Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5781
Gene name
LocationContig_594:6275..6938
Strand-
Gene length (bp)663
Transcript length (bp)591
Coding sequence length (bp)591
Protein length (aa) 197

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09420 Nop16 Ribosome biogenesis protein Nop16 3.3E-55 6 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4R9U5|NOP16_MAGO7 Nucleolar protein 16 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NOP16 PE=3 SV=2 1 191 8.0E-42
sp|A6RNR4|NOP16_BOTFB Nucleolar protein 16 OS=Botryotinia fuckeliana (strain B05.10) GN=nop16 PE=3 SV=1 1 191 3.0E-39
sp|Q5AVK6|NOP16_EMENI Nucleolar protein 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nop16 PE=3 SV=1 27 194 2.0E-37
sp|A1CFJ6|NOP16_ASPCL Nucleolar protein 16 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nop16 PE=3 SV=1 1 191 4.0E-37
sp|Q7S0I1|NOP16_NEUCR Nucleolar protein 16 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop-16 PE=3 SV=1 1 194 4.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4R9U5|NOP16_MAGO7 Nucleolar protein 16 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NOP16 PE=3 SV=2 1 191 8.0E-42
sp|A6RNR4|NOP16_BOTFB Nucleolar protein 16 OS=Botryotinia fuckeliana (strain B05.10) GN=nop16 PE=3 SV=1 1 191 3.0E-39
sp|Q5AVK6|NOP16_EMENI Nucleolar protein 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nop16 PE=3 SV=1 27 194 2.0E-37
sp|A1CFJ6|NOP16_ASPCL Nucleolar protein 16 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nop16 PE=3 SV=1 1 191 4.0E-37
sp|Q7S0I1|NOP16_NEUCR Nucleolar protein 16 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop-16 PE=3 SV=1 1 194 4.0E-36
sp|Q0UBQ5|NOP16_PHANO Nucleolar protein 16 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NOP16 PE=3 SV=3 1 193 9.0E-36
sp|Q0CDP3|NOP16_ASPTN Nucleolar protein 16 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nop16 PE=3 SV=1 1 191 2.0E-35
sp|A1CYJ1|NOP16_NEOFI Nucleolar protein 16 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nop16 PE=3 SV=1 1 191 2.0E-35
sp|Q4WIK9|NOP16_ASPFU Nucleolar protein 16 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nop16 PE=3 SV=1 1 191 3.0E-35
sp|A7E664|NOP16_SCLS1 Nucleolar protein 16 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=nop16 PE=3 SV=1 1 191 4.0E-34
sp|Q1EBC4|NOP16_COCIM Nucleolar protein 16 OS=Coccidioides immitis (strain RS) GN=NOP16 PE=3 SV=1 1 191 2.0E-33
sp|A2QGZ1|NOP16_ASPNC Nucleolar protein 16 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nop16 PE=3 SV=1 27 193 2.0E-32
sp|A6RC73|NOP16_AJECN Nucleolar protein 16 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NOP16 PE=3 SV=1 1 191 1.0E-30
sp|A6ZQU8|NOP16_YEAS7 Nucleolar protein 16 OS=Saccharomyces cerevisiae (strain YJM789) GN=NOP16 PE=3 SV=1 18 189 6.0E-22
sp|Q75AB6|NOP16_ASHGO Nucleolar protein 16 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP16 PE=3 SV=1 12 191 1.0E-21
sp|A7TP28|NOP16_VANPO Nucleolar protein 16 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NOP16 PE=3 SV=1 18 194 4.0E-20
sp|A5DFT1|NOP16_PICGU Nucleolar protein 16 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NOP16 PE=3 SV=2 27 189 3.0E-19
sp|Q6CQW3|NOP16_KLULA Nucleolar protein 16 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOP16 PE=3 SV=1 18 191 1.0E-18
sp|P40007|NOP16_YEAST Nucleolar protein 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP16 PE=1 SV=1 18 189 4.0E-18
sp|A5DYR5|NOP16_LODEL Nucleolar protein 16 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NOP16 PE=3 SV=1 13 191 9.0E-18
sp|Q6BWR0|NOP16_DEBHA Nucleolar protein 16 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NOP16 PE=3 SV=1 3 191 1.0E-17
sp|P0CP24|NOP16_CRYNJ Nucleolar protein 16 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NOP16 PE=3 SV=1 21 192 1.0E-17
sp|P0CP25|NOP16_CRYNB Nucleolar protein 16 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NOP16 PE=3 SV=1 21 192 1.0E-17
sp|Q76IQ1|NOP16_CANGA Nucleolar protein 16 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOP16 PE=3 SV=1 12 191 1.0E-17
sp|Q4PII9|NOP16_USTMA Nucleolar protein 16 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NOP16 PE=3 SV=1 7 192 4.0E-17
sp|A3LU29|NOP16_PICST Nucleolar protein 16 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NOP16 PE=3 SV=2 27 191 6.0E-17
sp|Q59YD8|NOP16_CANAL Nucleolar protein 16 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NOP16 PE=3 SV=1 13 191 2.0E-16
sp|Q6CE60|NOP16_YARLI Nucleolar protein 16 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP16 PE=3 SV=2 30 191 4.0E-16
sp|Q9Y7Z1|NOP16_SCHPO Nucleolar protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop16 PE=3 SV=1 11 176 1.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5781
MGREIQKKKLRSKRQPVRPKKTPQAPNPRGNTLIAQHWDKQQTPTQNYRRLGLVSRLKAPTGGSEKLASRQVALA
IAPLEQAIVSEAKVERDDEGNIVSVLPEPDSDSEDERGGGGHVGADDPHASQLVRDLIAMAQNPAPKKARHQSDA
EIQWLQRLVARHGDDAGAMARDRKLNPMQQTAADLARRIKKAQLTA*
Coding >Ophun1|5781
ATGGGCCGAGAAATCCAAAAGAAAAAGCTACGCTCCAAGCGCCAACCAGTCCGACCCAAAAAGACGCCCCAAGCC
CCCAACCCGCGCGGAAACACCCTCATAGCCCAACACTGGGATAAGCAGCAGACGCCCACGCAGAATTACCGTCGC
TTGGGCCTCGTCTCCCGTCTCAAAGCCCCCACTGGCGGATCCGAGAAGCTCGCCTCCAGGCAAGTCGCCCTGGCC
ATTGCGCCGCTCGAGCAGGCCATCGTCTCCGAGGCAAAAGTCGAGCGCGACGACGAGGGAAACATCGTCAGCGTG
CTGCCCGAACCGGACTCGGACTCTGAGGATGAAAGGGGCGGTGGTGGTCATGTCGGAGCGGATGACCCGCACGCC
TCGCAACTCGTTCGCGACCTCATCGCCATGGCGCAGAACCCCGCTCCTAAGAAAGCGCGGCACCAGAGCGACGCT
GAGATACAGTGGCTGCAGCGTCTCGTTGCTCGGCATGGGGACGATGCCGGTGCCATGGCGAGGGACCGAAAGCTG
AACCCCATGCAGCAGACGGCCGCTGACCTTGCGCGGAGGATTAAAAAGGCCCAATTGACGGCTTGA
Transcript >Ophun1|5781
ATGGGCCGAGAAATCCAAAAGAAAAAGCTACGCTCCAAGCGCCAACCAGTCCGACCCAAAAAGACGCCCCAAGCC
CCCAACCCGCGCGGAAACACCCTCATAGCCCAACACTGGGATAAGCAGCAGACGCCCACGCAGAATTACCGTCGC
TTGGGCCTCGTCTCCCGTCTCAAAGCCCCCACTGGCGGATCCGAGAAGCTCGCCTCCAGGCAAGTCGCCCTGGCC
ATTGCGCCGCTCGAGCAGGCCATCGTCTCCGAGGCAAAAGTCGAGCGCGACGACGAGGGAAACATCGTCAGCGTG
CTGCCCGAACCGGACTCGGACTCTGAGGATGAAAGGGGCGGTGGTGGTCATGTCGGAGCGGATGACCCGCACGCC
TCGCAACTCGTTCGCGACCTCATCGCCATGGCGCAGAACCCCGCTCCTAAGAAAGCGCGGCACCAGAGCGACGCT
GAGATACAGTGGCTGCAGCGTCTCGTTGCTCGGCATGGGGACGATGCCGGTGCCATGGCGAGGGACCGAAAGCTG
AACCCCATGCAGCAGACGGCCGCTGACCTTGCGCGGAGGATTAAAAAGGCCCAATTGACGGCTTGA
Gene >Ophun1|5781
ATGGGCCGAGAAATCCAAAAGAAAAAGCTACGCTCCAAGCGCCAACCAGTCCGACCCAAAAAGACGCCCCAAGCC
CCCAACCCGCGCGGAAACACCCTCATAGCCCAACACTGGTAAGCCCCCAGCCGGAAACAAACCGCCAACCCACTC
GAGAACACTCGTTGACCGGGGGCACCAATCCCCAGGGATAAGCAGCAGACGCCCACGCAGAATTACCGTCGCTTG
GGCCTCGTCTCCCGTCTCAAAGCCCCCACTGGCGGATCCGAGAAGCTCGCCTCCAGGCAAGTCGCCCTGGCCATT
GCGCCGCTCGAGCAGGCCATCGTCTCCGAGGCAAAAGTCGAGCGCGACGACGAGGGAAACATCGTCAGCGTGCTG
CCCGAACCGGACTCGGACTCTGAGGATGAAAGGGGCGGTGGTGGTCATGTCGGAGCGGATGACCCGCACGCCTCG
CAACTCGTTCGCGACCTCATCGCCATGGCGCAGAACCCCGCTCCTAAGAAAGCGCGGCACCAGAGCGACGCTGAG
ATACAGTGGCTGCAGCGTCTCGTTGCTCGGCATGGGGACGATGCCGGTGCCATGGCGAGGGACCGAAAGCTGAAC
CCCATGCAGCAGACGGCCGCTGACCTTGCGCGGAGGATTAAAAAGGCCCAATTGACGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail