Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5789
Gene name
LocationContig_596:2539..5078
Strand-
Gene length (bp)2539
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00307 CH Calponin homology (CH) domain 6.3E-21 170 274
PF00307 CH Calponin homology (CH) domain 4.8E-22 284 389
PF08726 EFhand_Ca_insen Ca2+ insensitive EF hand 4.2E-26 713 782
PF11971 CAMSAP_CH CAMSAP CH domain 1.8E-07 295 369

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13728|AIN1_SCHPO Alpha-actinin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ain1 PE=3 SV=1 166 788 0.0E+00
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 167 521 6.0E-88
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 167 541 2.0E-79
sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 167 541 3.0E-79
sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 167 541 3.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13728|AIN1_SCHPO Alpha-actinin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ain1 PE=3 SV=1 166 788 0.0E+00
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 167 521 6.0E-88
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 167 541 2.0E-79
sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 167 541 3.0E-79
sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 167 541 3.0E-79
sp|P05094|ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus GN=ACTN1 PE=1 SV=3 167 541 3.0E-79
sp|Q9Z1P2|ACTN1_RAT Alpha-actinin-1 OS=Rattus norvegicus GN=Actn1 PE=1 SV=1 167 541 4.0E-79
sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus GN=Actn1 PE=1 SV=1 167 541 7.0E-79
sp|Q3ZC55|ACTN2_BOVIN Alpha-actinin-2 OS=Bos taurus GN=ACTN2 PE=2 SV=1 167 541 2.0E-78
sp|Q9JI91|ACTN2_MOUSE Alpha-actinin-2 OS=Mus musculus GN=Actn2 PE=1 SV=2 167 541 2.0E-78
sp|Q08043|ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 167 606 3.0E-78
sp|P35609|ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 167 541 3.0E-78
sp|P20111|ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus GN=ACTN2 PE=2 SV=1 167 541 4.0E-78
sp|Q0III9|ACTN3_BOVIN Alpha-actinin-3 OS=Bos taurus GN=ACTN3 PE=2 SV=1 167 606 5.0E-78
sp|O88990|ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus GN=Actn3 PE=2 SV=1 167 541 1.0E-77
sp|A5D7D1|ACTN4_BOVIN Alpha-actinin-4 OS=Bos taurus GN=ACTN4 PE=2 SV=1 167 541 1.0E-77
sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus GN=Actn4 PE=1 SV=1 167 541 1.0E-77
sp|Q9QXQ0|ACTN4_RAT Alpha-actinin-4 OS=Rattus norvegicus GN=Actn4 PE=1 SV=2 167 541 1.0E-77
sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 167 541 4.0E-77
sp|Q90734|ACTN4_CHICK Alpha-actinin-4 OS=Gallus gallus GN=ACTN4 PE=1 SV=1 167 541 8.0E-77
sp|Q5RCS6|ACTN4_PONAB Alpha-actinin-4 OS=Pongo abelii GN=ACTN4 PE=2 SV=1 167 541 8.0E-77
sp|Q01082|SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2 170 540 9.0E-75
sp|Q62261|SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus GN=Sptbn1 PE=1 SV=2 170 540 1.0E-74
sp|Q00963|SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster GN=beta-Spec PE=1 SV=2 169 525 2.0E-74
sp|P15508|SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus GN=Sptb PE=1 SV=4 169 536 3.0E-74
sp|P11277|SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5 169 540 4.0E-73
sp|Q9QWN8|SPTN2_RAT Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus GN=Sptbn2 PE=1 SV=2 169 529 8.0E-73
sp|Q7PKQ5|ACTN_ANOGA Alpha-actinin, sarcomeric OS=Anopheles gambiae GN=Actn PE=3 SV=2 167 526 3.0E-72
sp|O15020|SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3 169 529 3.0E-72
sp|P18091|ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster GN=Actn PE=1 SV=2 167 526 8.0E-72
sp|Q9H254|SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2 169 543 1.0E-70
sp|Q9NRC6|SPTN5_HUMAN Spectrin beta chain, non-erythrocytic 5 OS=Homo sapiens GN=SPTBN5 PE=1 SV=2 164 518 1.0E-59
sp|Q9QXZ0|MACF1_MOUSE Microtubule-actin cross-linking factor 1 OS=Mus musculus GN=Macf1 PE=1 SV=2 115 551 2.0E-56
sp|D3ZHV2|MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus GN=Macf1 PE=1 SV=1 115 551 5.0E-56
sp|Q9UPN3|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4 115 551 2.0E-55
sp|Q03001|DYST_HUMAN Dystonin OS=Homo sapiens GN=DST PE=1 SV=4 170 564 5.0E-55
sp|Q91ZU6|DYST_MOUSE Dystonin OS=Mus musculus GN=Dst PE=1 SV=2 170 564 5.0E-54
sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 170 510 7.0E-53
sp|P30427|PLEC_RAT Plectin OS=Rattus norvegicus GN=Plec PE=1 SV=2 170 510 1.0E-51
sp|Q9QXS1|PLEC_MOUSE Plectin OS=Mus musculus GN=Plec PE=1 SV=3 170 510 3.0E-51
sp|Q54HG2|CTXA_DICDI Cortexillin-1 OS=Dictyostelium discoideum GN=ctxA PE=1 SV=1 167 392 1.0E-47
sp|P13466|GELA_DICDI Gelation factor OS=Dictyostelium discoideum GN=abpC PE=1 SV=1 165 384 1.0E-47
sp|Q9Y0T4|CTXA_POLPA Cortexillin-1 OS=Polysphondylium pallidum GN=ctxA PE=3 SV=1 167 395 2.0E-45
sp|Q550R2|CTXB_DICDI Cortexillin-2 OS=Dictyostelium discoideum GN=ctxB PE=1 SV=1 165 426 4.0E-44
sp|Q9JI55|PLEC_CRIGR Plectin (Fragment) OS=Cricetulus griseus GN=PLEC PE=1 SV=1 199 510 4.0E-44
sp|P11533|DMD_CHICK Dystrophin OS=Gallus gallus GN=DMD PE=2 SV=1 170 402 5.0E-42
sp|Q9Y0T3|CTXB_POLPA Cortexillin-2 OS=Polysphondylium pallidum GN=ctxB PE=3 SV=1 164 438 1.0E-41
sp|Q8NF91|SYNE1_HUMAN Nesprin-1 OS=Homo sapiens GN=SYNE1 PE=1 SV=4 170 399 2.0E-41
sp|Q6ZWR6|SYNE1_MOUSE Nesprin-1 OS=Mus musculus GN=Syne1 PE=1 SV=2 170 388 2.0E-40
sp|O76329|ACTNB_DICDI Interaptin OS=Dictyostelium discoideum GN=abpD PE=1 SV=1 167 390 3.0E-40
sp|Q8WXH0|SYNE2_HUMAN Nesprin-2 OS=Homo sapiens GN=SYNE2 PE=1 SV=3 170 386 2.0E-39
sp|Q96JQ2|CLMN_HUMAN Calmin OS=Homo sapiens GN=CLMN PE=1 SV=1 170 392 8.0E-39
sp|P11532|DMD_HUMAN Dystrophin OS=Homo sapiens GN=DMD PE=1 SV=3 170 395 2.0E-38
sp|Q6ZWQ0|SYNE2_MOUSE Nesprin-2 OS=Mus musculus GN=Syne2 PE=1 SV=2 155 385 4.0E-38
sp|Q8C5W0|CLMN_MOUSE Calmin OS=Mus musculus GN=Clmn PE=1 SV=2 170 406 4.0E-38
sp|P11530|DMD_RAT Dystrophin OS=Rattus norvegicus GN=Dmd PE=1 SV=2 170 402 5.0E-38
sp|P46939|UTRO_HUMAN Utrophin OS=Homo sapiens GN=UTRN PE=1 SV=2 170 404 7.0E-38
sp|P11531|DMD_MOUSE Dystrophin OS=Mus musculus GN=Dmd PE=1 SV=3 170 395 7.0E-38
sp|O97592|DMD_CANLF Dystrophin OS=Canis lupus familiaris GN=DMD PE=2 SV=1 170 395 1.0E-37
sp|Q5GN48|DMD_PIG Dystrophin OS=Sus scrofa GN=DMD PE=1 SV=1 170 395 1.0E-37
sp|Q7PKQ5|ACTN_ANOGA Alpha-actinin, sarcomeric OS=Anopheles gambiae GN=Actn PE=3 SV=2 493 787 1.0E-34
sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/F/G/H OS=Drosophila melanogaster GN=Dys PE=1 SV=3 170 391 2.0E-34
sp|P18091|ACTN_DROME Alpha-actinin, sarcomeric OS=Drosophila melanogaster GN=Actn PE=1 SV=2 493 787 3.0E-34
sp|Q9VEN1|FLNA_DROME Filamin-A OS=Drosophila melanogaster GN=cher PE=1 SV=2 161 384 6.0E-34
sp|Q8VHX6|FLNC_MOUSE Filamin-C OS=Mus musculus GN=Flnc PE=1 SV=3 137 382 8.0E-34
sp|D3ZHA0|FLNC_RAT Filamin-C OS=Rattus norvegicus GN=Flnc PE=1 SV=1 137 382 2.0E-33
sp|Q14315|FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 161 382 8.0E-33
sp|Q8BTM8|FLNA_MOUSE Filamin-A OS=Mus musculus GN=Flna PE=1 SV=5 161 382 2.0E-32
sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 161 382 3.0E-32
sp|O75369|FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 161 382 2.0E-31
sp|Q80X90|FLNB_MOUSE Filamin-B OS=Mus musculus GN=Flnb PE=1 SV=3 161 382 3.0E-31
sp|Q9JI91|ACTN2_MOUSE Alpha-actinin-2 OS=Mus musculus GN=Actn2 PE=1 SV=2 468 787 3.0E-30
sp|P35609|ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 468 787 5.0E-29
sp|Q3ZC55|ACTN2_BOVIN Alpha-actinin-2 OS=Bos taurus GN=ACTN2 PE=2 SV=1 468 787 9.0E-29
sp|Q90734|ACTN4_CHICK Alpha-actinin-4 OS=Gallus gallus GN=ACTN4 PE=1 SV=1 440 787 5.0E-28
sp|P20111|ACTN2_CHICK Alpha-actinin-2 OS=Gallus gallus GN=ACTN2 PE=2 SV=1 468 787 6.0E-28
sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus GN=ACTN1 PE=2 SV=1 507 787 9.0E-28
sp|Q7TPR4|ACTN1_MOUSE Alpha-actinin-1 OS=Mus musculus GN=Actn1 PE=1 SV=1 507 787 1.0E-27
sp|P12814|ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 507 787 2.0E-27
sp|Q2PFV7|ACTN1_MACFA Alpha-actinin-1 OS=Macaca fascicularis GN=ACTN1 PE=2 SV=1 507 787 2.0E-27
sp|P05094|ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus GN=ACTN1 PE=1 SV=3 507 787 2.0E-27
sp|Q9Z1P2|ACTN1_RAT Alpha-actinin-1 OS=Rattus norvegicus GN=Actn1 PE=1 SV=1 507 787 2.0E-27
sp|Q9QXQ0|ACTN4_RAT Alpha-actinin-4 OS=Rattus norvegicus GN=Actn4 PE=1 SV=2 488 787 2.0E-27
sp|P57780|ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus GN=Actn4 PE=1 SV=1 488 787 5.0E-27
sp|O43707|ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 488 787 6.0E-27
sp|Q5RCS6|ACTN4_PONAB Alpha-actinin-4 OS=Pongo abelii GN=ACTN4 PE=2 SV=1 488 787 6.0E-27
sp|P05095|ACTNA_DICDI Alpha-actinin A OS=Dictyostelium discoideum GN=abpA PE=1 SV=2 498 782 2.0E-26
sp|A5D7D1|ACTN4_BOVIN Alpha-actinin-4 OS=Bos taurus GN=ACTN4 PE=2 SV=1 488 787 2.0E-26
sp|O88990|ACTN3_MOUSE Alpha-actinin-3 OS=Mus musculus GN=Actn3 PE=2 SV=1 469 787 3.0E-26
sp|Q0III9|ACTN3_BOVIN Alpha-actinin-3 OS=Bos taurus GN=ACTN3 PE=2 SV=1 469 787 4.0E-26
sp|Q8N3F8|MILK1_HUMAN MICAL-like protein 1 OS=Homo sapiens GN=MICALL1 PE=1 SV=2 289 388 4.0E-24
sp|E1BBG2|MILK1_BOVIN MICAL-like protein 1 OS=Bos taurus GN=MICALL1 PE=1 SV=2 289 389 8.0E-24
sp|Q08043|ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 469 787 2.0E-23
sp|D3ZQL6|MILK1_RAT MICAL-like protein 1 OS=Rattus norvegicus GN=Micall1 PE=1 SV=1 289 389 2.0E-23
sp|Q8BGT6|MILK1_MOUSE MICAL-like protein 1 OS=Mus musculus GN=Micall1 PE=1 SV=3 289 389 2.0E-23
sp|Q8CJ19|MICA3_MOUSE Protein-methionine sulfoxide oxidase MICAL3 OS=Mus musculus GN=Mical3 PE=1 SV=2 226 388 4.0E-22
sp|D3ZEN0|MILK2_RAT MICAL-like protein 2 OS=Rattus norvegicus GN=Micall2 PE=1 SV=2 283 388 7.0E-22
sp|Q3TN34|MILK2_MOUSE MICAL-like protein 2 OS=Mus musculus GN=Micall2 PE=1 SV=1 283 388 9.0E-22
sp|Q7RTP6|MICA3_HUMAN Protein-methionine sulfoxide oxidase MICAL3 OS=Homo sapiens GN=MICAL3 PE=1 SV=2 226 388 3.0E-21
sp|Q2KN93|CYTSA_DANRE Cytospin-A OS=Danio rerio GN=specc1la PE=2 SV=2 280 388 3.0E-21
sp|G3MWR8|MICA3_BOVIN Protein-methionine sulfoxide oxidase MICAL3 OS=Bos taurus GN=MICAL3 PE=3 SV=1 226 388 9.0E-21
sp|Q2KNA0|CYTSA_CANLF Cytospin-A OS=Canis lupus familiaris GN=SPECC1L PE=2 SV=1 280 388 1.0E-20
sp|Q8IY33|MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens GN=MICALL2 PE=1 SV=1 283 388 1.0E-20
sp|Q2KN96|CYTSA_XENTR Cytospin-A OS=Xenopus tropicalis GN=specc1l PE=2 SV=1 280 388 1.0E-20
sp|Q2KN94|CYTSA_TAKRU Cytospin-A OS=Takifugu rubripes GN=specc1l PE=2 SV=1 280 388 2.0E-20
sp|Q2KNA1|CYTSA_PANTR Cytospin-A OS=Pan troglodytes GN=SPECC1L PE=2 SV=1 280 388 3.0E-20
sp|F1QH17|MCA3A_DANRE Protein-methionine sulfoxide oxidase mical3a OS=Danio rerio GN=mical3a PE=2 SV=2 281 388 3.0E-20
sp|Q69YQ0|CYTSA_HUMAN Cytospin-A OS=Homo sapiens GN=SPECC1L PE=1 SV=2 280 388 3.0E-20
sp|Q2KN97|CYTSA_CHICK Cytospin-A OS=Gallus gallus GN=SPECC1L PE=2 SV=2 280 388 8.0E-20
sp|Q2KN98|CYTSA_MOUSE Cytospin-A OS=Mus musculus GN=Specc1l PE=1 SV=1 280 388 8.0E-20
sp|Q2KN95|CYTSA_TETNG Cytospin-A OS=Tetraodon nigroviridis GN=specc1l PE=2 SV=1 280 388 1.0E-19
sp|Q2KN99|CYTSA_RAT Cytospin-A OS=Rattus norvegicus GN=Specc1l PE=1 SV=1 280 388 3.0E-19
sp|Q13813|SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3 477 778 1.0E-18
sp|P16546|SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus GN=Sptan1 PE=1 SV=4 477 778 1.0E-18
sp|P16086|SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus GN=Sptan1 PE=1 SV=2 477 778 1.0E-18
sp|Q5M775|CYTSB_HUMAN Cytospin-B OS=Homo sapiens GN=SPECC1 PE=1 SV=1 280 388 2.0E-18
sp|Q9N4M4|ANC1_CAEEL Nuclear anchorage protein 1 OS=Caenorhabditis elegans GN=anc-1 PE=1 SV=3 171 275 2.0E-18
sp|P07751|SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus GN=SPTAN1 PE=1 SV=3 477 778 3.0E-18
sp|P13395|SPTCA_DROME Spectrin alpha chain OS=Drosophila melanogaster GN=alpha-Spec PE=1 SV=2 477 778 5.0E-18
sp|Q2KI85|SMTL2_BOVIN Smoothelin-like protein 2 OS=Bos taurus GN=SMTNL2 PE=2 SV=1 284 392 6.0E-18
sp|O94851|MICA2_HUMAN Protein-methionine sulfoxide oxidase MICAL2 OS=Homo sapiens GN=MICAL2 PE=1 SV=1 289 388 9.0E-18
sp|Q8CI12|SMTL2_MOUSE Smoothelin-like protein 2 OS=Mus musculus GN=Smtnl2 PE=1 SV=1 284 392 1.0E-17
sp|Q8NDI1|EHBP1_HUMAN EH domain-binding protein 1 OS=Homo sapiens GN=EHBP1 PE=1 SV=3 284 392 2.0E-17
sp|F1MF74|MICA2_BOVIN Protein-methionine sulfoxide oxidase MICAL2 OS=Bos taurus GN=MICAL2 PE=3 SV=2 282 388 3.0E-17
sp|A8MU46|SMTL1_HUMAN Smoothelin-like protein 1 OS=Homo sapiens GN=SMTNL1 PE=1 SV=1 289 390 3.0E-17
sp|F6QZ15|MICA2_XENTR Protein-methionine sulfoxide oxidase mical2 OS=Xenopus tropicalis GN=mical2 PE=3 SV=1 289 388 4.0E-17
sp|Q5SXY1|CYTSB_MOUSE Cytospin-B OS=Mus musculus GN=Specc1 PE=1 SV=2 280 388 4.0E-17
sp|Q69ZW3|EHBP1_MOUSE EH domain-binding protein 1 OS=Mus musculus GN=Ehbp1 PE=1 SV=3 284 392 5.0E-17
sp|Q2TAL5|SMTL2_HUMAN Smoothelin-like protein 2 OS=Homo sapiens GN=SMTNL2 PE=2 SV=1 284 392 6.0E-17
sp|P02549|SPTA1_HUMAN Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens GN=SPTA1 PE=1 SV=5 491 778 6.0E-17
sp|F1RA39|MCA2B_DANRE Protein-methionine sulfoxide oxidase mical2b OS=Danio rerio GN=mical2b PE=2 SV=2 289 388 1.0E-16
sp|Q8BML1|MICA2_MOUSE Protein-methionine sulfoxide oxidase MICAL2 OS=Mus musculus GN=Mical2 PE=1 SV=1 289 388 2.0E-16
sp|D4A1F2|MICA2_RAT Protein-methionine sulfoxide oxidase MICAL2 OS=Rattus norvegicus GN=Mical2 PE=3 SV=1 289 388 3.0E-16
sp|Q99LM3|SMTL1_MOUSE Smoothelin-like protein 1 OS=Mus musculus GN=Smtnl1 PE=1 SV=1 289 390 4.0E-16
sp|E7F9T0|MICA1_DANRE Protein-methionine sulfoxide oxidase mical1 OS=Danio rerio GN=mical1 PE=3 SV=1 287 390 9.0E-16
sp|Q921U8|SMTN_MOUSE Smoothelin OS=Mus musculus GN=Smtn PE=1 SV=2 273 392 3.0E-15
sp|Q8N3D4|EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens GN=EHBP1L1 PE=1 SV=2 283 398 8.0E-15
sp|P53814|SMTN_HUMAN Smoothelin OS=Homo sapiens GN=SMTN PE=1 SV=7 273 392 1.0E-14
sp|Q99MS7|EH1L1_MOUSE EH domain-binding protein 1-like protein 1 OS=Mus musculus GN=Ehbp1l1 PE=1 SV=1 283 409 2.0E-14
sp|Q9N4M4|ANC1_CAEEL Nuclear anchorage protein 1 OS=Caenorhabditis elegans GN=anc-1 PE=1 SV=3 305 390 3.0E-14
sp|F1QWK4|MCA3B_DANRE Protein-methionine sulfoxide oxidase mical3b OS=Danio rerio GN=mical3b PE=3 SV=2 244 382 3.0E-14
sp|P08032|SPTA1_MOUSE Spectrin alpha chain, erythrocytic 1 OS=Mus musculus GN=Spta1 PE=1 SV=3 491 778 9.0E-14
sp|Q75JP5|Y2471_DICDI Calponin homology domain-containing protein DDB_G0272472 OS=Dictyostelium discoideum GN=DDB_G0272472 PE=3 SV=1 282 388 2.0E-13
sp|Q5TZ18|NAV3_DANRE Neuron navigator 3 OS=Danio rerio GN=nav3 PE=3 SV=1 173 269 1.0E-12
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 167 276 2.0E-12
sp|Q8IVL1|NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens GN=NAV2 PE=1 SV=3 175 269 5.0E-12
sp|Q7G188|FIMB1_ARATH Fimbrin-1 OS=Arabidopsis thaliana GN=FIM1 PE=1 SV=2 172 384 7.0E-12
sp|Q8IVL0|NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens GN=NAV3 PE=1 SV=3 173 269 8.0E-12
sp|Q80TN7|NAV3_MOUSE Neuron navigator 3 OS=Mus musculus GN=Nav3 PE=1 SV=2 173 269 9.0E-12
sp|F1MH07|MICA1_BOVIN Protein-methionine sulfoxide oxidase MICAL1 OS=Bos taurus GN=MICAL1 PE=2 SV=1 283 388 9.0E-11
sp|Q8VDP3|MICA1_MOUSE Protein-methionine sulfoxide oxidase MICAL1 OS=Mus musculus GN=Mical1 PE=1 SV=1 282 388 1.0E-10
sp|Q8TDZ2|MICA1_HUMAN Protein-methionine sulfoxide oxidase MICAL1 OS=Homo sapiens GN=MICAL1 PE=1 SV=2 286 391 1.0E-10
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 171 384 3.0E-10
sp|Q155Q3|DIXC1_HUMAN Dixin OS=Homo sapiens GN=DIXDC1 PE=1 SV=2 161 273 7.0E-10
sp|D3ZBP4|MICA1_RAT Protein-methionine sulfoxide oxidase MICAL1 OS=Rattus norvegicus GN=Mical1 PE=1 SV=1 282 388 7.0E-10
sp|P62285|ASPM_BOVIN Abnormal spindle-like microcephaly-associated protein homolog (Fragment) OS=Bos taurus GN=ASPM PE=2 SV=1 187 402 1.0E-09
sp|Q2VUH7|DIXC1_RAT Dixin OS=Rattus norvegicus GN=Dixdc1 PE=2 SV=1 171 273 1.0E-09
sp|Q9TW65|DMD_CAEEL Dystrophin-1 OS=Caenorhabditis elegans GN=dys-1 PE=1 SV=2 237 395 2.0E-09
sp|P62297|ASPM_SHEEP Abnormal spindle-like microcephaly-associated protein homolog (Fragment) OS=Ovis aries GN=ASPM PE=2 SV=1 187 402 2.0E-09
sp|Q8CJ27|ASPM_MOUSE Abnormal spindle-like microcephaly-associated protein homolog OS=Mus musculus GN=Aspm PE=2 SV=2 187 402 2.0E-09
sp|O50064|FIMB2_ARATH Fimbrin-2 OS=Arabidopsis thaliana GN=FIM2 PE=2 SV=1 116 384 4.0E-09
sp|P32599|FIMB_YEAST Fimbrin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC6 PE=1 SV=1 171 382 7.0E-09
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 171 384 9.0E-09
sp|Q9FJ70|FIMB3_ARATH Fimbrin-3 OS=Arabidopsis thaliana GN=FIM3 PE=3 SV=1 172 384 2.0E-08
sp|Q61233|PLSL_MOUSE Plastin-2 OS=Mus musculus GN=Lcp1 PE=1 SV=4 133 396 2.0E-08
sp|P13796|PLSL_HUMAN Plastin-2 OS=Homo sapiens GN=LCP1 PE=1 SV=6 133 396 7.0E-08
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 639 783 8.0E-08
sp|A7E3Q8|PLST_BOVIN Plastin-3 OS=Bos taurus GN=PLS3 PE=2 SV=1 169 382 1.0E-07
sp|Q6P698|PLSL_DANRE Plastin-2 OS=Danio rerio GN=lcp1 PE=2 SV=1 133 396 1.0E-07
sp|Q9FKI0|FIMB5_ARATH Fimbrin-5 OS=Arabidopsis thaliana GN=FIM5 PE=1 SV=1 192 368 2.0E-07
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 640 783 2.0E-07
sp|P13797|PLST_HUMAN Plastin-3 OS=Homo sapiens GN=PLS3 PE=1 SV=4 169 382 2.0E-07
sp|Q99K51|PLST_MOUSE Plastin-3 OS=Mus musculus GN=Pls3 PE=1 SV=3 169 382 2.0E-07
sp|Q9SJ84|FIMB4_ARATH Fimbrin-4 OS=Arabidopsis thaliana GN=FIM4 PE=3 SV=1 192 328 3.0E-07
sp|A7E3Q8|PLST_BOVIN Plastin-3 OS=Bos taurus GN=PLS3 PE=2 SV=1 125 327 3.0E-07
sp|P13797|PLST_HUMAN Plastin-3 OS=Homo sapiens GN=PLS3 PE=1 SV=4 125 327 3.0E-07
sp|Q99K51|PLST_MOUSE Plastin-3 OS=Mus musculus GN=Pls3 PE=1 SV=3 125 327 3.0E-07
sp|O88818|PLST_CRIGR Plastin-3 OS=Cricetulus griseus GN=PLS3 PE=2 SV=3 125 327 3.0E-07
sp|O88818|PLST_CRIGR Plastin-3 OS=Cricetulus griseus GN=PLS3 PE=2 SV=3 169 382 3.0E-07
sp|P19179|PLSI_CHICK Plastin-1 OS=Gallus gallus GN=PLS1 PE=1 SV=1 129 335 3.0E-07
sp|Q63598|PLST_RAT Plastin-3 OS=Rattus norvegicus GN=Pls3 PE=1 SV=2 125 327 3.0E-07
sp|P13796|PLSL_HUMAN Plastin-2 OS=Homo sapiens GN=LCP1 PE=1 SV=6 169 286 4.0E-07
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 640 783 4.0E-07
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 640 783 4.0E-07
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 640 783 4.0E-07
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 640 782 4.0E-07
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 640 753 6.0E-07
sp|A6H742|PLSI_BOVIN Plastin-1 OS=Bos taurus GN=PLS1 PE=2 SV=1 129 327 6.0E-07
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 640 782 6.0E-07
sp|Q1ZXE2|Y7875_DICDI PH domain-containing protein DDB_G0287875 OS=Dictyostelium discoideum GN=DDB_G0287875 PE=2 SV=1 174 392 9.0E-07
sp|Q6P698|PLSL_DANRE Plastin-2 OS=Danio rerio GN=lcp1 PE=2 SV=1 169 339 1.0E-06
sp|Q63598|PLST_RAT Plastin-3 OS=Rattus norvegicus GN=Pls3 PE=1 SV=2 169 382 1.0E-06
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 640 782 1.0E-06
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 640 782 1.0E-06
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 636 784 1.0E-06
sp|Q7G188|FIMB1_ARATH Fimbrin-1 OS=Arabidopsis thaliana GN=FIM1 PE=1 SV=2 193 393 2.0E-06
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 630 782 2.0E-06
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 640 783 2.0E-06
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 640 753 2.0E-06
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 640 784 2.0E-06
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 639 753 2.0E-06
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 640 782 2.0E-06
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 640 784 2.0E-06
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 640 784 2.0E-06
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 640 784 2.0E-06
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 637 783 3.0E-06
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 640 784 3.0E-06
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 640 782 3.0E-06
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 639 784 3.0E-06
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 638 784 3.0E-06
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 640 784 3.0E-06
sp|Q61233|PLSL_MOUSE Plastin-2 OS=Mus musculus GN=Lcp1 PE=1 SV=4 169 382 4.0E-06
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 640 784 4.0E-06
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 640 784 4.0E-06
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 640 784 4.0E-06
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 640 782 4.0E-06
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 640 784 4.0E-06
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 640 782 4.0E-06
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 640 782 4.0E-06
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 640 782 4.0E-06
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 640 782 4.0E-06
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 640 782 4.0E-06
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 640 782 4.0E-06
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 637 783 5.0E-06
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 638 761 5.0E-06
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 640 784 5.0E-06
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 640 784 5.0E-06
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 640 782 5.0E-06
sp|Q3V0K9|PLSI_MOUSE Plastin-1 OS=Mus musculus GN=Pls1 PE=1 SV=1 129 327 7.0E-06
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 640 783 7.0E-06
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 640 782 7.0E-06
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 640 783 7.0E-06
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 640 783 7.0E-06
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 640 783 7.0E-06
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 644 753 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5789
MADTAPADTAPADPQRSPLALPGNHDNGSLERFPQLSVDDDQFPDDVHDAHRWSYTFNSLRRLSGDCFPPSPKSS
RSATVSSASTAATSVDLAPFTPTLQRSRRDKELLHAARQQRSSRDRKPLASTKAKRVRRFQSSSTPAAALAAVEP
VHDQGLVRMTFTEQQRWITVQQKTFTKWLNTKLVARELEVKDLVQDLSDGVMLIHLLECLSNESLGRYASKPKMR
VQRFENANLALNFIKSRGIQMTNIGAEDVVDGNRKIVLGLIWTLILRFTISDINEEGLSAKEGLLLWCQRKTACY
DEVEVRDFSGSWNDGLAFCALLDIHRPDLIDFDALDKADHRGNMQLAFDIAHEAIGIPRLLDVEDVCDVAKPDER
SLMTYIAYWFHAFSQMEKVENAGRRVEKFVNNMQGAWEMQSAYERRMRELLKCVRGQVERWQQAKFEGTYADAKS
QANEFAGYKRGQKRDWVAEKSDLATLLGNIKTKLGTYRLRPYDPPAGLRLDVLEQDWATLTQTEMKRAQLINETI
RDIKNALRKSFADKANDLAMALNTMQLAISGLDGDVEDQLHHVRRLSDNLAPLDRYLETIAAVDAKCQEAKIEEN
DFTTYTYDELSYELGLVKSSVQKKLSFLENQMVARNMTNLTPIQLEEFESVFRHFDRDDTNSLQELEFSAALASL
GLVFSEDEMHEYFFETSNGRDHVTFEQFIRFMVEATEDQNTAEQVFQSFREVADGKPYVTEMDLRHSLVPDEVID
RLVEMMPPHSGPDMASDRGRAQYDYISFMEKMINEGDEGGGRPRVNGTTV*
Coding >Ophun1|5789
ATGGCGGACACGGCTCCAGCGGACACGGCCCCAGCGGACCCCCAGCGGAGCCCACTGGCACTGCCGGGCAACCAC
GACAATGGCAGCCTCGAGCGCTTCCCCCAGCTCTCGGTGGACGACGACCAATTTCCGGACGACGTGCACGACGCG
CATCGCTGGTCCTACACTTTCAACAGCCTCAGGCGTCTCAGCGGCGACTGCTTCCCGCCATCGCCCAAGTCTTCG
CGGTCGGCGACGGTTTCGAGCGCGTCTACTGCTGCTACCAGCGTCGATCTCGCGCCTTTCACCCCCACTCTCCAG
CGAAGTCGGCGAGATAAAGAGCTGCTGCATGCCGCGCGCCAGCAGCGTTCGAGTCGCGACCGGAAGCCGCTGGCG
TCCACAAAGGCTAAGAGGGTTCGGAGATTCCAGTCGAGCAGCACGCCTGCTGCTGCTCTCGCTGCTGTCGAGCCC
GTTCATGATCAGGGGCTTGTCAGGATGACTTTTACCGAGCAGCAGCGCTGGATCACGGTCCAGCAGAAGACGTTT
ACCAAATGGCTCAACACCAAGCTCGTGGCCAGAGAACTCGAGGTCAAGGACCTGGTCCAGGACCTCAGCGATGGT
GTCATGCTTATCCATCTCCTCGAATGCCTCTCCAACGAATCCCTCGGCCGCTATGCCTCCAAACCCAAGATGCGC
GTCCAACGGTTCGAAAACGCAAACCTGGCCCTCAATTTCATCAAGTCCCGCGGCATTCAAATGACAAACATTGGC
GCAGAGGACGTCGTCGACGGCAACCGCAAAATCGTCCTCGGCCTCATCTGGACCCTGATCCTGCGCTTCACCATC
AGCGACATCAACGAGGAGGGCCTGTCGGCCAAGGAGGGCCTGCTCCTTTGGTGTCAGCGGAAGACGGCGTGCTAC
GACGAGGTCGAAGTGCGAGACTTTAGCGGCAGCTGGAACGACGGCCTGGCCTTTTGCGCCCTTCTCGACATTCAC
CGGCCCGACCTCATCGACTTTGACGCCCTCGACAAGGCCGACCACCGCGGCAACATGCAGCTGGCCTTTGATATC
GCTCACGAGGCCATTGGCATCCCGCGCCTGCTCGATGTCGAGGACGTGTGCGACGTGGCCAAGCCCGACGAGCGC
AGTCTCATGACGTACATTGCCTACTGGTTCCACGCCTTTTCCCAGATGGAAAAGGTGGAAAACGCGGGTCGCCGC
GTGGAAAAGTTTGTCAACAACATGCAGGGCGCCTGGGAGATGCAGAGCGCCTACGAGCGCCGCATGCGCGAGCTT
CTCAAGTGCGTCCGCGGCCAGGTCGAGCGCTGGCAACAGGCCAAGTTCGAGGGCACCTACGCCGATGCCAAGTCG
CAGGCCAACGAGTTCGCCGGCTACAAGAGGGGCCAGAAGCGGGACTGGGTGGCAGAGAAGAGCGATCTGGCCACG
CTGCTGGGCAACATCAAGACCAAGCTGGGCACGTATCGACTCCGGCCCTACGACCCGCCGGCCGGCCTGAGGCTC
GACGTGCTGGAGCAGGACTGGGCCACGCTGACGCAGACGGAGATGAAGCGCGCCCAGCTCATCAACGAGACGATC
CGAGACATCAAGAACGCGCTGCGCAAGTCATTTGCCGACAAGGCCAACGACCTGGCCATGGCCCTCAACACGATG
CAGCTGGCCATCTCGGGCCTCGACGGCGATGTTGAGGACCAGCTGCACCACGTGCGTCGCCTCAGCGACAACTTG
GCTCCGCTCGACCGCTACCTCGAGACGATTGCGGCCGTCGACGCCAAGTGCCAAGAGGCCAAGATTGAGGAGAAC
GACTTTACGACGTACACGTACGACGAGCTGTCGTACGAGCTGGGGCTGGTCAAGTCGTCTGTACAGAAGAAGCTG
TCGTTCCTCGAGAACCAGATGGTGGCCCGCAACATGACCAACCTGACGCCCATCCAGCTCGAGGAGTTTGAGAGC
GTCTTCCGCCACTTTGACCGCGACGACACCAACTCGTTGCAGGAGCTCGAGTTCAGCGCGGCGCTGGCGTCGCTC
GGCCTCGTCTTCTCCGAGGACGAGATGCACGAGTACTTTTTCGAGACGTCCAACGGGCGCGATCACGTCACGTTT
GAGCAGTTCATCCGCTTCATGGTGGAGGCGACAGAGGACCAGAACACGGCCGAGCAGGTGTTCCAGTCCTTCCGC
GAGGTGGCCGACGGCAAGCCCTACGTGACGGAGATGGACCTGCGGCACAGCCTGGTTCCGGACGAGGTGATTGAC
CGGCTGGTGGAGATGATGCCGCCGCACTCGGGGCCCGATATGGCGTCGGATCGGGGGAGGGCGCAGTACGACTAC
ATTTCCTTTATGGAGAAGATGATCAATGAGGGGGATGAGGGGGGTGGGAGGCCGAGGGTGAACGGGACGACTGTG
TAG
Transcript >Ophun1|5789
ATGGCGGACACGGCTCCAGCGGACACGGCCCCAGCGGACCCCCAGCGGAGCCCACTGGCACTGCCGGGCAACCAC
GACAATGGCAGCCTCGAGCGCTTCCCCCAGCTCTCGGTGGACGACGACCAATTTCCGGACGACGTGCACGACGCG
CATCGCTGGTCCTACACTTTCAACAGCCTCAGGCGTCTCAGCGGCGACTGCTTCCCGCCATCGCCCAAGTCTTCG
CGGTCGGCGACGGTTTCGAGCGCGTCTACTGCTGCTACCAGCGTCGATCTCGCGCCTTTCACCCCCACTCTCCAG
CGAAGTCGGCGAGATAAAGAGCTGCTGCATGCCGCGCGCCAGCAGCGTTCGAGTCGCGACCGGAAGCCGCTGGCG
TCCACAAAGGCTAAGAGGGTTCGGAGATTCCAGTCGAGCAGCACGCCTGCTGCTGCTCTCGCTGCTGTCGAGCCC
GTTCATGATCAGGGGCTTGTCAGGATGACTTTTACCGAGCAGCAGCGCTGGATCACGGTCCAGCAGAAGACGTTT
ACCAAATGGCTCAACACCAAGCTCGTGGCCAGAGAACTCGAGGTCAAGGACCTGGTCCAGGACCTCAGCGATGGT
GTCATGCTTATCCATCTCCTCGAATGCCTCTCCAACGAATCCCTCGGCCGCTATGCCTCCAAACCCAAGATGCGC
GTCCAACGGTTCGAAAACGCAAACCTGGCCCTCAATTTCATCAAGTCCCGCGGCATTCAAATGACAAACATTGGC
GCAGAGGACGTCGTCGACGGCAACCGCAAAATCGTCCTCGGCCTCATCTGGACCCTGATCCTGCGCTTCACCATC
AGCGACATCAACGAGGAGGGCCTGTCGGCCAAGGAGGGCCTGCTCCTTTGGTGTCAGCGGAAGACGGCGTGCTAC
GACGAGGTCGAAGTGCGAGACTTTAGCGGCAGCTGGAACGACGGCCTGGCCTTTTGCGCCCTTCTCGACATTCAC
CGGCCCGACCTCATCGACTTTGACGCCCTCGACAAGGCCGACCACCGCGGCAACATGCAGCTGGCCTTTGATATC
GCTCACGAGGCCATTGGCATCCCGCGCCTGCTCGATGTCGAGGACGTGTGCGACGTGGCCAAGCCCGACGAGCGC
AGTCTCATGACGTACATTGCCTACTGGTTCCACGCCTTTTCCCAGATGGAAAAGGTGGAAAACGCGGGTCGCCGC
GTGGAAAAGTTTGTCAACAACATGCAGGGCGCCTGGGAGATGCAGAGCGCCTACGAGCGCCGCATGCGCGAGCTT
CTCAAGTGCGTCCGCGGCCAGGTCGAGCGCTGGCAACAGGCCAAGTTCGAGGGCACCTACGCCGATGCCAAGTCG
CAGGCCAACGAGTTCGCCGGCTACAAGAGGGGCCAGAAGCGGGACTGGGTGGCAGAGAAGAGCGATCTGGCCACG
CTGCTGGGCAACATCAAGACCAAGCTGGGCACGTATCGACTCCGGCCCTACGACCCGCCGGCCGGCCTGAGGCTC
GACGTGCTGGAGCAGGACTGGGCCACGCTGACGCAGACGGAGATGAAGCGCGCCCAGCTCATCAACGAGACGATC
CGAGACATCAAGAACGCGCTGCGCAAGTCATTTGCCGACAAGGCCAACGACCTGGCCATGGCCCTCAACACGATG
CAGCTGGCCATCTCGGGCCTCGACGGCGATGTTGAGGACCAGCTGCACCACGTGCGTCGCCTCAGCGACAACTTG
GCTCCGCTCGACCGCTACCTCGAGACGATTGCGGCCGTCGACGCCAAGTGCCAAGAGGCCAAGATTGAGGAGAAC
GACTTTACGACGTACACGTACGACGAGCTGTCGTACGAGCTGGGGCTGGTCAAGTCGTCTGTACAGAAGAAGCTG
TCGTTCCTCGAGAACCAGATGGTGGCCCGCAACATGACCAACCTGACGCCCATCCAGCTCGAGGAGTTTGAGAGC
GTCTTCCGCCACTTTGACCGCGACGACACCAACTCGTTGCAGGAGCTCGAGTTCAGCGCGGCGCTGGCGTCGCTC
GGCCTCGTCTTCTCCGAGGACGAGATGCACGAGTACTTTTTCGAGACGTCCAACGGGCGCGATCACGTCACGTTT
GAGCAGTTCATCCGCTTCATGGTGGAGGCGACAGAGGACCAGAACACGGCCGAGCAGGTGTTCCAGTCCTTCCGC
GAGGTGGCCGACGGCAAGCCCTACGTGACGGAGATGGACCTGCGGCACAGCCTGGTTCCGGACGAGGTGATTGAC
CGGCTGGTGGAGATGATGCCGCCGCACTCGGGGCCCGATATGGCGTCGGATCGGGGGAGGGCGCAGTACGACTAC
ATTTCCTTTATGGAGAAGATGATCAATGAGGGGGATGAGGGGGGTGGGAGGCCGAGGGTGAACGGGACGACTGTG
TAG
Gene >Ophun1|5789
ATGGCGGACACGGCTCCAGCGGACACGGCCCCAGCGGACCCCCAGCGGAGCCCACTGGCACTGCCGGGCAACCAC
GACAATGGCAGCCTCGAGCGCTTCCCCCAGCTCTCGGTGGACGACGACCAATTTCCGGACGACGTGCACGACGCG
CATCGCTGGTCCTACACTTTCAACAGCCTCAGGCGTCTCAGCGGCGACTGCTTCCCGCCATCGCCCAAGTCTTCG
CGGTCGGCGACGGTTTCGAGCGCGTCTACTGCTGCTACCAGCGTCGATCTCGCGCCTTTCACCCCCACTCTCCAG
CGAAGTCGGCGAGATAAAGAGCTGCTGCATGCCGCGCGCCAGCAGCGTTCGAGTCGCGACCGGAAGCCGCTGGCG
TCCACAAAGGCTAAGAGGGTTCGGAGATTCCAGTCGAGCAGCACGCCTGCTGCTGCTCTCGCTGCTGTCGAGCCC
GTTCATGATCAGGGGCTTGTCAGGATGACTTTTACCGAGCAGCAGCGCTGGATCACGGTCCAGCAGAAGACGTTT
ACCAAATGGTATCACTCTCTCTGTCACTCTCTCGCTCTCTCTCTCAGAGATTCGTCTATTGTTGTCGAGGCTGAC
GCGCTTCTTACTTAGGCTCAACACCAAGCTCGTGGCCAGAGAACTCGAGGTCAAGGACCTGGTCCAGGACCTCAG
CGATGGTGTACGTTGCCCCCTTGTTCAACTGAAGGTCTCTTCTAACTCTGCTCTCTCCCAGGTCATGCTTATCCA
TCTCCTCGAATGCCTCTCCAACGAATCCCTCGGCCGCTATGCCTCCAAACCCAAGATGCGCGTCCAACGGTTCGA
AAACGCAAACCTGGCCCTCAATTTCATCAAGTCCCGCGGCATTCAAATGACAAACATTGGCGCAGAGGACGTCGT
CGACGGCAACCGCAAAATCGTCCTCGGCCTCATCTGGACCCTGATCCTGCGCTTCACCATCAGCGACATCAACGA
GGAGGGCCTGTCGGCCAAGGAGGGCCTGCTCCTTTGGTGTCAGCGGAAGACGGCGTGCTACGACGAGGTCGAAGT
GCGAGACTTTAGCGGCAGCTGGAACGACGGCCTGGCCTTTTGCGCCCTTCTCGACATTCACCGGCCCGACCTCAT
CGACTTTGACGCCCTCGACAAGGCCGACCACCGCGGCAACATGCAGCTGGCCTTTGATATCGCTCACGAGGCCAT
TGGCATCCCGCGCCTGCTCGATGTCGAGGACGTGTGCGACGTGGCCAAGCCCGACGAGCGCAGTCTCATGACGTA
CATTGCCTACTGGTTCCACGCCTTTTCCCAGATGGAAAAGGTGGAAAACGCGGGTCGCCGCGTGGAAAAGTTTGT
CAACAACATGCAGGGCGCCTGGGAGATGCAGAGCGCCTACGAGCGCCGCATGCGCGAGCTTCTCAAGTGCGTCCG
CGGCCAGGTCGAGCGCTGGCAACAGGCCAAGTTCGAGGGCACCTACGCCGATGCCAAGTCGCAGGCCAACGAGTT
CGCCGGCTACAAGAGGGGCCAGAAGCGGGACTGGGTGGCAGAGAAGAGCGATCTGGCCACGCTGCTGGGCAACAT
CAAGACCAAGCTGGGCACGTATCGACTCCGGCCCTACGACCCGCCGGCCGGCCTGAGGCTCGACGTGCTGGAGCA
GGACTGGGCCACGCTGACGCAGACGGAGATGAAGCGCGCCCAGCTCATCAACGAGACGATCCGAGACATCAAGAA
CGCGCTGCGCAAGTCATTTGCCGACAAGGCCAACGACCTGGCCATGGCCCTCAACACGATGCAGCTGGCCATCTC
GGGCCTCGACGGCGATGTTGAGGACCAGCTGCACCACGTGCGTCGCCTCAGCGACAACTTGGCTCCGCTCGACCG
CTACCTCGAGACGATTGCGGCCGTCGACGCCAAGTGCCAAGAGGCCAAGATTGAGGAGAACGACTTTACGACGTA
CACGTACGACGAGCTGTCGTACGAGCTGGGGCTGGTCAAGTCGTCTGTACAGAAGAAGCTGTCGTTCCTCGAGAA
CCAGATGGTGGCCCGCAACATGACCAACCTGACGCCCATCCAGCTCGAGGAGTTTGAGAGCGTCTTCCGCCACTT
TGACCGCGACGACACCAACTCGTTGCAGGAGCTCGAGTTCAGCGCGGCGCTGGCGTCGCTCGGCCTCGTCTTCTC
CGAGGACGAGATGCACGAGTACTTTTTCGAGACGTCCAACGGGCGCGATCACGTCACGTTTGAGCAGTTCATCCG
CTTCATGGTGGAGGCGACAGAGGACCAGAACACGGCCGAGCAGGTGTTCCAGTCCTTCCGCGAGGTGGCCGACGG
CAAGCCCTACGTGACGGAGATGGACCTGCGGCACAGCCTGGTTCCGGACGAGGTGATTGACCGGCTGGTGGAGAT
GATGCCGCCGCACTCGGGGCCCGATATGGCGTCGGATCGGGGGAGGGCGCAGTACGACTACATTTCCTTTATGGA
GAAGATGATCAATGAGGGGGATGAGGGGGGTGGGAGGCCGAGGGTGAACGGGACGACTGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail