Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5784
Gene name
LocationContig_595:57..4586
Strand+
Gene length (bp)4529
Transcript length (bp)4407
Coding sequence length (bp)4407
Protein length (aa) 1469

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17109 Goodbye fungal STAND N-terminal Goodbye domain 2.2E-28 23 141

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 273 607 4.0E-10

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2841
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7504
Ophiocordyceps australis map64 (Brazil) OphauB2|4773
Ophiocordyceps camponoti-floridani Ophcf2|05911
Ophiocordyceps camponoti-rufipedis Ophun1|5784 (this protein)
Ophiocordyceps kimflemingae Ophio5|4840
Ophiocordyceps subramaniannii Hirsu2|4647

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5784
MHLDKMDDDDVDVEGQFAAILADAARIHKEKSGSSLQDFAEPSMASVDDLQRQLNLHNAGFAAFRAKRKTIFAAA
SAALRPVELVGDIAAGAASHAFAPSQTIYAAALFLINAGHNVSATYDSIVELFDQLSDFTERLDVYVRYPLSAPL
RQKVVSILVALFEVMVLATKEIRRGRLRAYFRRLIGSSSPVMPALERLKALTQGEERQVLADTFGGVSDIGAKAG
RIESIVTQVNHGVQVLQVEHRELANRPKDEKLRAILSPSPFADDIYCALKKSIVPNTGAWILADEGLASWLRAEV
PYLWIFGNAGTGKSFVTTSVISWALENAAKFPYVGYFYFRADNPETRSVLQALRDVAYQLSEKDPVYRRELVSKL
EHRGDIKTVASAFRKLFESRTDGGSQRIKYIFLDGIDEAEADEMRQLLSCLSPDEGQVPRPPHFQFALVGRPYLS
DNVAVKLDPSGRSLATVQVTSDRNASDVKAFINSSVFHSRVLSRTSVEFKTKVIAALERQADGFFILAKFMVDDV
NRKRHLSSILESLQTYPKEINGVLQRTLTDLCSTITDEEARDLREILCWVTCAEEPLTLGQLEAALVLRFGDPPM
FLEESLRRQYSCFFDLERDDGLTTDDLVKDAGRLQRELRKDLSPPSRLFSGVPFHQGRSFSAGEASMPKRRLSPA
PTPNRNSISGPGLPAAVELGTPSRVSGSSFDVASDTDFRSSKSTTRVAFFHSSVRDFFLISRPPAASPSLGFDLD
EARLRIVKTCLKIFIDRDWFLALDLGPGKEALRQYAAWYWQEHVASMDPAAVPRQEKRQLAGQLYRMLTDEDTVH
DWSIMYEKNDEGLEVLNDANIKGLRRWFRDADVLDGLDETAAAFARASTARAAGVCEKIGRYYARAWLAGDYEGY
VPPLFCFKIVQSVAYMEAGYDWAQGNGEDTVQQRVERATSWAAQEETAHWHRRVGSSYLMMGLRDEALRHYDAAL
AMDQNNVETRSRIAYCLYKDGRYRDALEQSAECVAVEERDVRDGRLSPTELRDSRWRLYRNYLVIANCAHRTGDE
ERTHAFFAKAMAASGDAGLGPSESLEAETSYLEALADDNRHGHMMAVARRMAAQPSATGHDRGRFADLLLEHHDS
DLVLDWLPKAACKARELVFLVEQAGHALEVADGLSDSTRALYLRLTLGTAYAYNGDADEALALFEHMCLLEARPR
GTIATRRAHAASFQKLAGLYKHKALLAGLRTVEAGAWVRKLEAVQRKQREHRNADMPSVMLGSDVNVASIYLASF
YRLQGRDDEANALLAGLIGDSLAILSDSEPQNDVFALDNLLRIFIAADDVANAQALARSMRRVNPEASVSSPGES
PIERRNNAPKLSGIRPHDRSCFQCLDTVAASAEFVMCRLCMESFCRRCLDKVILDDQDEGGREGARGIERLTCQS
DHEWFTVEPLNRVLHTGEILLQDDSVQGFAEWKDGVRREWGVA*
Coding >Ophun1|5784
ATGCATCTCGACAAGATGGACGACGACGACGTCGATGTCGAGGGTCAGTTTGCCGCTATTCTGGCCGACGCCGCC
AGGATCCACAAGGAAAAGTCTGGTAGCTCCCTCCAAGACTTCGCCGAACCGTCCATGGCCTCGGTCGACGACCTC
CAGCGTCAGCTCAACCTCCACAACGCTGGCTTCGCCGCCTTTCGTGCCAAGCGCAAGACCATCTTCGCCGCTGCC
TCGGCCGCCCTCCGGCCCGTCGAGCTCGTCGGCGATATTGCCGCCGGCGCCGCCTCACACGCCTTTGCGCCGTCT
CAGACCATCTACGCCGCAGCCCTCTTCCTCATCAACGCCGGCCACAACGTCTCGGCCACGTACGACTCCATCGTC
GAGCTGTTTGACCAGCTGTCGGACTTTACCGAACGGCTCGACGTCTATGTGCGATACCCCTTGTCCGCTCCGCTG
CGGCAAAAGGTCGTCTCCATTCTCGTCGCCCTCTTCGAAGTCATGGTCCTGGCCACCAAGGAGATCCGCCGCGGT
CGGTTGAGGGCCTACTTCAGGCGCCTCATCGGCTCCTCCAGCCCCGTCATGCCGGCACTCGAGCGGCTCAAGGCC
TTGACCCAAGGCGAGGAAAGACAGGTCCTGGCCGACACCTTTGGCGGCGTGTCCGATATTGGTGCCAAGGCCGGC
CGTATCGAGAGCATCGTCACCCAGGTCAACCACGGGGTTCAGGTTCTGCAGGTCGAACACCGCGAGCTGGCGAAC
CGGCCCAAAGACGAGAAGCTGCGAGCCATTCTGAGCCCCTCACCCTTTGCCGACGACATATACTGCGCCCTCAAG
AAGTCCATTGTCCCCAATACGGGCGCCTGGATTCTTGCCGACGAGGGTCTGGCGTCCTGGCTTCGAGCAGAGGTC
CCCTATCTGTGGATATTCGGCAATGCTGGCACCGGCAAGAGCTTCGTCACCACGAGCGTCATCTCTTGGGCGCTG
GAAAATGCCGCCAAGTTCCCCTACGTTGGCTACTTTTACTTCCGCGCAGACAATCCCGAAACCCGGTCCGTCCTA
CAGGCCCTTCGCGACGTTGCCTACCAGCTCAGCGAAAAGGATCCCGTCTACCGCCGAGAGCTCGTGTCCAAGCTG
GAGCACAGAGGCGACATCAAGACGGTGGCGAGCGCGTTTCGGAAACTCTTTGAGTCTCGGACGGACGGCGGCAGC
CAGAGGATCAAGTACATCTTCCTCGACGGCATCGACGAGGCCGAAGCCGACGAAATGCGCCAGCTGCTCAGCTGC
CTCTCTCCCGATGAGGGCCAAGTGCCTCGGCCGCCTCACTTTCAGTTCGCCCTCGTCGGGAGGCCCTACCTTTCG
GACAACGTGGCCGTCAAGCTGGATCCGAGCGGCCGCAGCTTGGCAACGGTTCAGGTCACGTCGGATCGCAACGCC
AGCGACGTAAAGGCCTTTATCAACAGCAGCGTCTTCCACTCGCGCGTCCTGAGCCGAACCAGCGTCGAATTCAAA
ACAAAGGTGATTGCCGCCCTCGAGCGCCAGGCCGACGGCTTCTTCATCTTGGCCAAGTTCATGGTCGACGACGTC
AACCGCAAGCGCCACCTGAGCTCCATCCTCGAGAGCCTGCAGACGTACCCCAAGGAGATTAACGGCGTGCTGCAG
CGGACATTAACCGATCTGTGCAGCACCATTACCGACGAGGAGGCTCGAGATCTTCGCGAGATTCTCTGCTGGGTG
ACGTGCGCCGAAGAGCCCCTGACGCTGGGACAGCTCGAGGCGGCGCTGGTACTGCGCTTCGGTGATCCGCCCATG
TTCCTCGAGGAGTCGCTGCGGCGTCAGTACTCGTGTTTCTTCGACCTCGAACGCGACGACGGTCTGACGACCGAC
GACCTCGTCAAGGACGCGGGGAGACTGCAGCGCGAGCTAAGAAAGGACCTCAGCCCGCCGTCGCGCCTCTTCAGC
GGCGTCCCGTTCCATCAGGGCCGGAGCTTCAGCGCGGGCGAGGCTTCGATGCCCAAGCGTCGCCTGAGCCCGGCA
CCGACGCCCAACCGGAACAGCATCAGCGGCCCCGGCCTCCCTGCCGCCGTCGAGCTCGGGACTCCCTCGCGCGTG
AGCGGATCGTCGTTTGACGTGGCCAGCGACACCGACTTCCGGTCGAGCAAGTCGACGACGCGCGTCGCCTTTTTC
CACTCGTCTGTCCGGGACTTTTTCCTTATCAGCCGACCTCCGGCAGCGAGTCCGTCTCTCGGCTTCGACTTGGAC
GAGGCCCGGCTCCGGATCGTCAAGACGTGTCTCAAGATCTTCATCGACAGGGACTGGTTCCTGGCGCTCGACCTC
GGGCCCGGAAAGGAGGCGCTCCGGCAATACGCGGCATGGTACTGGCAGGAACACGTGGCGTCGATGGACCCGGCA
GCGGTGCCACGGCAGGAGAAGCGGCAGCTGGCCGGGCAGCTGTACCGGATGCTGACGGACGAGGACACGGTTCAC
GACTGGAGCATCATGTACGAGAAGAACGACGAGGGCCTCGAGGTGCTCAACGACGCCAACATCAAGGGCCTGCGG
CGCTGGTTCCGCGACGCCGACGTGTTGGACGGGCTGGACGAGACGGCGGCGGCCTTTGCGCGGGCTTCGACGGCG
CGAGCGGCGGGAGTATGCGAAAAGATTGGGCGATACTACGCGCGGGCGTGGCTGGCGGGCGACTACGAGGGCTAC
GTGCCGCCGCTGTTCTGCTTCAAGATTGTACAGAGCGTGGCTTACATGGAGGCAGGCTACGACTGGGCGCAAGGC
AACGGTGAGGACACGGTCCAGCAGCGGGTGGAGCGGGCGACGAGCTGGGCGGCGCAGGAGGAGACGGCGCACTGG
CACCGGCGGGTTGGCAGCTCCTATCTGATGATGGGCCTGCGGGACGAGGCGCTGCGGCATTACGACGCGGCGCTG
GCCATGGACCAGAACAACGTCGAGACGCGCAGCCGCATCGCCTACTGCCTGTACAAGGACGGACGATATCGCGAC
GCGCTGGAGCAGTCGGCCGAGTGCGTGGCCGTCGAGGAGCGCGACGTGCGCGACGGCAGGCTCTCTCCGACTGAG
CTCCGCGACAGCAGATGGCGCCTGTACCGGAACTACCTGGTCATTGCCAATTGCGCGCACCGGACGGGCGACGAG
GAGCGGACGCACGCCTTCTTCGCCAAGGCCATGGCGGCTTCCGGAGACGCCGGCCTCGGCCCGTCCGAGTCGCTC
GAGGCCGAGACCAGCTATCTAGAGGCCCTGGCCGACGACAACCGGCACGGCCACATGATGGCGGTGGCCCGGCGC
ATGGCGGCTCAGCCGTCGGCAACGGGCCATGATAGGGGCCGGTTCGCCGACCTGCTGCTGGAGCACCACGACTCG
GATCTGGTGCTGGACTGGCTGCCCAAGGCGGCCTGCAAGGCGCGCGAGCTCGTCTTCCTCGTCGAGCAGGCCGGT
CACGCGCTCGAGGTGGCCGACGGCCTGAGCGACTCGACTCGGGCGCTGTATCTGCGTCTGACGCTGGGCACCGCC
TACGCCTACAACGGCGACGCCGACGAGGCGCTGGCCCTGTTCGAGCACATGTGCCTGCTCGAGGCTCGCCCGCGC
GGGACCATCGCCACGCGCCGCGCCCACGCCGCCTCGTTCCAGAAGCTGGCCGGCCTGTACAAACACAAGGCGCTG
CTGGCCGGGCTGCGCACCGTCGAGGCCGGCGCCTGGGTTCGCAAGCTGGAGGCGGTACAGCGCAAGCAGCGCGAG
CACCGCAACGCCGACATGCCGTCCGTCATGCTGGGCTCCGACGTCAACGTGGCCTCGATCTACCTCGCCAGCTTC
TACCGACTGCAGGGCCGCGACGACGAGGCCAACGCGCTGCTGGCGGGACTCATCGGCGACAGCCTGGCCATCCTG
TCGGACAGCGAGCCCCAGAACGACGTCTTCGCCCTCGATAACCTGCTGCGCATCTTCATCGCCGCCGACGACGTG
GCCAACGCGCAGGCGCTCGCCAGGTCCATGCGCCGCGTCAACCCGGAGGCCTCGGTGAGCTCCCCCGGCGAATCC
CCCATCGAGCGGCGCAACAACGCCCCCAAGCTATCGGGCATAAGGCCCCACGACCGGAGCTGCTTCCAGTGTCTC
GACACGGTGGCCGCCTCGGCCGAGTTCGTCATGTGCCGCCTCTGCATGGAGAGTTTCTGCCGGAGGTGTCTGGAC
AAGGTCATCCTCGACGACCAGGACGAGGGGGGCAGGGAGGGGGCGAGGGGTATCGAGAGGCTGACGTGCCAGAGC
GATCATGAGTGGTTTACGGTCGAGCCGCTTAATCGGGTGTTGCACACGGGGGAGATTCTGTTGCAGGATGATAGT
GTGCAGGGGTTTGCCGAGTGGAAGGATGGGGTGAGGAGGGAATGGGGGGTTGCGTAG
Transcript >Ophun1|5784
ATGCATCTCGACAAGATGGACGACGACGACGTCGATGTCGAGGGTCAGTTTGCCGCTATTCTGGCCGACGCCGCC
AGGATCCACAAGGAAAAGTCTGGTAGCTCCCTCCAAGACTTCGCCGAACCGTCCATGGCCTCGGTCGACGACCTC
CAGCGTCAGCTCAACCTCCACAACGCTGGCTTCGCCGCCTTTCGTGCCAAGCGCAAGACCATCTTCGCCGCTGCC
TCGGCCGCCCTCCGGCCCGTCGAGCTCGTCGGCGATATTGCCGCCGGCGCCGCCTCACACGCCTTTGCGCCGTCT
CAGACCATCTACGCCGCAGCCCTCTTCCTCATCAACGCCGGCCACAACGTCTCGGCCACGTACGACTCCATCGTC
GAGCTGTTTGACCAGCTGTCGGACTTTACCGAACGGCTCGACGTCTATGTGCGATACCCCTTGTCCGCTCCGCTG
CGGCAAAAGGTCGTCTCCATTCTCGTCGCCCTCTTCGAAGTCATGGTCCTGGCCACCAAGGAGATCCGCCGCGGT
CGGTTGAGGGCCTACTTCAGGCGCCTCATCGGCTCCTCCAGCCCCGTCATGCCGGCACTCGAGCGGCTCAAGGCC
TTGACCCAAGGCGAGGAAAGACAGGTCCTGGCCGACACCTTTGGCGGCGTGTCCGATATTGGTGCCAAGGCCGGC
CGTATCGAGAGCATCGTCACCCAGGTCAACCACGGGGTTCAGGTTCTGCAGGTCGAACACCGCGAGCTGGCGAAC
CGGCCCAAAGACGAGAAGCTGCGAGCCATTCTGAGCCCCTCACCCTTTGCCGACGACATATACTGCGCCCTCAAG
AAGTCCATTGTCCCCAATACGGGCGCCTGGATTCTTGCCGACGAGGGTCTGGCGTCCTGGCTTCGAGCAGAGGTC
CCCTATCTGTGGATATTCGGCAATGCTGGCACCGGCAAGAGCTTCGTCACCACGAGCGTCATCTCTTGGGCGCTG
GAAAATGCCGCCAAGTTCCCCTACGTTGGCTACTTTTACTTCCGCGCAGACAATCCCGAAACCCGGTCCGTCCTA
CAGGCCCTTCGCGACGTTGCCTACCAGCTCAGCGAAAAGGATCCCGTCTACCGCCGAGAGCTCGTGTCCAAGCTG
GAGCACAGAGGCGACATCAAGACGGTGGCGAGCGCGTTTCGGAAACTCTTTGAGTCTCGGACGGACGGCGGCAGC
CAGAGGATCAAGTACATCTTCCTCGACGGCATCGACGAGGCCGAAGCCGACGAAATGCGCCAGCTGCTCAGCTGC
CTCTCTCCCGATGAGGGCCAAGTGCCTCGGCCGCCTCACTTTCAGTTCGCCCTCGTCGGGAGGCCCTACCTTTCG
GACAACGTGGCCGTCAAGCTGGATCCGAGCGGCCGCAGCTTGGCAACGGTTCAGGTCACGTCGGATCGCAACGCC
AGCGACGTAAAGGCCTTTATCAACAGCAGCGTCTTCCACTCGCGCGTCCTGAGCCGAACCAGCGTCGAATTCAAA
ACAAAGGTGATTGCCGCCCTCGAGCGCCAGGCCGACGGCTTCTTCATCTTGGCCAAGTTCATGGTCGACGACGTC
AACCGCAAGCGCCACCTGAGCTCCATCCTCGAGAGCCTGCAGACGTACCCCAAGGAGATTAACGGCGTGCTGCAG
CGGACATTAACCGATCTGTGCAGCACCATTACCGACGAGGAGGCTCGAGATCTTCGCGAGATTCTCTGCTGGGTG
ACGTGCGCCGAAGAGCCCCTGACGCTGGGACAGCTCGAGGCGGCGCTGGTACTGCGCTTCGGTGATCCGCCCATG
TTCCTCGAGGAGTCGCTGCGGCGTCAGTACTCGTGTTTCTTCGACCTCGAACGCGACGACGGTCTGACGACCGAC
GACCTCGTCAAGGACGCGGGGAGACTGCAGCGCGAGCTAAGAAAGGACCTCAGCCCGCCGTCGCGCCTCTTCAGC
GGCGTCCCGTTCCATCAGGGCCGGAGCTTCAGCGCGGGCGAGGCTTCGATGCCCAAGCGTCGCCTGAGCCCGGCA
CCGACGCCCAACCGGAACAGCATCAGCGGCCCCGGCCTCCCTGCCGCCGTCGAGCTCGGGACTCCCTCGCGCGTG
AGCGGATCGTCGTTTGACGTGGCCAGCGACACCGACTTCCGGTCGAGCAAGTCGACGACGCGCGTCGCCTTTTTC
CACTCGTCTGTCCGGGACTTTTTCCTTATCAGCCGACCTCCGGCAGCGAGTCCGTCTCTCGGCTTCGACTTGGAC
GAGGCCCGGCTCCGGATCGTCAAGACGTGTCTCAAGATCTTCATCGACAGGGACTGGTTCCTGGCGCTCGACCTC
GGGCCCGGAAAGGAGGCGCTCCGGCAATACGCGGCATGGTACTGGCAGGAACACGTGGCGTCGATGGACCCGGCA
GCGGTGCCACGGCAGGAGAAGCGGCAGCTGGCCGGGCAGCTGTACCGGATGCTGACGGACGAGGACACGGTTCAC
GACTGGAGCATCATGTACGAGAAGAACGACGAGGGCCTCGAGGTGCTCAACGACGCCAACATCAAGGGCCTGCGG
CGCTGGTTCCGCGACGCCGACGTGTTGGACGGGCTGGACGAGACGGCGGCGGCCTTTGCGCGGGCTTCGACGGCG
CGAGCGGCGGGAGTATGCGAAAAGATTGGGCGATACTACGCGCGGGCGTGGCTGGCGGGCGACTACGAGGGCTAC
GTGCCGCCGCTGTTCTGCTTCAAGATTGTACAGAGCGTGGCTTACATGGAGGCAGGCTACGACTGGGCGCAAGGC
AACGGTGAGGACACGGTCCAGCAGCGGGTGGAGCGGGCGACGAGCTGGGCGGCGCAGGAGGAGACGGCGCACTGG
CACCGGCGGGTTGGCAGCTCCTATCTGATGATGGGCCTGCGGGACGAGGCGCTGCGGCATTACGACGCGGCGCTG
GCCATGGACCAGAACAACGTCGAGACGCGCAGCCGCATCGCCTACTGCCTGTACAAGGACGGACGATATCGCGAC
GCGCTGGAGCAGTCGGCCGAGTGCGTGGCCGTCGAGGAGCGCGACGTGCGCGACGGCAGGCTCTCTCCGACTGAG
CTCCGCGACAGCAGATGGCGCCTGTACCGGAACTACCTGGTCATTGCCAATTGCGCGCACCGGACGGGCGACGAG
GAGCGGACGCACGCCTTCTTCGCCAAGGCCATGGCGGCTTCCGGAGACGCCGGCCTCGGCCCGTCCGAGTCGCTC
GAGGCCGAGACCAGCTATCTAGAGGCCCTGGCCGACGACAACCGGCACGGCCACATGATGGCGGTGGCCCGGCGC
ATGGCGGCTCAGCCGTCGGCAACGGGCCATGATAGGGGCCGGTTCGCCGACCTGCTGCTGGAGCACCACGACTCG
GATCTGGTGCTGGACTGGCTGCCCAAGGCGGCCTGCAAGGCGCGCGAGCTCGTCTTCCTCGTCGAGCAGGCCGGT
CACGCGCTCGAGGTGGCCGACGGCCTGAGCGACTCGACTCGGGCGCTGTATCTGCGTCTGACGCTGGGCACCGCC
TACGCCTACAACGGCGACGCCGACGAGGCGCTGGCCCTGTTCGAGCACATGTGCCTGCTCGAGGCTCGCCCGCGC
GGGACCATCGCCACGCGCCGCGCCCACGCCGCCTCGTTCCAGAAGCTGGCCGGCCTGTACAAACACAAGGCGCTG
CTGGCCGGGCTGCGCACCGTCGAGGCCGGCGCCTGGGTTCGCAAGCTGGAGGCGGTACAGCGCAAGCAGCGCGAG
CACCGCAACGCCGACATGCCGTCCGTCATGCTGGGCTCCGACGTCAACGTGGCCTCGATCTACCTCGCCAGCTTC
TACCGACTGCAGGGCCGCGACGACGAGGCCAACGCGCTGCTGGCGGGACTCATCGGCGACAGCCTGGCCATCCTG
TCGGACAGCGAGCCCCAGAACGACGTCTTCGCCCTCGATAACCTGCTGCGCATCTTCATCGCCGCCGACGACGTG
GCCAACGCGCAGGCGCTCGCCAGGTCCATGCGCCGCGTCAACCCGGAGGCCTCGGTGAGCTCCCCCGGCGAATCC
CCCATCGAGCGGCGCAACAACGCCCCCAAGCTATCGGGCATAAGGCCCCACGACCGGAGCTGCTTCCAGTGTCTC
GACACGGTGGCCGCCTCGGCCGAGTTCGTCATGTGCCGCCTCTGCATGGAGAGTTTCTGCCGGAGGTGTCTGGAC
AAGGTCATCCTCGACGACCAGGACGAGGGGGGCAGGGAGGGGGCGAGGGGTATCGAGAGGCTGACGTGCCAGAGC
GATCATGAGTGGTTTACGGTCGAGCCGCTTAATCGGGTGTTGCACACGGGGGAGATTCTGTTGCAGGATGATAGT
GTGCAGGGGTTTGCCGAGTGGAAGGATGGGGTGAGGAGGGAATGGGGGGTTGCGTAG
Gene >Ophun1|5784
ATGCATCTCGACAAGATGGACGACGACGACGTCGATGTCGAGGGTCAGTTTGCCGCTATTCTGGCCGACGCCGCC
AGGATCCACAAGGAAAAGTCTGGTAGCTCCCTCCAAGACTTCGCCGAACCGTCCATGGCCTCGGTCGACGACCTC
CAGCGTCAGCTCAACCTCCACAACGCTGGCTTCGCCGCCTTTCGTGCCAAGCGCAAGACCATCTTCGCCGCTGCC
TCGGCCGCCCTCCGGCCCGTCGAGCTCGTCGGCGATATTGCCGCCGGCGCCGCCTCACACGCCTTTGCGCCGTCT
CAGACCATCTACGCCGCAGCCCTCTTCCTCATCAACGCCGGCCACAACGTCTCGGCCACGTACGACTCCATCGTC
GAGCTGTTTGACCAGCTGTCGGTACTTCTCTCGATCACGACCGCTCATCGGGACTCGACTCGCTGACTCTGTCAG
GACTTTACCGAACGGCTCGACGTCTATGTGCGATACCCCTTGTCCGCTCCGCTGCGGCAAAAGGTCGTCTCCATT
CTCGTCGCCCTCTTCGAAGTCATGGTCCTGGCCACCAAGGAGATCCGCCGCGGTCGGTTGAGGGCCTACTTCAGG
CGCCTCATCGGCTCCTCCAGCCCCGTCATGCCGGCACTCGAGCGGCTCAAGGCCTTGACCCAAGGCGAGGAAAGA
CAGGTCCTGGCCGACACCTTTGGCGGCGTGTCCGATATTGGTGCCAAGGCCGGCCGTATCGAGAGCATCGTCACC
CAGGTCAACCACGGGGTTCAGGTTCTGCAGGTCGAACACCGCGAGCTGGCGAACCGGCCCAAAGACGAGAAGCTG
CGAGCCATTCTGAGCCCCTCACCCTTTGCCGACGACATATACTGCGCCCTCAAGAAGTCCATTGTCCCCAATACG
GGCGCCTGGATTCTTGCCGACGAGGGTCTGGCGTCCTGGCTTCGAGCAGAGGTCCCCTATCTGTGGATATTCGGC
AATGCTGGTGAGTTCTTTTGCCTTCTCACCCATCCGAGACCACCTGGGAAGGCAACTGATGGGTCAAACCAACAG
GCACCGGCAAGAGCTTCGTCACCACGAGCGTCATCTCTTGGGCGCTGGAAAATGCCGCCAAGTTCCCCTACGTTG
GCTACTTTTACTTCCGCGCAGACAATCCCGAAACCCGGTCCGTCCTACAGGCCCTTCGCGACGTTGCCTACCAGC
TCAGCGAAAAGGATCCCGTCTACCGCCGAGAGCTCGTGTCCAAGCTGGAGCACAGAGGCGACATCAAGACGGTGG
CGAGCGCGTTTCGGAAACTCTTTGAGTCTCGGACGGACGGCGGCAGCCAGAGGATCAAGTACATCTTCCTCGACG
GCATCGACGAGGCCGAAGCCGACGAAATGCGCCAGCTGCTCAGCTGCCTCTCTCCCGATGAGGGCCAAGTGCCTC
GGCCGCCTCACTTTCAGTTCGCCCTCGTCGGGAGGCCCTACCTTTCGGACAACGTGGCCGTCAAGCTGGATCCGA
GCGGCCGCAGCTTGGCAACGGTTCAGGTCACGTCGGATCGCAACGCCAGCGACGTAAAGGCCTTTATCAACAGCA
GCGTCTTCCACTCGCGCGTCCTGAGCCGAACCAGCGTCGAATTCAAAACAAAGGTGATTGCCGCCCTCGAGCGCC
AGGCCGACGGCTTCTTCATCTTGGCCAAGTTCATGGTCGACGACGTCAACCGCAAGCGCCACCTGAGCTCCATCC
TCGAGAGCCTGCAGACGTACCCCAAGGAGATTAACGGCGTGCTGCAGCGGACATTAACCGATCTGTGCAGCACCA
TTACCGACGAGGAGGCTCGAGATCTTCGCGAGATTCTCTGCTGGGTGACGTGCGCCGAAGAGCCCCTGACGCTGG
GACAGCTCGAGGCGGCGCTGGTACTGCGCTTCGGTGATCCGCCCATGTTCCTCGAGGAGTCGCTGCGGCGTCAGT
ACTCGTGTTTCTTCGACCTCGAACGCGACGACGGTCTGACGACCGACGACCTCGTCAAGGACGCGGGGAGACTGC
AGCGCGAGCTAAGAAAGGACCTCAGCCCGCCGTCGCGCCTCTTCAGCGGCGTCCCGTTCCATCAGGGCCGGAGCT
TCAGCGCGGGCGAGGCTTCGATGCCCAAGCGTCGCCTGAGCCCGGCACCGACGCCCAACCGGAACAGCATCAGCG
GCCCCGGCCTCCCTGCCGCCGTCGAGCTCGGGACTCCCTCGCGCGTGAGCGGATCGTCGTTTGACGTGGCCAGCG
ACACCGACTTCCGGTCGAGCAAGTCGACGACGCGCGTCGCCTTTTTCCACTCGTCTGTCCGGGACTTTTTCCTTA
TCAGCCGACCTCCGGCAGCGAGTCCGTCTCTCGGCTTCGACTTGGACGAGGCCCGGCTCCGGATCGTCAAGACGT
GTCTCAAGATCTTCATCGACAGGGACTGGTTCCTGGCGCTCGACCTCGGGCCCGGAAAGGAGGCGCTCCGGCAAT
ACGCGGCATGGTACTGGCAGGAACACGTGGCGTCGATGGACCCGGCAGCGGTGCCACGGCAGGAGAAGCGGCAGC
TGGCCGGGCAGCTGTACCGGATGCTGACGGACGAGGACACGGTTCACGACTGGAGCATCATGTACGAGAAGAACG
ACGAGGGCCTCGAGGTGCTCAACGACGCCAACATCAAGGGCCTGCGGCGCTGGTTCCGCGACGCCGACGTGTTGG
ACGGGCTGGACGAGACGGCGGCGGCCTTTGCGCGGGCTTCGACGGCGCGAGCGGCGGGAGTATGCGAAAAGATTG
GGCGATACTACGCGCGGGCGTGGCTGGCGGGCGACTACGAGGGCTACGTGCCGCCGCTGTTCTGCTTCAAGATTG
TACAGAGCGTGGCTTACATGGAGGCAGGCTACGACTGGGCGCAAGGCAACGGTGAGGACACGGTCCAGCAGCGGG
TGGAGCGGGCGACGAGCTGGGCGGCGCAGGAGGAGACGGCGCACTGGCACCGGCGGGTTGGCAGCTCCTATCTGA
TGATGGGCCTGCGGGACGAGGCGCTGCGGCATTACGACGCGGCGCTGGCCATGGACCAGAACAACGTCGAGACGC
GCAGCCGCATCGCCTACTGCCTGTACAAGGACGGACGATATCGCGACGCGCTGGAGCAGTCGGCCGAGTGCGTGG
CCGTCGAGGAGCGCGACGTGCGCGACGGCAGGCTCTCTCCGACTGAGCTCCGCGACAGCAGATGGCGCCTGTACC
GGAACTACCTGGTCATTGCCAATTGCGCGCACCGGACGGGCGACGAGGAGCGGACGCACGCCTTCTTCGCCAAGG
CCATGGCGGCTTCCGGAGACGCCGGCCTCGGCCCGTCCGAGTCGCTCGAGGCCGAGACCAGCTATCTAGAGGCCC
TGGCCGACGACAACCGGCACGGCCACATGATGGCGGTGGCCCGGCGCATGGCGGCTCAGCCGTCGGCAACGGGCC
ATGATAGGGGCCGGTTCGCCGACCTGCTGCTGGAGCACCACGACTCGGATCTGGTGCTGGACTGGCTGCCCAAGG
CGGCCTGCAAGGCGCGCGAGCTCGTCTTCCTCGTCGAGCAGGCCGGTCACGCGCTCGAGGTGGCCGACGGCCTGA
GCGACTCGACTCGGGCGCTGTATCTGCGTCTGACGCTGGGCACCGCCTACGCCTACAACGGCGACGCCGACGAGG
CGCTGGCCCTGTTCGAGCACATGTGCCTGCTCGAGGCTCGCCCGCGCGGGACCATCGCCACGCGCCGCGCCCACG
CCGCCTCGTTCCAGAAGCTGGCCGGCCTGTACAAACACAAGGCGCTGCTGGCCGGGCTGCGCACCGTCGAGGCCG
GCGCCTGGGTTCGCAAGCTGGAGGCGGTACAGCGCAAGCAGCGCGAGCACCGCAACGCCGACATGCCGTCCGTCA
TGCTGGGCTCCGACGTCAACGTGGCCTCGATCTACCTCGCCAGCTTCTACCGACTGCAGGGCCGCGACGACGAGG
CCAACGCGCTGCTGGCGGGACTCATCGGCGACAGCCTGGCCATCCTGTCGGACAGCGAGCCCCAGAACGACGTCT
TCGCCCTCGATAACCTGCTGCGCATCTTCATCGCCGCCGACGACGTGGCCAACGCGCAGGCGCTCGCCAGGTCCA
TGCGCCGCGTCAACCCGGAGGCCTCGGTGAGCTCCCCCGGCGAATCCCCCATCGAGCGGCGCAACAACGCCCCCA
AGCTATCGGGCATAAGGCCCCACGACCGGAGCTGCTTCCAGTGTCTCGACACGGTGGCCGCCTCGGCCGAGTTCG
TCATGTGCCGCCTCTGCATGGAGAGTTTCTGCCGGAGGTGTCTGGACAAGGTCATCCTCGACGACCAGGACGAGG
GGGGCAGGGAGGGGGCGAGGGGTATCGAGAGGCTGACGTGCCAGAGCGATCATGAGTGGTTTACGGTCGAGCCGC
TTAATCGGGTGTTGCACACGGGGGAGATTCTGTTGCAGGATGATAGTGTGCAGGGGTTTGCCGAGTGGAAGGATG
GGGTGAGGAGGGAATGGGGGGTTGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail