Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|579
Gene name
LocationContig_118:20948..21335
Strand-
Gene length (bp)387
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01423 LSM LSM domain 5.7E-11 9 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GQ67|LMD1A_XENLA N-alpha-acetyltransferase 38-A, NatC auxiliary subunit OS=Xenopus laevis GN=naa38-a PE=3 SV=1 2 91 3.0E-15
sp|A4IGZ4|LSMD1_XENTR N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Xenopus tropicalis GN=naa38 PE=3 SV=2 4 91 3.0E-15
sp|Q6NU60|LMD1B_XENLA N-alpha-acetyltransferase 38-B, NatC auxiliary subunit OS=Xenopus laevis GN=naa38-b PE=3 SV=1 4 91 6.0E-15
sp|Q9BRA0|LSMD1_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens GN=NAA38 PE=1 SV=1 4 92 8.0E-15
sp|Q9D2U5|LSMD1_MOUSE N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Mus musculus GN=Naa38 PE=1 SV=1 6 92 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6GQ67|LMD1A_XENLA N-alpha-acetyltransferase 38-A, NatC auxiliary subunit OS=Xenopus laevis GN=naa38-a PE=3 SV=1 2 91 3.0E-15
sp|A4IGZ4|LSMD1_XENTR N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Xenopus tropicalis GN=naa38 PE=3 SV=2 4 91 3.0E-15
sp|Q6NU60|LMD1B_XENLA N-alpha-acetyltransferase 38-B, NatC auxiliary subunit OS=Xenopus laevis GN=naa38-b PE=3 SV=1 4 91 6.0E-15
sp|Q9BRA0|LSMD1_HUMAN N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Homo sapiens GN=NAA38 PE=1 SV=1 4 92 8.0E-15
sp|Q9D2U5|LSMD1_MOUSE N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Mus musculus GN=Naa38 PE=1 SV=1 6 92 1.0E-14
sp|A2BIG9|LSMD1_DANRE N-alpha-acetyltransferase 38, NatC auxiliary subunit OS=Danio rerio GN=naa38 PE=3 SV=1 6 91 2.0E-13
sp|P91918|RSMB_CAEEL Probable small nuclear ribonucleoprotein-associated protein B OS=Caenorhabditis elegans GN=snr-2 PE=3 SV=1 14 106 8.0E-10
sp|Q10163|RSMB_SCHPO Small nuclear ribonucleoprotein-associated protein B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=smb1 PE=1 SV=1 6 104 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1902
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2759
Ophiocordyceps australis map64 (Brazil) OphauB2|4422
Ophiocordyceps camponoti-floridani Ophcf2|03375
Ophiocordyceps camponoti-rufipedis Ophun1|579 (this protein)
Ophiocordyceps kimflemingae Ophio5|797
Ophiocordyceps subramaniannii Hirsu2|199

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|579
MEPDEATAYLKSLLNKNLRIITTDGRLFWGAFKCTDANQNVVLSHTYEYRQPVSAHGSASHEPPARMDVSAARYL
GLVVVPGHHIVRMELEKFVSQMKATPPQDYDRSLII*
Coding >Ophun1|579
ATGGAACCCGACGAGGCAACTGCTTACCTCAAGTCCCTTCTCAACAAGAACCTCCGGATCATCACCACAGACGGG
CGTCTCTTCTGGGGCGCCTTCAAATGCACCGACGCCAACCAAAACGTCGTCCTGTCCCATACGTATGAGTATCGA
CAGCCGGTGTCCGCCCATGGCTCAGCCTCTCACGAGCCTCCTGCCCGGATGGATGTTTCGGCTGCGCGCTATCTC
GGTCTTGTCGTCGTCCCGGGCCACCATATCGTCCGCATGGAGCTGGAGAAGTTTGTGAGCCAGATGAAGGCGACG
CCACCACAAGACTACGACAGAAGTCTCATCATATAG
Transcript >Ophun1|579
ATGGAACCCGACGAGGCAACTGCTTACCTCAAGTCCCTTCTCAACAAGAACCTCCGGATCATCACCACAGACGGG
CGTCTCTTCTGGGGCGCCTTCAAATGCACCGACGCCAACCAAAACGTCGTCCTGTCCCATACGTATGAGTATCGA
CAGCCGGTGTCCGCCCATGGCTCAGCCTCTCACGAGCCTCCTGCCCGGATGGATGTTTCGGCTGCGCGCTATCTC
GGTCTTGTCGTCGTCCCGGGCCACCATATCGTCCGCATGGAGCTGGAGAAGTTTGTGAGCCAGATGAAGGCGACG
CCACCACAAGACTACGACAGAAGTCTCATCATATAG
Gene >Ophun1|579
ATGGAACCCGACGAGGCAACTGCTTACCTCAAGTCCCTTCTCAACAAGAACCTCCGGATCATCACCACAGACGGG
CGTCTCTTCTGGGGCGCCTTCAAATGCACCGACGCCGTTCGTCATCCGAATCTCCCGTCGTCGTTGGCGCGCAGC
TGAACCGAACAGAACCAAAACGTCGTCCTGTCCCATACGTATGAGTATCGACAGCCGGTGTCCGCCCATGGCTCA
GCCTCTCACGAGCCTCCTGCCCGGATGGATGTTTCGGCTGCGCGCTATCTCGGTCTTGTCGTCGTCCCGGGCCAC
CATATCGTCCGCATGGAGCTGGAGAAGTTTGTGAGCCAGATGAAGGCGACGCCACCACAAGACTACGACAGAAGT
CTCATCATATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail