCCGTCTTCATC
TTCGACGGTGGCGCCCCTGCCCTTAAGCGAGCCACCATTCAGAAGCGGCAGCGAAGACGAGAGGGTCGGCGGGAC
GATGCCGTTCGGACGGCGGGGAAACTGCTGGCGGTGCAGATGCAGCGTGCCGCCGTCGACGAGGAGGAACGACGC
AAGAGGGAGCTGGGCGGCGACGTTTCCGCTCGAGAGGCACTGCTGCAGCAAGAGGATGCCGCTGAATCCAGTGAT
CTCGTCTATCAGGCCGAGCTCAACATGTCGCAGCGGGAAAAGACACAATCCAGGCGCTTCTTCAAACAGGATGCC
TATCACCTACCCGAGCTCGATCGCGACATCGCCTCCATGGGCAAGCCCGAAGACCCGCGCATCATGAGCGTCGAA
GAGCTGGATGAATATGCGCGCCAGTTCAACGACGGTCAGGACATTAATCTCTACGACTTTAGCAAGATTGATTTT
GACGGCGACTTCTTCAAGAGCCTGCCGCCCGCGGATCGCTACAATATCCTCAATGCCGCGCGGTTGAGGAGCCGC
CTCAGGATGGGCTACAGCAAGGATCAGCTCGAGGAGATGTTTCCGGACCGCATGGCCTTTTCTAGGTTTCAGATT
GAGAGAGTCCGGGAACGAAATAACTTGACGCAGCGGCTCATGTTCGAGGTCGGCATGACGGACACGGATCTGACC
TTGCCGGTCAACGCGCGCATCGCCGGAGATAAAGATCGCGAGTACCTCCTAGTCAAGAACGAGGGCGCCGAAGGG
GGGTGGGCGTTGGGCGTTGTGAGCAAGGAAAAGGATATTGGGCAGGCTCACAAGCCCATCGACGTAGACGCTATC
CAGGTTCAATACCAAACCAAAGACGACGAGGAGGATGAAGACGAGGACGAAGACTTTGAGGACGTGCCGATAGAG
GGACTCAATCGCCTGCCGAAACCGAGGCTACCCGAGGCACCGAGCCAGCAGTTTGCGCAGGACATTGCGGCGGCT
AGACAGCATATCTATCTCGACAATCAGGTACGCGCTGCCGGGGAGGAGGCCAGTGGCGAGGGGTCTCTTTTCGTC
GGTGGCAACACTGGTGAGGCGAGTGCGATTCTTGAGAAAGATGCGGACCAGGAGTCGCGTCTCGATGAAGAGGAC
GATATCAACCAGGCCATCGCCTTGTCTTTGAGAAACCAGCACGAATTGGACGAGGAGCAAAGCAGGGGAGATGCA
CCCGATGAAGCACCCGATGAAGCATCCTCGAAAAAGCCGAAATGGACGCAAAGAGCTGCCGAGGCGTCGAGACCC
ATTCACGGAGCCAGCGGTTCCATGATCGCCCACGTTGTCAACAATCGATCCAACGCTGCGGTGAGACGTCGAGAC
GTCGAGGAAGAGGACAGTGACAGCGAGGACGATATGCAAACCGTTTTGGCTAGGGCCAGGAATGCGAAGCCTGCT
CCAGCAGAGCGCAGTGTTGCTGCGATGAGCAACGCTTTCGGTGGGCCACTTCCCTTTCCTAAACTCGACTGGAAA
ACCTCTGTCTTTGCCAGGAAAGACGCCCAACAAGATCAAGTCCCCAAGAGAGACGTTGCGCGAGAAGAGGCCGGA
GGAGCAGAAGAGGAGGGAGCAGAAGAGGAGACAGCAGCTGAAGTCGAGGGCGGCGGCTTTGAAGTTTCACCGCAA
AAGCAAGACGACGCTCCAAAGGAATTACCCCCTTGGTTGGCGGACGACACTGATATTAGGGAGTCTCTCAAGAAG
CAGCATGATGTGGAGAGAGAGATTAATGCTGAAGATAGGGAGGAGGCTGAGGAGGAGGAGCGACTGCAGCGGAAA
GAGATGGAGCGGCGGCTTATTGAGATCGAGTCTTCATCTGACGACGACGGCGATGTGGAAATCATCGAGGCACCC
TATTCGGCTAAGCGGCCTACTGGAGACCTCAACAGGGGGAAGCAATCTGTTGAAGATAGCTTTTCGACGGGAACT
GTCTCCGAAATCGAGCCAACGGAACCGCTGGAAACCGAGATGAACGACGCGAGGCATACAAGTGTTGCCAGTGCG
CAGGCGGATGCTTTGGTAGATGAGACGCCATCTTTGGTGGAGGGAAACCCGCCTCCAGCGGACGAAGCAGAGCCA
TCGGGAGAAAAGCCATCTCAAACAGAGGAGGATCTGTTCTCGGCATCGGCGTCGCCCGAACCCGTGTTTGAGGAC
GTTCCCGCGGCTGCTACGGCGACTGTCGTGCAGGAAGAACCCCTCCCAAATGGAGAGGATGTTTCGGACGACGAT
TTATTCGGGGACGCAGAGTCGGAGGACTTTAGCGAACCCGAAGACCAGGAGCTCATGATGCAGATGGCCGAAGAG
GCCGAAGAGCACGCCCGCTTCGCCAGCCAGCTGAACCAAAAGTCGGCGGCGCAAAACAAGGAGGACTACGAAAAG
GAGCTGCGAGCGCTGCGAAACCAACAGAAGAAGGACCGGCGAGACGCGGACGAGGTGACACAGGTCATGGTAGGC
GAGTGTCAAGCGCTACTCCGTCTCTTCGGCATCCCGTACGTGACGGCACCGATGGAGGCCGAGGCGCAGTGCGCG
GAGCTGGTCAGGCTGGGCATCGTCGACGGCATCGTCACCGACGACTCGGACACGTTTCTCTTTGGCGGCACGCGG
GTGTACAAGAACATGTTTAACAGCAACAAGTTTGTCGAGTGCTACCTGGGCGTCGATGTCGAAAAGGAACTGTCG
CTCTCGCGCGAGCAGCTGATTTCACTGGCTCAGCTGCTCGGATCCGACTACACCGAAGGCCTGTCGGGCGTGGGC
CCCGTCACGGCGGTCGAGATCCTATCCGAGTTCCCCGGAAGGGACGGGCTCGAGCATTTTCGGGAGTGGTGGACG
TCTGTACAGAGCCTGAGCCGGCCCAAAGAGGCGGACTCGTCGTCTCCTTTCCGCATCAAGTTCCGAAAGTCGCAG
GCCACCAAGCTCTTTCTGCCTCCGGGCTTCCCTTCCCAAGCGGTGTACGATGCCTATCAACATCCCGAGGTGGAC
GACAGCGCGGAACCGTTTCAATGGGGTGTTCCGGATTTACAAGGGCTGCGGCGCTTCCTCATGTCGACGATTGGG
TGGAGCCAAGAGCGGACGGATGAGGTGCTGGTGCCGGTGATCCGTGACATGAACAGGCGAGAGGCAGAAGGCACG
CAGAGCAATATCACGCAGTTCTTTGGAGGCGGTGTCGGGGCTGGCGCTAGGGAGGCGTTTGCGCCGAGGCAGAGG
GCCAGGGGGAGCAAGCGGATGGCGGCTGCGGTGGATAGGCTGAGGGCAAATGTTGCGGGTGAGAGTAGCAGGGAG
GAGGAGCGGGAGAGGCCGAGTAAGAGGAGGAAGAGGGCGGGGACGAGGAGAGGATCTCGGAGGGAGGAGGGTATT
GAGGAGGAGGAAGATGGGGAGCAAGAGGATGAGCAAGAGGATGAGCAAGAGGATGAGCAAGAGGATGAGCAAGAG
GATGAGGCAGAGTGAAGAGCGAGAGAGGTTGTCTCGGCGTGTTGTGATGGCCACTTTCAACAAGACTCTGAGAAT
ATTGAAAGAGATCCCGAATTGGAGCACCTTTAAAAGAGATGATCATGACGGTAAACACGCCTGATGTTTCAGCTG
TCAACAGCTAATGCCCCAACAGCCTCTACACTGCGAGAAGATGGACGACGTCGATGCTGCCAAGCCGCACCCCGG
GGTGAGGGCGGCTAAACCCCGGCCTCCCCCCACTCTTCCCCTCGGCGATTCTCATGCACGTGCGCAGCGGTGCCT
GGAAGCTTCATCCAACCCCCGAAACCTCAGCTTCTGAAATCATCAAGGCCGCCATGGACCAACGCGAGCTGGAGG
CGCGCATCAAGGCGCTGACCAAGTCGGTCGCTGCGAACGAACCGGCCGAGAATGCCATCAGGCTGCTGGATACGC
TGAAGAAGGAGGCTGCTCCGACGGAGGAGATGTTACGAGTGAGTCACCCCTCTTTCCTGATGATTTCGAAACGAG
AAGCTTGGCTTTGGATGCGGTCACGATGGACGTTTGTTTGCTCTTTCGTTCTTGATCCCTATCGCATTCGTCTCC
TTCCCTATGAGTACGGACTGTTTGCTGACGAGCCGACGTCGTTCTTCTAGGCCACCCGCGCCGGCGTCTACGTCG
GCAAACTGCGTGCGAACCCCAACAAAGAAATCGCTCGAGCTGCTACGGAACTCGTCGTCAAGTGGAAGAAACTCG
TCGAGCAGGAAAAGAACTCCAAGATGCAAAAGGCAAAGAAGGGCTCCCCGGCTCTCCCCGTGGCGTCGCCCCCGG
CTGTGGCAGCAGCTCCCCTGGGCGCCAAGAAGGCCTTCGCCGGCGACCCAGAGAAGCGCAAGTTCGACACGGACG
GCATCGACATTAAGCGGACGGGCTCGACCCTTCGCGATCAGTGCATCGGACTCGTCTACAACGGCCTCGCCTTTC
GCTCGACCGAGGCCCCCTCGGACGTCGTCTCCAAGGCCAGCGCCATCGAAAAGGCCGTGCTCGAAATCTACGGCA
GCCCCGAAAACGCAGATTACAAGAAGAAGATACGGTCTCTTTTTGCTAACCTCAAGAACAAGTCGAACCGGGAGC
TCGGCCTGCGCGTCATGTCGGGCGACATAACGCCTGAGCAATTCGCCACCATGACCGACGAGGAACTCAAGAGCG
AGGACCAGCGCAAGAAGGACCAGGAGCTCGAAAGGGAGAATATGAAGAAGGCGCAGGTGCCCATGGCCGAGAAGA
GCATCAGTGACAGCCTCGAGTGCGGCCGCTGTAAGAAGAAGCGCGTCAGCTACACGCAGGCCCAGACACGGAGTG
CCGACGAGCCCATGACGACCTTTTGCGAATGCATGGGTTGCGGTCACCGTTGGAAGGTGAGCGGCATTATTGAAG
GATACTGGCTGCGCTTCTACTGACACGCCATCTTTCCACGCAGTTCTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail