Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5762
Gene name
LocationContig_591:588..1506
Strand-
Gene length (bp)918
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family 5.6E-38 63 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT07|EIF3K_MAGO7 Eukaryotic translation initiation factor 3 subunit K OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_03855 PE=3 SV=1 2 229 6.0E-114
sp|L7IAU0|EIF3K_MAGOY Eukaryotic translation initiation factor 3 subunit K OS=Magnaporthe oryzae (strain Y34) GN=OOU_Y34scaffold00487g12 PE=2 SV=1 2 229 6.0E-114
sp|Q7S2R9|EIF3K_NEUCR Eukaryotic translation initiation factor 3 subunit K OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU09707 PE=3 SV=1 1 231 2.0E-113
sp|A7F080|EIF3K_SCLS1 Eukaryotic translation initiation factor 3 subunit K OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10997 PE=3 SV=1 4 229 2.0E-80
sp|A6SDU6|EIF3K_BOTFB Eukaryotic translation initiation factor 3 subunit K OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_11363 PE=3 SV=1 4 229 2.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT07|EIF3K_MAGO7 Eukaryotic translation initiation factor 3 subunit K OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_03855 PE=3 SV=1 2 229 6.0E-114
sp|L7IAU0|EIF3K_MAGOY Eukaryotic translation initiation factor 3 subunit K OS=Magnaporthe oryzae (strain Y34) GN=OOU_Y34scaffold00487g12 PE=2 SV=1 2 229 6.0E-114
sp|Q7S2R9|EIF3K_NEUCR Eukaryotic translation initiation factor 3 subunit K OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU09707 PE=3 SV=1 1 231 2.0E-113
sp|A7F080|EIF3K_SCLS1 Eukaryotic translation initiation factor 3 subunit K OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_10997 PE=3 SV=1 4 229 2.0E-80
sp|A6SDU6|EIF3K_BOTFB Eukaryotic translation initiation factor 3 subunit K OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_11363 PE=3 SV=1 4 229 2.0E-79
sp|Q0TXH0|EIF3K_PHANO Eukaryotic translation initiation factor 3 subunit K OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_15727 PE=3 SV=1 4 229 3.0E-76
sp|Q5B8S5|EIF3K_EMENI Eukaryotic translation initiation factor 3 subunit K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN3055 PE=3 SV=1 9 229 1.0E-69
sp|Q4WXE9|EIF3K_ASPFU Eukaryotic translation initiation factor 3 subunit K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_3G09280 PE=3 SV=2 9 229 3.0E-69
sp|B0XY69|EIF3K_ASPFC Eukaryotic translation initiation factor 3 subunit K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_039840 PE=3 SV=2 9 229 3.0E-69
sp|A1CK40|EIF3K_ASPCL Eukaryotic translation initiation factor 3 subunit K OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_037210 PE=3 SV=1 9 229 6.0E-69
sp|A1D7C4|EIF3K_NEOFI Eukaryotic translation initiation factor 3 subunit K OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_067850 PE=3 SV=1 9 229 9.0E-69
sp|A2R7B4|EIF3K_ASPNC Eukaryotic translation initiation factor 3 subunit K OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An16g02940 PE=3 SV=1 9 227 3.0E-67
sp|Q0CXN3|EIF3K_ASPTN Eukaryotic translation initiation factor 3 subunit K OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01551 PE=3 SV=1 9 229 4.0E-67
sp|Q2UQC6|EIF3K_ASPOR Eukaryotic translation initiation factor 3 subunit K OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005001305 PE=3 SV=1 9 229 1.0E-65
sp|Q1E6D3|EIF3K_COCIM Eukaryotic translation initiation factor 3 subunit K OS=Coccidioides immitis (strain RS) GN=CIMG_01880 PE=3 SV=1 4 229 1.0E-64
sp|Q6C830|EIF3K_YARLI Eukaryotic translation initiation factor 3 subunit K OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D23243g PE=3 SV=1 6 229 1.0E-40
sp|Q4P4X6|EIF3K_USTMA Eukaryotic translation initiation factor 3 subunit K OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_12282 PE=3 SV=2 6 227 2.0E-28
sp|Q9UBQ5|EIF3K_HUMAN Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens GN=EIF3K PE=1 SV=1 13 224 8.0E-26
sp|Q3T0V3|EIF3K_BOVIN Eukaryotic translation initiation factor 3 subunit K OS=Bos taurus GN=EIF3K PE=2 SV=1 13 224 1.0E-25
sp|Q9DBZ5|EIF3K_MOUSE Eukaryotic translation initiation factor 3 subunit K OS=Mus musculus GN=Eif3k PE=1 SV=1 13 224 2.0E-25
sp|P0CN54|EIF3K_CRYNJ Eukaryotic translation initiation factor 3 subunit K OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CND02370 PE=3 SV=1 6 227 1.0E-24
sp|P0CN55|EIF3K_CRYNB Eukaryotic translation initiation factor 3 subunit K OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBD3990 PE=3 SV=1 6 227 1.0E-24
sp|B3NN00|EIF3K_DROER Eukaryotic translation initiation factor 3 subunit K OS=Drosophila erecta GN=GG22131 PE=3 SV=1 13 218 8.0E-24
sp|Q9W2D9|EIF3K_DROME Eukaryotic translation initiation factor 3 subunit K OS=Drosophila melanogaster GN=CG10306 PE=2 SV=1 13 218 1.0E-23
sp|B4I7U3|EIF3K_DROSE Eukaryotic translation initiation factor 3 subunit K OS=Drosophila sechellia GN=GM15855 PE=3 SV=1 13 218 1.0E-23
sp|Q28C65|EIF3K_XENTR Eukaryotic translation initiation factor 3 subunit K OS=Xenopus tropicalis GN=eif3k PE=2 SV=1 13 224 2.0E-23
sp|Q292B6|EIF3K_DROPS Eukaryotic translation initiation factor 3 subunit K OS=Drosophila pseudoobscura pseudoobscura GN=GA24496 PE=3 SV=1 13 193 4.0E-23
sp|B4G9X6|EIF3K_DROPE Eukaryotic translation initiation factor 3 subunit K OS=Drosophila persimilis GN=GL10802 PE=3 SV=1 13 193 4.0E-23
sp|B4P8V1|EIF3K_DROYA Eukaryotic translation initiation factor 3 subunit K OS=Drosophila yakuba GN=GE12213 PE=2 SV=1 13 218 5.0E-23
sp|Q1HPS4|EIF3K_BOMMO Eukaryotic translation initiation factor 3 subunit K OS=Bombyx mori PE=2 SV=1 13 221 5.0E-23
sp|B3MIY7|EIF3K_DROAN Eukaryotic translation initiation factor 3 subunit K OS=Drosophila ananassae GN=GF13261 PE=3 SV=1 13 215 5.0E-23
sp|Q61K76|EIF3K_CAEBR Eukaryotic translation initiation factor 3 subunit K OS=Caenorhabditis briggsae GN=eif-3.K PE=3 SV=1 17 223 5.0E-23
sp|Q567V6|EIF3K_DANRE Eukaryotic translation initiation factor 3 subunit K OS=Danio rerio GN=eif3k PE=2 SV=1 13 224 2.0E-22
sp|Q6GNI4|EIF3K_XENLA Eukaryotic translation initiation factor 3 subunit K OS=Xenopus laevis GN=eif3k PE=2 SV=1 13 224 2.0E-22
sp|A7SGZ5|EIF3K_NEMVE Eukaryotic translation initiation factor 3 subunit K OS=Nematostella vectensis GN=v1g170558 PE=3 SV=1 13 227 3.0E-22
sp|Q9XUP3|EIF3K_CAEEL Eukaryotic translation initiation factor 3 subunit K OS=Caenorhabditis elegans GN=eif-3.K PE=2 SV=1 17 224 9.0E-22
sp|B4KTN5|EIF3K_DROMO Eukaryotic translation initiation factor 3 subunit K OS=Drosophila mojavensis GN=GI20605 PE=3 SV=1 13 215 4.0E-21
sp|B4JVG7|EIF3K_DROGR Eukaryotic translation initiation factor 3 subunit K OS=Drosophila grimshawi GN=GH22679 PE=3 SV=1 13 189 5.0E-21
sp|B4LNQ8|EIF3K_DROVI Eukaryotic translation initiation factor 3 subunit K OS=Drosophila virilis GN=GJ21045 PE=3 SV=1 13 189 8.0E-21
sp|B4MIW0|EIF3K_DROWI Eukaryotic translation initiation factor 3 subunit K OS=Drosophila willistoni GN=GK10740 PE=3 SV=1 13 218 9.0E-21
sp|A8QDN3|EIF3K_BRUMA Eukaryotic translation initiation factor 3 subunit K OS=Brugia malayi GN=Bm1_52955 PE=3 SV=1 17 224 1.0E-20
sp|Q9SZA3|EIF3K_ARATH Eukaryotic translation initiation factor 3 subunit K OS=Arabidopsis thaliana GN=TIF3K1 PE=2 SV=1 4 224 5.0E-20
sp|Q94HF1|EIF3K_ORYSJ Eukaryotic translation initiation factor 3 subunit K OS=Oryza sativa subsp. japonica GN=TIF3K1 PE=2 SV=1 23 214 2.0E-19
sp|B0XEA7|EIF3K_CULQU Eukaryotic translation initiation factor 3 subunit K OS=Culex quinquefasciatus GN=CPIJ017839 PE=3 SV=2 13 221 4.0E-19
sp|Q177J8|EIF3K_AEDAE Eukaryotic translation initiation factor 3 subunit K OS=Aedes aegypti GN=AAEL006115 PE=3 SV=1 13 221 1.0E-18
sp|Q7QGK4|EIF3K_ANOGA Eukaryotic translation initiation factor 3 subunit K OS=Anopheles gambiae GN=AGAP011580 PE=3 SV=2 13 221 6.0E-18
sp|Q54EQ1|EIF3K_DICDI Eukaryotic translation initiation factor 3 subunit K OS=Dictyostelium discoideum GN=eif3K PE=3 SV=2 8 224 7.0E-15
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1381
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6422
Ophiocordyceps australis map64 (Brazil) OphauB2|4278
Ophiocordyceps camponoti-floridani Ophcf2|03171
Ophiocordyceps camponoti-rufipedis Ophun1|5762 (this protein)
Ophiocordyceps kimflemingae Ophio5|435
Ophiocordyceps subramaniannii Hirsu2|10821

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5762
MNGDDPPERPDYITSIINGLERYNPEAVGTLETYLQEQCEGKFCDCNANRTLLKLYQLNPDRMKDEVVTNILVKA
MTQFPSAQFSLALHIINPSVAATGELPEALTKLRSLNSQLEGAQYTNFWAAVDGDDICADLVADISGFEDLIRHR
IAQLISQAFREVSMDLLEPWLGLSKDATKKFVTEVCGWEVDDQGNAKIPPNPENEAKKAEIREDVNVDQFARVIR
RAWETTV*
Coding >Ophun1|5762
ATGAACGGCGACGACCCGCCCGAGCGGCCCGATTACATCACCAGCATCATCAATGGCCTCGAGCGCTACAACCCG
GAAGCCGTCGGCACCCTCGAGACGTACCTTCAGGAGCAGTGCGAGGGCAAGTTTTGCGACTGCAACGCCAACAGG
ACCTTGCTGAAGCTATACCAGCTCAACCCCGATCGCATGAAAGACGAGGTCGTCACCAACATCCTCGTCAAAGCC
ATGACGCAGTTCCCCTCTGCCCAATTCTCCCTCGCACTCCACATCATCAACCCATCAGTCGCTGCGACCGGAGAG
CTCCCCGAAGCCCTAACCAAGCTACGCTCGCTCAACTCACAGCTCGAAGGCGCCCAGTACACCAACTTCTGGGCG
GCTGTCGACGGCGATGACATCTGTGCCGACCTCGTGGCCGACATCTCGGGCTTCGAGGATCTCATCCGGCACCGC
ATCGCTCAACTCATCTCGCAGGCCTTCAGAGAGGTCAGCATGGACCTCCTCGAACCGTGGCTCGGTCTCAGCAAG
GACGCTACCAAGAAGTTCGTGACGGAAGTCTGCGGCTGGGAAGTCGACGACCAAGGAAACGCCAAGATCCCCCCC
AATCCGGAAAACGAGGCGAAAAAGGCCGAGATCCGCGAGGACGTCAACGTCGACCAGTTTGCCAGAGTCATCCGA
CGAGCCTGGGAGACGACTGTATGA
Transcript >Ophun1|5762
ATGAACGGCGACGACCCGCCCGAGCGGCCCGATTACATCACCAGCATCATCAATGGCCTCGAGCGCTACAACCCG
GAAGCCGTCGGCACCCTCGAGACGTACCTTCAGGAGCAGTGCGAGGGCAAGTTTTGCGACTGCAACGCCAACAGG
ACCTTGCTGAAGCTATACCAGCTCAACCCCGATCGCATGAAAGACGAGGTCGTCACCAACATCCTCGTCAAAGCC
ATGACGCAGTTCCCCTCTGCCCAATTCTCCCTCGCACTCCACATCATCAACCCATCAGTCGCTGCGACCGGAGAG
CTCCCCGAAGCCCTAACCAAGCTACGCTCGCTCAACTCACAGCTCGAAGGCGCCCAGTACACCAACTTCTGGGCG
GCTGTCGACGGCGATGACATCTGTGCCGACCTCGTGGCCGACATCTCGGGCTTCGAGGATCTCATCCGGCACCGC
ATCGCTCAACTCATCTCGCAGGCCTTCAGAGAGGTCAGCATGGACCTCCTCGAACCGTGGCTCGGTCTCAGCAAG
GACGCTACCAAGAAGTTCGTGACGGAAGTCTGCGGCTGGGAAGTCGACGACCAAGGAAACGCCAAGATCCCCCCC
AATCCGGAAAACGAGGCGAAAAAGGCCGAGATCCGCGAGGACGTCAACGTCGACCAGTTTGCCAGAGTCATCCGA
CGAGCCTGGGAGACGACTGTATGA
Gene >Ophun1|5762
ATGAACGGCGACGACCCGCCCGAGCGGCCCGATTACATCACCAGCATCATCAATGGCCTCGAGCGCTACAACCCG
GAAGCCGTCGGCACCCTCGAGACGTACCTTCAGGAGCAGTGCGAGGGCAAGTTTTGCGACTGCAACGCCAACAGG
ACCTTGCTGAAGCTGTGAGTGGCGCTGCTTGGATTTGTGACTTTTCGAATCTGTCTGGTTCTACCGGTGTTGGGG
CAGCCTCTGTGTGATGTTGCGTAAACGTTTCCTATTACCTGACCGCGACGGGCTCTTTGCAGTCTTGTCGCTGAT
GAAGCCTTGATCTGACCTTGGCTGCCATTCTGCTTCTCTGACGCATCCATCTCCGAGCCGTGCGCGCAACTAACC
GTCAAAAGATACCAGCTCAACCCCGATCGCATGAAAGACGAGGTCGTCACCAACATCCTCGTCAAAGCCATGACG
CAGTTCCCCTCTGCCCAATTCTCCCTCGCACTCCACATCATCAACCCATCAGTCGCTGCGACCGGAGAGCTCCCC
GAAGCCCTAACCAAGCTACGCTCGCTCAACTCACAGCTCGAAGGCGCCCAGTACACCAACTTCTGGGCGGCTGTC
GACGGCGATGACATCTGTGCCGACCTCGTGGCCGACATCTCGGGCTTCGAGGATCTCATCCGGCACCGCATCGCT
CAACTCATCTCGCAGGCCTTCAGAGAGGTCAGCATGGACCTCCTCGAACCGTGGCTCGGTCTCAGCAAGGACGCT
ACCAAGAAGTTCGTGACGGAAGTCTGCGGCTGGGAAGTCGACGACCAAGGAAACGCCAAGATCCCCCCCAATCCG
GAAAACGAGGCGAAAAAGGCCGAGATCCGCGAGGACGTCAACGTCGACCAGTTTGCCAGAGTCATCCGACGAGCC
TGGGAGACGACTGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail