Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5787
Gene name
LocationContig_595:9893..11570
Strand+
Gene length (bp)1677
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.1E-23 23 358
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.8E-06 27 56
PF00890 FAD_binding_2 FAD binding domain 9.1E-06 25 55

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 25 349 4.0E-18
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 23 355 7.0E-18
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 23 355 8.0E-18
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 25 349 3.0E-17
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 25 353 4.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I0Q0|PQSH_PSEAE 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsH PE=3 SV=1 25 349 4.0E-18
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 23 355 7.0E-18
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 23 355 8.0E-18
sp|Q02N79|PQSH_PSEAB 2-heptyl-3-hydroxy-4(1H)-quinolone synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pqsH PE=1 SV=1 25 349 3.0E-17
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 25 353 4.0E-11
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 49 385 6.0E-11
sp|A8LVF4|KMO_SALAI Kynurenine 3-monooxygenase OS=Salinispora arenicola (strain CNS-205) GN=kmo PE=3 SV=1 29 353 7.0E-09
sp|P9WM51|Y1260_MYCTU Uncharacterized protein Rv1260 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1260 PE=1 SV=1 25 368 1.0E-08
sp|P9WM50|Y1260_MYCTO Uncharacterized protein MT1298 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1298 PE=4 SV=1 25 368 1.0E-08
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 38 384 6.0E-08
sp|Q93NG3|DHPH_ARTNI 2,6-dihydroxypyridine 3-monooxygenase OS=Arthrobacter nicotinovorans GN=dhpH PE=1 SV=1 24 345 1.0E-07
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 38 385 2.0E-07
sp|A4XD40|KMO_SALTO Kynurenine 3-monooxygenase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=kmo PE=3 SV=1 29 353 6.0E-07
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 23 361 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 21 40 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup63
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6183
Ophiocordyceps australis 1348a (Ghana) OphauG2|6246
Ophiocordyceps australis map64 (Brazil) OphauB2|1391
Ophiocordyceps australis map64 (Brazil) OphauB2|2981
Ophiocordyceps australis map64 (Brazil) OphauB2|2982
Ophiocordyceps australis map64 (Brazil) OphauB2|4757
Ophiocordyceps camponoti-floridani Ophcf2|02169
Ophiocordyceps camponoti-floridani Ophcf2|05915
Ophiocordyceps camponoti-floridani Ophcf2|04805
Ophiocordyceps camponoti-rufipedis Ophun1|6198
Ophiocordyceps camponoti-rufipedis Ophun1|5787 (this protein)
Ophiocordyceps kimflemingae Ophio5|1107
Ophiocordyceps kimflemingae Ophio5|2267
Ophiocordyceps kimflemingae Ophio5|2268
Ophiocordyceps kimflemingae Ophio5|3035
Ophiocordyceps subramaniannii Hirsu2|5140
Ophiocordyceps subramaniannii Hirsu2|4439

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5787
MWTNLSSSSHSNDQMNIKTTGRLRVIIVGAGIGGLTAALALNRAGIDFVIIEKHASVLEPMGSSITLTPGSQRIL
HQLGLLNKIKTLSRPYSRGVEVREPNGQVLSQVSLSTFAMMHGEGMIILQRDLFIRTLYEALPADSEFILGRSVV
SVEHEAGAVRVHLSDGLSRTGHLVVGSDGVRGVVRVAMWKHADATAPGLIPREDREAVWCSWRSLWATCAEDERV
TNDVIMSSHHNRSCTTVLSSLGSLTLGVMVKTGSAGRRSKRLPTYKAEEADEMAASVARLPLNESLTFGDLWAKK
LRGGMTDIEVGVLNRWHYGRIVLVGDTAHSVTPAMAFGANLCMESVVELVNALHQAVVEAGNQVPTGFDLDRALS
LYQKRQLPRAMTSAVGLCAC*
Coding >Ophun1|5787
ATGTGGACCAATCTGTCGTCGTCTTCACATAGCAATGACCAGATGAACATCAAAACCACCGGCCGACTTCGAGTC
ATCATCGTGGGAGCCGGCATCGGCGGCCTCACCGCGGCACTCGCATTGAACCGGGCCGGCATCGACTTTGTCATC
ATCGAGAAGCATGCATCTGTGCTCGAGCCGATGGGTTCATCCATCACCTTGACTCCCGGGTCGCAGAGGATCCTG
CATCAGCTGGGGCTCCTGAACAAGATCAAGACACTCTCGCGACCCTATTCCCGAGGCGTCGAGGTTCGAGAGCCC
AACGGCCAGGTGCTATCTCAAGTCTCCTTGTCGACCTTTGCCATGATGCATGGAGAAGGCATGATCATTCTGCAG
CGTGATTTGTTCATCAGAACGCTGTACGAGGCGCTACCCGCCGATTCCGAGTTTATCTTGGGCCGTTCGGTTGTG
TCTGTCGAGCACGAAGCCGGAGCCGTGCGCGTTCATCTCTCAGATGGACTCTCGAGAACGGGTCATCTGGTGGTG
GGCTCGGACGGCGTCAGGGGCGTCGTCCGGGTCGCAATGTGGAAACATGCCGATGCCACGGCCCCGGGGCTCATA
CCTCGAGAGGATAGAGAAGCGGTGTGGTGCAGTTGGAGGTCTCTCTGGGCCACTTGCGCGGAAGACGAACGGGTG
ACAAACGACGTCATCATGAGTAGCCATCACAACCGGTCATGTACAACCGTTCTCTCCTCCTTGGGAAGCCTGACC
TTGGGCGTAATGGTCAAGACGGGCTCGGCCGGACGACGAAGTAAGCGGCTGCCTACGTACAAGGCCGAGGAAGCG
GACGAGATGGCGGCCTCGGTTGCACGCCTGCCACTCAACGAGAGCCTGACGTTTGGTGATCTCTGGGCTAAGAAG
CTTCGAGGAGGCATGACGGACATCGAAGTGGGCGTCTTGAATCGCTGGCATTACGGGCGAATCGTCCTCGTTGGC
GATACAGCCCACAGCGTAACGCCAGCCATGGCATTTGGCGCCAATTTGTGCATGGAAAGCGTCGTCGAGCTCGTC
AACGCCCTTCACCAGGCCGTCGTCGAGGCAGGGAACCAGGTGCCGACGGGCTTCGATCTCGACAGGGCGCTGAGC
CTTTACCAGAAACGCCAGCTCCCGCGTGCCATGACGTCCGCTGTTGGACTTTGTGCGTGTTGA
Transcript >Ophun1|5787
ATGTGGACCAATCTGTCGTCGTCTTCACATAGCAATGACCAGATGAACATCAAAACCACCGGCCGACTTCGAGTC
ATCATCGTGGGAGCCGGCATCGGCGGCCTCACCGCGGCACTCGCATTGAACCGGGCCGGCATCGACTTTGTCATC
ATCGAGAAGCATGCATCTGTGCTCGAGCCGATGGGTTCATCCATCACCTTGACTCCCGGGTCGCAGAGGATCCTG
CATCAGCTGGGGCTCCTGAACAAGATCAAGACACTCTCGCGACCCTATTCCCGAGGCGTCGAGGTTCGAGAGCCC
AACGGCCAGGTGCTATCTCAAGTCTCCTTGTCGACCTTTGCCATGATGCATGGAGAAGGCATGATCATTCTGCAG
CGTGATTTGTTCATCAGAACGCTGTACGAGGCGCTACCCGCCGATTCCGAGTTTATCTTGGGCCGTTCGGTTGTG
TCTGTCGAGCACGAAGCCGGAGCCGTGCGCGTTCATCTCTCAGATGGACTCTCGAGAACGGGTCATCTGGTGGTG
GGCTCGGACGGCGTCAGGGGCGTCGTCCGGGTCGCAATGTGGAAACATGCCGATGCCACGGCCCCGGGGCTCATA
CCTCGAGAGGATAGAGAAGCGGTGTGGTGCAGTTGGAGGTCTCTCTGGGCCACTTGCGCGGAAGACGAACGGGTG
ACAAACGACGTCATCATGAGTAGCCATCACAACCGGTCATGTACAACCGTTCTCTCCTCCTTGGGAAGCCTGACC
TTGGGCGTAATGGTCAAGACGGGCTCGGCCGGACGACGAAGTAAGCGGCTGCCTACGTACAAGGCCGAGGAAGCG
GACGAGATGGCGGCCTCGGTTGCACGCCTGCCACTCAACGAGAGCCTGACGTTTGGTGATCTCTGGGCTAAGAAG
CTTCGAGGAGGCATGACGGACATCGAAGTGGGCGTCTTGAATCGCTGGCATTACGGGCGAATCGTCCTCGTTGGC
GATACAGCCCACAGCGTAACGCCAGCCATGGCATTTGGCGCCAATTTGTGCATGGAAAGCGTCGTCGAGCTCGTC
AACGCCCTTCACCAGGCCGTCGTCGAGGCAGGGAACCAGGTGCCGACGGGCTTCGATCTCGACAGGGCGCTGAGC
CTTTACCAGAAACGCCAGCTCCCGCGTGCCATGACGTCCGCTGTTGGACTTTGTGCGTGTTGA
Gene >Ophun1|5787
ATGTGGACCAATCTGTCGTCGTCTTCACATAGCAATGACCAGTAAGCATCGACAAACCCATCCATATGGCTTGTG
ACGAGTCTTGTCAACTGATGTAAGCCACATAGCAGATGCCAAGTCCATCACGTACATTGATATACTCTTAAGCCC
GAGACGTCTCGCCAGTTAAGACCGAGTAACTTGGTCTTTATTATTCAGTGGCTGGACCACTGTGTCGTGTCTTTG
AACAGGATGAACATCAAAACCACCGGCCGACTTCGAGTCATCATCGTGGGAGCCGGCATCGGCGGCCTCACCGCG
GCACTCGCATTGAACCGGGCCGGCATCGACTTTGTCATCATCGAGAAGCATGCATCTGTGCTCGAGCCGATGGGT
TCATCCATCACCTTGACTCCCGGGTCGCAGAGGATCCTGCATCAGCTGGGGCTCCTGAACAAGATCAAGACACTC
TCGCGACCCTATTCCCGAGGCGTCGAGGTTCGAGAGCCCAACGGCCAGGTGCTATCTCAAGTCTCCTTGTCGACC
TTTGCCATGATGTGAGAGCGGGCAGACTCCCCCATCAACGGTGCATCCTCCCTGACAAGGCTGGCCAAGGCATGG
AGAAGGCATGATCATTCTGCAGCGTGATTTGTTCATCAGAACGCTGTACGAGGCGCTACCCGCCGATTCCGAGTT
TATCTTGGGCCGTTCGGTTGTGTCTGTCGAGCACGAAGCCGGAGCCGTGCGCGTTCATCTCTCAGATGGACTCTC
GAGAACGGGTCATCTGGTGGTGGGCTCGGACGGCGTCAGGGGCGTCGTCCGGGTCGCAATGTGGAAACATGCCGA
TGCCACGGCCCCGGGGCTCATACCTCGAGAGGATAGAGAAGGTGAGCAGCCCCTTTTGCACCCTTGCCAACGCCT
GCTCACAATTTGCAGCGGTGTGGTGCAGTTGGAGGTCTCTCTGGGCCACTTGCGCGGAAGACGAACGGGTGACAA
ACGACGTCATCATGAGTAGCCATCACAACCGGTCATGTACAACCGTTCTCTCCTCCTTGGGAAGCCTGACCTTGG
GCGTAATGGTCAAGACGGGCTCGGCCGGACGACGAAGTAAGCGGCTGCCTACGTACAAGGCCGAGGAAGCGGACG
AGATGGCGGCCTCGGTTGCACGCCTGCCACTCAACGAGAGCCTGACGTTTGGTGATCTCTGGGCTAAGAAGCTTC
GAGGAGGCATGACGGACATCGAAGTGGGCGTCTTGAATCGCTGGCATTACGGGCGAATCGTCCTCGTTGGCGATA
CAGCCCACAGCGTGAGTTACGACAAAGGACCTGAGCTGAGCTGCAGCATCTGACTGGGGCTGAGCAGGTAACGCC
AGCCATGGCATTTGGCGCCAATTTGTGCATGGAAAGCGTCGTCGAGCTCGTCAACGCCCTTCACCAGGCCGTCGT
CGAGGCAGGGAACCAGGTGCCGACGGGCTTCGATCTCGACAGGGCGCTGAGCCTTTACCAGAAACGCCAGCTCCC
GCGTGCCATGACGGTGTGCCGCCTGACGATGCTGTACGACCGGCTGCACGCGTGGGACGCGACGTGGATGAGGCT
GTGGTCGCTTTATCTGGCTCGCTGGCTGAATCCGTTGCTGGTGCCGCTCTTGCTCGGCTACATGTTCCGCGGAAG
TCCGCTGTTGGACTTTGTGCGTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail