Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5788
Gene name
LocationContig_596:49..2079
Strand-
Gene length (bp)2030
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02913 FAD-oxidase_C FAD linked oxidases, C-terminal domain 6.4E-57 306 571
PF01565 FAD_binding_4 FAD binding domain 3.3E-34 131 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1X2|YN53_SCHPO Putative D-lactate dehydrogenase C713.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.03 PE=3 SV=1 35 573 0.0E+00
sp|P46681|DLD2_YEAST D-lactate dehydrogenase [cytochrome] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD2 PE=1 SV=1 52 573 0.0E+00
sp|P39976|DLD3_YEAST D-lactate dehydrogenase [cytochrome] 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD3 PE=1 SV=1 68 573 6.0E-170
sp|O23240|D2HDH_ARATH D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=D2HGDH PE=1 SV=3 78 573 3.0E-167
sp|Q1JPD3|D2HDH_BOVIN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=D2HGDH PE=2 SV=2 60 573 4.0E-167
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1X2|YN53_SCHPO Putative D-lactate dehydrogenase C713.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC713.03 PE=3 SV=1 35 573 0.0E+00
sp|P46681|DLD2_YEAST D-lactate dehydrogenase [cytochrome] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD2 PE=1 SV=1 52 573 0.0E+00
sp|P39976|DLD3_YEAST D-lactate dehydrogenase [cytochrome] 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD3 PE=1 SV=1 68 573 6.0E-170
sp|O23240|D2HDH_ARATH D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Arabidopsis thaliana GN=D2HGDH PE=1 SV=3 78 573 3.0E-167
sp|Q1JPD3|D2HDH_BOVIN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=D2HGDH PE=2 SV=2 60 573 4.0E-167
sp|Q8N465|D2HDH_HUMAN D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=D2HGDH PE=1 SV=3 52 573 1.0E-166
sp|A1L258|D2HDH_DANRE D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Danio rerio GN=d2hgdh PE=2 SV=1 84 573 1.0E-165
sp|Q8CIM3|D2HDH_MOUSE D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=D2hgdh PE=1 SV=3 45 573 2.0E-165
sp|P84850|D2HDH_RAT D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=D2hgdh PE=3 SV=1 55 573 3.0E-165
sp|B8B7X6|D2HDH_ORYSI Probable D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Oryza sativa subsp. indica GN=D2HGDH PE=3 SV=1 78 573 5.0E-165
sp|Q7XI14|D2HDH_ORYSJ Probable D-2-hydroxyglutarate dehydrogenase, mitochondrial OS=Oryza sativa subsp. japonica GN=D2HGDH PE=3 SV=1 78 573 2.0E-164
sp|P32891|DLD1_YEAST D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DLD1 PE=1 SV=2 131 574 5.0E-46
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 118 573 5.0E-41
sp|P9WIT1|Y2280_MYCTU Uncharacterized FAD-linked oxidoreductase Rv2280 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2280 PE=1 SV=1 103 569 2.0E-38
sp|P9WIT0|Y2280_MYCTO Uncharacterized FAD-linked oxidoreductase MT2338 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2338 PE=3 SV=1 103 569 2.0E-38
sp|Q12627|DLD1_KLULA D-lactate dehydrogenase [cytochrome], mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DLD1 PE=3 SV=2 131 574 8.0E-38
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 132 573 2.0E-37
sp|Q86WU2|LDHD_HUMAN Probable D-lactate dehydrogenase, mitochondrial OS=Homo sapiens GN=LDHD PE=1 SV=1 133 573 6.0E-36
sp|P0AEP9|GLCD_ECOLI Glycolate oxidase subunit GlcD OS=Escherichia coli (strain K12) GN=glcD PE=3 SV=1 109 573 6.0E-35
sp|P0AEQ0|GLCD_ECOL6 Glycolate oxidase subunit GlcD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glcD PE=3 SV=1 109 573 6.0E-35
sp|Q7TNG8|LDHD_MOUSE Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus GN=Ldhd PE=1 SV=1 133 573 8.0E-32
sp|O29853|DLD_ARCFU D-lactate dehydrogenase (acceptor) OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=dld PE=1 SV=1 128 356 3.0E-27
sp|O45218|ADAS_CAEEL Alkyldihydroxyacetonephosphate synthase OS=Caenorhabditis elegans GN=ads-1 PE=2 SV=1 132 567 5.0E-20
sp|P97275|ADAS_CAVPO Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Cavia porcellus GN=AGPS PE=1 SV=1 95 567 8.0E-20
sp|O00116|ADAS_HUMAN Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens GN=AGPS PE=1 SV=1 132 567 2.0E-19
sp|Q8C0I1|ADAS_MOUSE Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Mus musculus GN=Agps PE=1 SV=1 76 567 3.0E-18
sp|O96759|ADAS_DICDI Alkyldihydroxyacetonephosphate synthase OS=Dictyostelium discoideum GN=eapA PE=1 SV=1 109 337 4.0E-18
sp|Q9V778|ADAS_DROME Alkyldihydroxyacetonephosphate synthase OS=Drosophila melanogaster GN=CG10253 PE=2 SV=1 71 567 3.0E-17
sp|Q9EQR2|ADAS_RAT Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Rattus norvegicus GN=Agps PE=2 SV=1 76 567 4.0E-17
sp|Q8X7S0|YGCU_ECO57 Uncharacterized FAD-linked oxidoreductase YgcU OS=Escherichia coli O157:H7 GN=ygcU PE=3 SV=1 133 301 6.0E-14
sp|Q46911|YGCU_ECOLI Uncharacterized FAD-linked oxidoreductase YgcU OS=Escherichia coli (strain K12) GN=ygcU PE=3 SV=4 133 301 6.0E-14
sp|O97157|ADAS_TRYBB Alkyldihydroxyacetonephosphate synthase OS=Trypanosoma brucei brucei PE=3 SV=1 57 326 2.0E-11
sp|P77748|YDIJ_ECOLI Uncharacterized protein YdiJ OS=Escherichia coli (strain K12) GN=ydiJ PE=3 SV=1 133 571 3.0E-11
sp|Q57252|Y1163_HAEIN Uncharacterized protein HI_1163 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1163 PE=1 SV=1 126 571 1.0E-10
sp|Q90YK3|GGLO_SCYTO L-gulonolactone oxidase OS=Scyliorhinus torazame GN=GULO PE=2 SV=1 117 304 9.0E-09
sp|Q8HXW0|GGLO_PIG L-gulonolactone oxidase OS=Sus scrofa GN=GULO PE=2 SV=3 120 305 2.0E-07
sp|P58710|GGLO_MOUSE L-gulonolactone oxidase OS=Mus musculus GN=Gulo PE=1 SV=3 120 305 2.0E-07
sp|Q3ZC33|GGLO_BOVIN L-gulonolactone oxidase OS=Bos taurus GN=GULO PE=2 SV=3 120 305 8.0E-07
sp|P52073|GLCE_ECOLI Glycolate oxidase subunit GlcE OS=Escherichia coli (strain K12) GN=glcE PE=3 SV=1 186 308 3.0E-06
sp|P10867|GGLO_RAT L-gulonolactone oxidase OS=Rattus norvegicus GN=Gulo PE=1 SV=3 120 305 6.0E-06
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 113 304 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5788
MEHVGRGGREPSSEMRLHQRLIAGPSRRKRCSVLRLLPSAMLRLALARLPRLGPARRFHQSGSRRRQAQLTAKTY
PALRRDERFAQLTEADVAHFRHELRGSNAVLEDHGDGSELAGYNRDWMGKYRGQSRLVLRPGSTEEVRRILEYCH
ERQLAVVPQGGNTGLVGGSVPVFDEIVVSLARLQTIHSLDDTSGCLVLDAGVLLETADSYLAERGFIFPLDLGAK
GSCQVGGNVATNAGGLRLLRYGSLHGSVLGMEAVMPDGTILDDLCTLRKNNTGYDIKQLLIGSEGTLGIITKLAI
QCPPRPAAVNVAYLGLSSFTAARRAFREARSRLSEILSAFELMDRRSQQVVQAVRGADFRRPLEDDGLPFYCLVE
TSGSDAAHDYEKLERFLEFVLSEGIVADGVVAQDATQARALWNWREAIPECVGHWGGVYKYDVSIPMTDMYSLVE
DVRARLIQQKLMAPEPSPSSSPPSSSQDAFVAQAVIGYGHMGDANLHLNVAVRQYDRRVEEALEPYVYEWIGARR
GSISAEHGLGLAKRDFIRYSRSETMVMLMKKIKELYDPKGIMNPYKYLK*
Coding >Ophun1|5788
ATGGAGCACGTGGGGCGGGGCGGACGGGAGCCGAGCTCCGAGATGCGGCTTCATCAGAGGCTCATTGCCGGACCG
TCCCGACGAAAGCGCTGCTCCGTCCTCCGTCTCCTACCGTCAGCCATGCTCCGTCTCGCCCTTGCCCGCCTCCCC
CGTCTCGGCCCGGCCCGCCGCTTCCACCAGTCCGGCAGCCGAAGACGACAGGCCCAGCTGACGGCAAAGACGTAT
CCCGCCCTCCGACGAGACGAGCGCTTCGCCCAGCTGACGGAGGCGGACGTGGCGCACTTCCGGCACGAGCTGCGC
GGCTCCAACGCTGTGCTCGAGGACCATGGCGACGGCTCCGAGCTTGCGGGCTACAACCGGGACTGGATGGGCAAA
TACCGTGGCCAGAGCAGGCTGGTTCTTCGGCCGGGGTCTACGGAAGAGGTCCGCCGGATCCTCGAGTATTGCCAT
GAGAGGCAGTTGGCTGTTGTGCCGCAGGGGGGGAATACGGGTCTTGTGGGCGGGTCGGTGCCCGTGTTCGATGAG
ATTGTTGTCAGCTTGGCGCGGTTGCAGACGATTCATTCGCTTGATGATACTAGCGGCTGTCTCGTTCTCGACGCC
GGTGTTCTTCTCGAGACGGCGGACTCTTACCTCGCTGAACGGGGCTTCATCTTTCCTCTTGATCTTGGGGCCAAG
GGCTCGTGTCAGGTTGGTGGCAACGTGGCGACCAACGCTGGCGGACTACGGCTTCTACGCTACGGGAGTCTTCAC
GGATCGGTTCTCGGTATGGAGGCTGTCATGCCGGACGGGACGATACTGGATGATCTCTGCACGCTGCGGAAGAAT
AACACGGGCTACGACATCAAACAGCTCCTCATCGGCTCCGAGGGAACGCTCGGCATCATCACAAAGCTGGCCATC
CAGTGCCCTCCCCGTCCAGCAGCCGTCAACGTCGCCTATCTAGGTCTCAGCTCCTTCACCGCCGCCCGCCGCGCC
TTTCGCGAAGCCCGCTCCCGTCTGTCCGAGATTCTCTCCGCCTTTGAGCTGATGGACCGTCGAAGCCAGCAGGTG
GTGCAGGCTGTGCGCGGGGCGGACTTCCGGCGTCCGCTTGAGGATGACGGACTGCCTTTTTACTGCCTGGTTGAG
ACGAGCGGGTCGGATGCTGCGCATGATTATGAGAAGCTGGAGCGGTTTCTTGAGTTTGTGCTTTCCGAGGGCATT
GTTGCTGATGGGGTTGTTGCGCAGGATGCTACGCAGGCGAGGGCCTTGTGGAATTGGAGGGAGGCTATTCCTGAG
TGTGTTGGGCATTGGGGGGGGGTTTACAAGTATGATGTTTCGATTCCCATGACGGACATGTACAGCCTCGTTGAG
GATGTTCGCGCCCGTCTAATCCAACAGAAGCTCATGGCTCCCGAACCCTCGCCGTCTTCATCTCCGCCTTCGTCT
TCACAGGACGCCTTTGTCGCCCAAGCTGTTATAGGCTACGGCCACATGGGCGACGCAAACCTCCACCTCAACGTC
GCGGTACGACAATACGACCGCCGCGTGGAAGAGGCGCTGGAACCTTATGTTTACGAATGGATCGGTGCCAGGAGA
GGGAGCATCAGCGCTGAGCATGGCCTCGGTTTGGCAAAGAGGGATTTCATAAGGTATAGTCGCAGTGAGACTATG
GTGATGCTCATGAAGAAGATCAAGGAGCTTTACGACCCGAAAGGCATCATGAACCCGTACAAGTACCTGAAATAG
Transcript >Ophun1|5788
ATGGAGCACGTGGGGCGGGGCGGACGGGAGCCGAGCTCCGAGATGCGGCTTCATCAGAGGCTCATTGCCGGACCG
TCCCGACGAAAGCGCTGCTCCGTCCTCCGTCTCCTACCGTCAGCCATGCTCCGTCTCGCCCTTGCCCGCCTCCCC
CGTCTCGGCCCGGCCCGCCGCTTCCACCAGTCCGGCAGCCGAAGACGACAGGCCCAGCTGACGGCAAAGACGTAT
CCCGCCCTCCGACGAGACGAGCGCTTCGCCCAGCTGACGGAGGCGGACGTGGCGCACTTCCGGCACGAGCTGCGC
GGCTCCAACGCTGTGCTCGAGGACCATGGCGACGGCTCCGAGCTTGCGGGCTACAACCGGGACTGGATGGGCAAA
TACCGTGGCCAGAGCAGGCTGGTTCTTCGGCCGGGGTCTACGGAAGAGGTCCGCCGGATCCTCGAGTATTGCCAT
GAGAGGCAGTTGGCTGTTGTGCCGCAGGGGGGGAATACGGGTCTTGTGGGCGGGTCGGTGCCCGTGTTCGATGAG
ATTGTTGTCAGCTTGGCGCGGTTGCAGACGATTCATTCGCTTGATGATACTAGCGGCTGTCTCGTTCTCGACGCC
GGTGTTCTTCTCGAGACGGCGGACTCTTACCTCGCTGAACGGGGCTTCATCTTTCCTCTTGATCTTGGGGCCAAG
GGCTCGTGTCAGGTTGGTGGCAACGTGGCGACCAACGCTGGCGGACTACGGCTTCTACGCTACGGGAGTCTTCAC
GGATCGGTTCTCGGTATGGAGGCTGTCATGCCGGACGGGACGATACTGGATGATCTCTGCACGCTGCGGAAGAAT
AACACGGGCTACGACATCAAACAGCTCCTCATCGGCTCCGAGGGAACGCTCGGCATCATCACAAAGCTGGCCATC
CAGTGCCCTCCCCGTCCAGCAGCCGTCAACGTCGCCTATCTAGGTCTCAGCTCCTTCACCGCCGCCCGCCGCGCC
TTTCGCGAAGCCCGCTCCCGTCTGTCCGAGATTCTCTCCGCCTTTGAGCTGATGGACCGTCGAAGCCAGCAGGTG
GTGCAGGCTGTGCGCGGGGCGGACTTCCGGCGTCCGCTTGAGGATGACGGACTGCCTTTTTACTGCCTGGTTGAG
ACGAGCGGGTCGGATGCTGCGCATGATTATGAGAAGCTGGAGCGGTTTCTTGAGTTTGTGCTTTCCGAGGGCATT
GTTGCTGATGGGGTTGTTGCGCAGGATGCTACGCAGGCGAGGGCCTTGTGGAATTGGAGGGAGGCTATTCCTGAG
TGTGTTGGGCATTGGGGGGGGGTTTACAAGTATGATGTTTCGATTCCCATGACGGACATGTACAGCCTCGTTGAG
GATGTTCGCGCCCGTCTAATCCAACAGAAGCTCATGGCTCCCGAACCCTCGCCGTCTTCATCTCCGCCTTCGTCT
TCACAGGACGCCTTTGTCGCCCAAGCTGTTATAGGCTACGGCCACATGGGCGACGCAAACCTCCACCTCAACGTC
GCGGTACGACAATACGACCGCCGCGTGGAAGAGGCGCTGGAACCTTATGTTTACGAATGGATCGGTGCCAGGAGA
GGGAGCATCAGCGCTGAGCATGGCCTCGGTTTGGCAAAGAGGGATTTCATAAGGTATAGTCGCAGTGAGACTATG
GTGATGCTCATGAAGAAGATCAAGGAGCTTTACGACCCGAAAGGCATCATGAACCCGTACAAGTACCTGAAATAG
Gene >Ophun1|5788
ATGGAGCACGTGGGGCGGGGCGGACGGGAGCCGAGCTCCGAGATGCGGCTTCATCAGAGGCTCATTGCCGGACCG
TGTCCGTCTCCATCTTCATTTCCCATCTCCAGTCCTTGGACCTTTCCCCGGCCGCAGCCCGACGAAAGCGCTGCT
CCGTCCTCCGTCTCCTACCGTCAGCCATGCTCCGTCTCGCCCTTGCCCGCCTCCCCCGTCTCGGCCCGGCCCGCC
GCTTCCACCAGTCCGGCAGCCGAAGACGACAGGCCCAGCTGACGGCAAAGACGTATCCCGCCCTCCGACGAGACG
AGCGCTTCGCCCAGCTGACGGAGGCGGACGTGGCGCACTTCCGGCACGAGCTGCGCGGCTCCAACGCTGTGCTCG
AGGACCATGGCGACGGCTCCGAGCTTGCGGGCTACAACCGGGACTGGATGGGCAAATACCGTGGCCAGAGCAGGC
TGGTTCTTCGGCCGGGGTCTACGGAAGAGGTCCGCCGGATCCTCGAGTATTGCCATGAGAGGCAGTTGGCTGTTG
TGCCGCAGGGGGGGAATACGGGTCTTGTGGGCGGGTCGGTGCCCGTGTTCGATGAGATTGTTGTCAGCTTGGCGC
GGTTGCAGACGATTCATTCGCTTGATGATACTAGCGGCTGTCTCGTTCTCGACGCCGGTGTTCTTCTCGAGACGG
CGGACTCTTACCTCGCTGAACGGGGCTTCATCTTTCCTCTTGATCTTGGGGCCAAGGGCTCGTGTCAGGTTGGTG
GCAACGTGGCGACCAACGCTGGCGGACTACGGCTTCTACGCTACGGGAGTCTTCACGGATCGGTTCTCGGTATGG
AGGCTGTCATGCCGGACGGGACGATACTGGATGATCTCTGCACGCTGCGGAAGAATAACACGGGCTACGACATCA
AACAGCTCCTCATCGGCTCCGAGGGAACGCTCGGCATCATCACAAAGCTGGCCATCCAGTGCCCTCCCCGTCCAG
CAGCCGTCAACGTCGCCTATCTAGGTCTCAGCTCCTTCACCGCCGCCCGCCGCGCCTTTCGCGAAGCCCGCTCCC
GTCTGTCCGAGATTCTCTCCGCCTTTGAGCTGATGGACCGTCGAAGCCAGCAGGTGGTGCAGGCTGTGCGCGGGG
CGGACTTCCGGCGTCCGCTTGAGGATGACGGACTGCCTTTTTACTGCCTGGTTGAGACGAGCGGGTCGGATGCTG
CGCATGATTATGAGAAGCTGGAGCGGTTTCTTGAGTTTGTGCTTTCCGAGGGCATTGTTGCTGATGGGGTTGTTG
CGCAGGATGCTACGCAGGCGAGGGCCTTGTGGAATTGGAGGGAGGCTATTCCTGAGTGTGTTGGGCATTGGGGGG
GGGTTTACAAGTATGATGTTTCGATTCCCATGACGGACATGTACAGCCTCGTTGAGGATGTTCGCGCCCGTCTAA
TCCAACAGAAGCTCATGGCTCCCGAACCCTCGCCGTCTTCATCTCCGCCTTCGTCTTCACAGGACGCCTTTGTCG
CCCAAGCTGTTATAGGCTACGGCCACATGGGCGACGCAAACCTCCACCTCAACGTCGCGGTACGACAATACGACC
GCCGCGTGGAAGAGGCGCTGGAACCTTATGTTTACGAATGGATCGGTGCCAGGAGAGGGAGCATCAGCGCTGAGC
ATGGCCTCGGTTTGGCAAAGAGGGATTTCATAAGGTATAGTCGCAGTGAGACTATGGTGATGCTCATGAAGAAGA
TCAAGGAGCTTTACGACCCGGTGAGTTCTTTCCCCCGTTTTCCAGTCTTGATTTCCAGGGCTTTCTTCTTTTTTT
ACTTGGATGGGTGCTGATGTGAGAGATGGCGTTGGGGGGAGGGGAGGGGGGAGGGTATAACCGGCCGAGACGAAA
GGGATAAAGAAACGCACGCTGGAAAAGCATTCCGCGAAGTCAAGAATAAGAGAAGGAAACGAAGAACGACGCACG
GCCCGCCTCAAACTCCCCTCCCTCGCGTCGTCTCATCCTAACAGAAAGGCATCATGAACCCGTACAAGTACCTGA
AATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail