Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5757
Gene name
LocationContig_590:157..3381
Strand-
Gene length (bp)3224
Transcript length (bp)2763
Coding sequence length (bp)2763
Protein length (aa) 921

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 617 836 1.0E-29
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 583 836 4.0E-24
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 566 839 2.0E-20
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 586 781 1.0E-19
sp|Q8R2Y3|DOLK_MOUSE Dolichol kinase OS=Mus musculus GN=Dolk PE=1 SV=1 581 781 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 617 836 1.0E-29
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 583 836 4.0E-24
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 566 839 2.0E-20
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 586 781 1.0E-19
sp|Q8R2Y3|DOLK_MOUSE Dolichol kinase OS=Mus musculus GN=Dolk PE=1 SV=1 581 781 1.0E-18
sp|Q9UPQ8|DOLK_HUMAN Dolichol kinase OS=Homo sapiens GN=DOLK PE=1 SV=1 589 781 4.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 173 192 19
2 325 344 19
3 348 370 22
4 500 522 22
5 589 611 22
6 632 654 22
7 689 711 22
8 732 754 22
9 769 788 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5757
MPAPSADEASKPDDASSTLTPDDPRPYRALSRSPHPYHHQTPERCVLDHHHSSSPPSESGTDADDEHFLKGLPAS
RVRLHKGLRGQNEFASRPSTPLVHPASSEHELPDSLVEQHVVQARDSLACHLREAAFRNKVLIRRVTEFCLVALL
GRIVRSNAGVSLLLTVWRRDLQLLGLLLAALLALYPLRVAAWAYRRHRPCRLWPFEMPLDFDPAPLLYPPAITVF
ASLLISVGNQAVLLPNIILSISALPRSLIPTTEPTAPFDTPQWLVSCLPLIWTSSDTAMLSAQQGLTGEMLVLLH
PLHQTLCSVLQHLTTTSLLDAELQLLSVALINILVLAVSPQIQVLKALLWVGGLSAMVLCGPVISWGISLARVPK
WRFRKTPDVVEDAPRALSWRRATKGLLGLFRGDGFDDGDPSSEDDKSPSRFVGLSRVRTLDKNGARSKLAEDEAK
RGSIARRHTMPHPDKARIALTSSGRRRRATSGAARPFLRLTQAQATRRKWLYAAYVYACLLAIILVGVRAHVQRY
ALGGHEPIGWGLGYLLGDWPWFRSEAGVGRWICLDDGPAADGEGQRLDGWVQRLRLEVWGEAKTRLLISGYWLAI
LVVGLMVVLRLKDTYEVDTRRKVFHFMMVAMFLPATYVDPAFAALALALMLALFLMLDLVRASQLPPLSKPIASF
LAPYVDGRDFRGSVVVSHIFLLIGCAIPLWLALATVPRTTTASTCRAGWEVTIREVSMVSGVVCVGLGDAAASLI
GRRFGHRKWLWGGGKSLEGSAAFALAVSVGLAVASAWLRAGGWSVAEGEAGGSLAGAVVCASVASLTEAVLTGGN
DNVIVPVVLWTCVKSHLAHKKAEQALCILGQAAQHKGHALPGVKPRGRPAQQPVHHVHHVDLDVERGVRRGVVED
EVEGGAEADVPEEGEVGRVG*
Coding >Ophun1|5757
ATGCCGGCCCCGTCCGCCGACGAGGCGTCCAAGCCTGACGATGCCTCGTCCACTCTCACCCCCGATGACCCGCGT
CCTTACCGCGCCCTGAGCCGCTCCCCTCATCCCTATCACCACCAGACGCCTGAGAGATGCGTACTCGACCATCAT
CACTCGTCGTCTCCTCCCAGCGAGAGCGGCACCGATGCCGACGACGAGCACTTCCTCAAGGGTCTCCCCGCCTCG
CGCGTGAGGCTTCACAAGGGGCTGCGCGGCCAGAACGAATTTGCCTCGCGTCCCTCTACGCCTCTCGTCCATCCG
GCTTCTTCTGAGCATGAGCTTCCGGATTCCCTCGTCGAGCAGCATGTCGTCCAAGCACGCGATTCGCTTGCCTGC
CACTTGAGAGAGGCCGCCTTTCGTAACAAGGTCTTGATCCGGCGCGTCACAGAGTTTTGCCTCGTCGCGTTGCTG
GGGCGCATCGTGCGCTCCAACGCCGGCGTCTCCTTGCTGCTGACCGTCTGGCGCCGAGACCTTCAGCTCCTTGGC
CTGCTGCTCGCCGCTCTGCTGGCACTCTACCCCCTTCGTGTCGCCGCCTGGGCCTATCGCCGTCATCGCCCTTGT
CGTCTATGGCCTTTTGAGATGCCCCTCGACTTTGACCCGGCTCCTCTGCTGTACCCGCCAGCCATTACTGTTTTT
GCGTCCCTCCTGATATCCGTCGGAAACCAGGCTGTCCTTCTTCCCAACATCATTCTCAGCATTAGCGCATTGCCG
CGGTCCTTGATCCCAACCACCGAGCCGACCGCTCCCTTTGACACGCCTCAATGGCTCGTCTCATGTCTGCCTCTC
ATCTGGACCTCGTCCGACACGGCAATGCTCTCGGCCCAACAAGGCTTGACGGGGGAGATGCTCGTCTTGCTGCAT
CCTCTGCACCAGACGCTGTGCTCCGTCTTGCAGCATCTGACGACGACGAGCCTCCTGGATGCCGAGCTTCAGCTG
TTATCTGTAGCCTTGATCAACATCCTCGTCCTGGCCGTATCACCGCAGATTCAGGTGCTCAAAGCCCTGCTCTGG
GTCGGGGGCTTGTCAGCCATGGTGCTGTGCGGCCCGGTCATCTCGTGGGGGATCTCCCTGGCGCGGGTGCCCAAA
TGGCGTTTTCGAAAGACTCCTGATGTTGTCGAGGACGCGCCCCGGGCTCTGTCCTGGCGCAGAGCCACCAAGGGA
CTACTGGGGCTGTTCCGTGGTGACGGCTTCGATGATGGCGACCCATCATCCGAGGACGACAAGAGTCCGTCTCGC
TTCGTCGGCCTCTCGAGGGTCCGGACTCTCGATAAGAACGGAGCCAGGTCCAAGTTGGCCGAGGATGAGGCCAAA
CGCGGCAGCATAGCACGGAGACACACGATGCCGCACCCGGACAAGGCGCGAATAGCGCTCACGTCTTCCGGCCGA
AGGAGACGGGCGACGTCGGGCGCGGCTCGGCCCTTTCTCCGGCTCACGCAGGCGCAGGCGACGCGCAGGAAATGG
CTGTACGCCGCCTACGTCTACGCGTGCCTGCTGGCCATCATCCTGGTCGGCGTCCGGGCGCACGTTCAGCGATAC
GCGCTCGGGGGCCACGAGCCCATCGGCTGGGGGCTGGGCTACCTGCTGGGAGACTGGCCCTGGTTCCGGAGCGAG
GCCGGCGTTGGGCGCTGGATCTGCCTGGACGACGGTCCGGCAGCGGACGGCGAGGGACAGCGTCTCGACGGCTGG
GTGCAGCGGCTCCGGCTCGAGGTCTGGGGCGAGGCCAAGACGCGGCTGCTCATCAGCGGCTACTGGCTGGCCATC
CTGGTCGTCGGCCTGATGGTGGTGCTGCGGCTCAAGGACACATACGAGGTGGACACACGGCGCAAAGTGTTCCAC
TTCATGATGGTTGCCATGTTCCTGCCGGCAACGTACGTCGACCCGGCGTTTGCTGCCCTGGCCCTGGCCCTGATG
CTGGCCCTGTTCCTGATGCTGGACCTCGTCCGGGCGAGCCAGCTGCCGCCCCTGTCGAAGCCCATTGCGTCCTTC
CTGGCCCCCTACGTCGACGGGAGGGACTTTCGAGGCTCCGTCGTCGTCTCCCACATCTTCCTCCTCATCGGCTGC
GCCATCCCGCTATGGCTGGCCCTGGCAACGGTGCCGCGAACGACGACGGCTTCGACCTGCCGAGCCGGATGGGAG
GTGACGATACGCGAGGTGAGCATGGTCTCGGGCGTCGTCTGCGTCGGCCTCGGAGACGCAGCCGCCTCGCTCATC
GGCCGCCGCTTCGGTCACCGCAAGTGGCTCTGGGGCGGAGGCAAGAGCCTCGAAGGCAGCGCCGCCTTTGCCCTC
GCCGTCTCCGTCGGTCTGGCCGTCGCGAGCGCCTGGCTCAGGGCCGGAGGGTGGTCGGTGGCGGAGGGGGAGGCC
GGGGGATCGCTCGCCGGTGCCGTCGTCTGCGCTTCTGTGGCGAGCTTGACGGAGGCGGTGCTGACGGGGGGGAAC
GACAACGTCATCGTTCCCGTTGTGCTGTGGACGTGCGTCAAGAGTCACCTCGCCCACAAGAAGGCGGAACAGGCT
CTTTGCATTCTCGGGCAAGCTGCGCAGCACAAAGGCCACGCCCTCCCTGGCGTGAAGCCGCGTGGCAGACCTGCC
CAGCAGCCGGTTCACCACGTCCACCACGTCGACCTCGACGTCGAGCGGGGCGTACGTCGTGGCGTCGTGGAAGAT
GAAGTTGAAGGCGGAGCGGAGGCCGACGTCCCAGAGGAGGGGGAAGTCGGGCGTGTCGGCTGA
Transcript >Ophun1|5757
ATGCCGGCCCCGTCCGCCGACGAGGCGTCCAAGCCTGACGATGCCTCGTCCACTCTCACCCCCGATGACCCGCGT
CCTTACCGCGCCCTGAGCCGCTCCCCTCATCCCTATCACCACCAGACGCCTGAGAGATGCGTACTCGACCATCAT
CACTCGTCGTCTCCTCCCAGCGAGAGCGGCACCGATGCCGACGACGAGCACTTCCTCAAGGGTCTCCCCGCCTCG
CGCGTGAGGCTTCACAAGGGGCTGCGCGGCCAGAACGAATTTGCCTCGCGTCCCTCTACGCCTCTCGTCCATCCG
GCTTCTTCTGAGCATGAGCTTCCGGATTCCCTCGTCGAGCAGCATGTCGTCCAAGCACGCGATTCGCTTGCCTGC
CACTTGAGAGAGGCCGCCTTTCGTAACAAGGTCTTGATCCGGCGCGTCACAGAGTTTTGCCTCGTCGCGTTGCTG
GGGCGCATCGTGCGCTCCAACGCCGGCGTCTCCTTGCTGCTGACCGTCTGGCGCCGAGACCTTCAGCTCCTTGGC
CTGCTGCTCGCCGCTCTGCTGGCACTCTACCCCCTTCGTGTCGCCGCCTGGGCCTATCGCCGTCATCGCCCTTGT
CGTCTATGGCCTTTTGAGATGCCCCTCGACTTTGACCCGGCTCCTCTGCTGTACCCGCCAGCCATTACTGTTTTT
GCGTCCCTCCTGATATCCGTCGGAAACCAGGCTGTCCTTCTTCCCAACATCATTCTCAGCATTAGCGCATTGCCG
CGGTCCTTGATCCCAACCACCGAGCCGACCGCTCCCTTTGACACGCCTCAATGGCTCGTCTCATGTCTGCCTCTC
ATCTGGACCTCGTCCGACACGGCAATGCTCTCGGCCCAACAAGGCTTGACGGGGGAGATGCTCGTCTTGCTGCAT
CCTCTGCACCAGACGCTGTGCTCCGTCTTGCAGCATCTGACGACGACGAGCCTCCTGGATGCCGAGCTTCAGCTG
TTATCTGTAGCCTTGATCAACATCCTCGTCCTGGCCGTATCACCGCAGATTCAGGTGCTCAAAGCCCTGCTCTGG
GTCGGGGGCTTGTCAGCCATGGTGCTGTGCGGCCCGGTCATCTCGTGGGGGATCTCCCTGGCGCGGGTGCCCAAA
TGGCGTTTTCGAAAGACTCCTGATGTTGTCGAGGACGCGCCCCGGGCTCTGTCCTGGCGCAGAGCCACCAAGGGA
CTACTGGGGCTGTTCCGTGGTGACGGCTTCGATGATGGCGACCCATCATCCGAGGACGACAAGAGTCCGTCTCGC
TTCGTCGGCCTCTCGAGGGTCCGGACTCTCGATAAGAACGGAGCCAGGTCCAAGTTGGCCGAGGATGAGGCCAAA
CGCGGCAGCATAGCACGGAGACACACGATGCCGCACCCGGACAAGGCGCGAATAGCGCTCACGTCTTCCGGCCGA
AGGAGACGGGCGACGTCGGGCGCGGCTCGGCCCTTTCTCCGGCTCACGCAGGCGCAGGCGACGCGCAGGAAATGG
CTGTACGCCGCCTACGTCTACGCGTGCCTGCTGGCCATCATCCTGGTCGGCGTCCGGGCGCACGTTCAGCGATAC
GCGCTCGGGGGCCACGAGCCCATCGGCTGGGGGCTGGGCTACCTGCTGGGAGACTGGCCCTGGTTCCGGAGCGAG
GCCGGCGTTGGGCGCTGGATCTGCCTGGACGACGGTCCGGCAGCGGACGGCGAGGGACAGCGTCTCGACGGCTGG
GTGCAGCGGCTCCGGCTCGAGGTCTGGGGCGAGGCCAAGACGCGGCTGCTCATCAGCGGCTACTGGCTGGCCATC
CTGGTCGTCGGCCTGATGGTGGTGCTGCGGCTCAAGGACACATACGAGGTGGACACACGGCGCAAAGTGTTCCAC
TTCATGATGGTTGCCATGTTCCTGCCGGCAACGTACGTCGACCCGGCGTTTGCTGCCCTGGCCCTGGCCCTGATG
CTGGCCCTGTTCCTGATGCTGGACCTCGTCCGGGCGAGCCAGCTGCCGCCCCTGTCGAAGCCCATTGCGTCCTTC
CTGGCCCCCTACGTCGACGGGAGGGACTTTCGAGGCTCCGTCGTCGTCTCCCACATCTTCCTCCTCATCGGCTGC
GCCATCCCGCTATGGCTGGCCCTGGCAACGGTGCCGCGAACGACGACGGCTTCGACCTGCCGAGCCGGATGGGAG
GTGACGATACGCGAGGTGAGCATGGTCTCGGGCGTCGTCTGCGTCGGCCTCGGAGACGCAGCCGCCTCGCTCATC
GGCCGCCGCTTCGGTCACCGCAAGTGGCTCTGGGGCGGAGGCAAGAGCCTCGAAGGCAGCGCCGCCTTTGCCCTC
GCCGTCTCCGTCGGTCTGGCCGTCGCGAGCGCCTGGCTCAGGGCCGGAGGGTGGTCGGTGGCGGAGGGGGAGGCC
GGGGGATCGCTCGCCGGTGCCGTCGTCTGCGCTTCTGTGGCGAGCTTGACGGAGGCGGTGCTGACGGGGGGGAAC
GACAACGTCATCGTTCCCGTTGTGCTGTGGACGTGCGTCAAGAGTCACCTCGCCCACAAGAAGGCGGAACAGGCT
CTTTGCATTCTCGGGCAAGCTGCGCAGCACAAAGGCCACGCCCTCCCTGGCGTGAAGCCGCGTGGCAGACCTGCC
CAGCAGCCGGTTCACCACGTCCACCACGTCGACCTCGACGTCGAGCGGGGCGTACGTCGTGGCGTCGTGGAAGAT
GAAGTTGAAGGCGGAGCGGAGGCCGACGTCCCAGAGGAGGGGGAAGTCGGGCGTGTCGGCTGA
Gene >Ophun1|5757
ATGCCGGCCCCGTCCGCCGACGAGGCGTCCAAGCCTGACGATGCCTCGTCCACTCTCACCCCCGATGACCCGCGT
CCTTACCGCGCCCTGAGCCGCTCCCCTCATCCCTATCACCACCAGACGCCTGAGAGATGCGTACTCGACCATCAT
CACTCGTCGTCTCCTCCCAGCGAGAGCGGCACCGATGCCGACGACGAGCACTTCCTCAAGGGTCTCCCCGCCTCG
CGCGTGAGGCTTCACAAGGGGCTGCGCGGCCAGAACGAATTTGCCTCGCGTCCCTCTACGCCTCTCGTCCATCCG
GCTTCTTCTGAGCATGAGCTTCCGGATTCCCTCGTCGAGCAGCATGTCGTCCAAGCACGCGATTCGCTTGCCTGC
CACTTGAGAGAGGCCGCCTTTCGTAACAAGGTCTTGATCCGGCGCGTCACAGAGTTTTGCCTCGTCGCGTTGCTG
GGGCGCATCGTGCGCTCCAACGCCGGCGTCTCCTTGCTGCTGACCGTCTGGCGCCGAGGTTCGTTCCCAATTGAT
TGAGTGCGCCGCTCGACTCTTCTCACTGTTACTAGACCTTCAGCTCCTTGGCCTGCTGCTCGCCGCTCTGCTGGC
ACTCTACCCCCTTCGTGTCGCCGCCTGGGCCTATCGCCGTCATCGCCCTTGTCGTCTATGGCCTTTTGAGATGCC
CCTCGACTTTGACCCGGCTCCTCTGCTGTACCCGCCAGCCATTACTGTTTTTGCGTCCCTCCTGATATCCGTCGG
AAACCAGGCTGTCCTTCTTCCCAACATCATTCTCAGCATTAGCGCATTGCCGCGGTCCTTGATCCCAACCACCGA
GCCGACCGCTCCCTTTGACACGCCTCAATGGCTCGTCTCATGTCTGCCTCTCATCTGGACCTCGTCCGACACGGC
AATGCTCTCGGCCCAACAAGGCTTGACGGGGGAGATGCTCGTCTTGCTGCATCCTCTGCACCAGACGCTGTGCTC
CGTCTTGCAGCATCTGACGACGACGAGCCTCCTGGATGCCGAGCTTCAGCTGTTATCTGTAGCCTTGATCAACAT
CCTCGTCCTGGCCGTATCACCGCAGATTCAGGTGCTCAAAGCCCTGCTCTGGGTCGGGGGCTTGTCAGCCATGGT
GCTGTGCGGCCCGGTCATCTCGTGGGGGATCTCCCTGGCGCGGGTGCCCAAATGGCGTTTTCGAAAGACTCCTGA
TGTTGTCGAGGACGCGCCCCGGGCTCTGTCCTGGCGCAGAGCCACCAAGGGACTACTGGGGCTGTTCCGTGGTGA
CGGCTTCGATGATGGCGACCCATCATCCGAGGACGACAAGAGTCCGTCTCGCTTCGTCGGCCTCTCGAGGGTCCG
GACTCTCGATAAGAACGGAGCCAGGTCCAAGTTGGCCGAGGATGAGGCCAAACGCGGCAGCATAGCACGGAGACA
CACGATGCCGCACCCGGACAAGGCGCGAATAGCGCTCACGTCTTCCGGCCGAAGGAGACGGGCGACGTCGGGCGC
GGCTCGGCCCTTTCTCCGGCTCACGCAGGCGCAGGCGACGCGCAGGAAATGGCTGTACGCCGCCTACGTCTACGC
GTGCCTGCTGGCCATCATCCTGGTCGGCGTCCGGGCGCACGTTCAGCGATACGCGCTCGGGGGCCACGAGCCCAT
CGGCTGGGGGCTGGGCTACCTGCTGGGAGACTGGCCCTGGTTCCGGAGCGAGGCCGGCGTTGGGCGCTGGATCTG
CCTGGACGACGGTCCGGCAGCGGACGGCGAGGGACAGCGTCTCGACGGCTGGGTGCAGCGGCTCCGGCTCGAGGT
CTGGGGCGAGGCCAAGACGCGGCTGCTCATCAGCGGCTACTGGCTGGCCATCCTGGTCGTCGGCCTGATGGTGGT
GCTGCGGCTCAAGGACACATACGAGGTGGACACACGGCGCAAAGTGTTCCACTTCATGATGGTTGCCATGTTCCT
GCCGGCAACGTACGTCGACCCGGCGTTTGCTGCCCTGGCCCTGGCCCTGATGCTGGCCCTGTTCCTGATGCTGGA
CCTCGTCCGGGCGAGCCAGCTGCCGCCCCTGTCGAAGCCCATTGCGTCCTTCCTGGCCCCCTACGTCGACGGGAG
GGACTTTCGAGGCTCCGTCGTCGTCTCCCACATCTTCCTCCTCATCGGCTGCGCCATCCCGCTATGGCTGGCCCT
GGCAACGGTGCCGCGAACGACGACGGCTTCGACCTGCCGAGCCGGATGGGAGGTGACGATACGCGAGGTGAGCAT
GGTCTCGGGCGTCGTCTGCGTCGGCCTCGGAGACGCAGCCGCCTCGCTCATCGGCCGCCGCTTCGGTCACCGCAA
GTGGCTCTGGGGCGGAGGCAAGAGCCTCGAAGGCAGCGCCGCCTTTGCCCTCGCCGTCTCCGTCGGTCTGGCCGT
CGCGAGCGCCTGGCTCAGGGCCGGAGGGTGGTCGGTGGCGGAGGGGGAGGCCGGGGGATCGCTCGCCGGTGCCGT
CGTCTGCGCTTCTGTGGCGAGCTTGACGGAGGCGGTGCTGACGGGGGGGAACGACAACGTCATCGTTCCCGTTGT
GCTGTGGACGTGCGTCAAGAGTGTGGGCGTGTGAAGATGGATTGGAAGGGGGCGAGACGGCGTCTTGTCGTCTGG
CAATGTCCTGTACCTGCTCTACGACATACATGATGAAGAACAAGACGTCGTTTATGCCATCATGTCCTCCAGCAT
AGCCTCCAACTCATCGCGAGGAAAGGGGACGCTCAAAAGTTCAGTGCCGACGACGTCCTTGCGACTGGTGATGAT
CTGATGATCGTGAAACCTGCATCCAACAACGTCAGCCAAAACCCCCCAACAGAAAAGAAACAAGACCAAAAGAAG
GAAGAACCCAACTCTTTGAGCAGAGTGCGAAAGGCCATCTCAGAAGAGCACACAAACTCCTCAACCGCCTTGTTA
TACACAATCCGATACTCCACCGCCGCAACCTCGTCCCCTTCCTCCATGGCGACCAGCACCTCGCCCACAAGAAGG
CGGAACAGGCTCTTTGCATTCTCGGGCAAGCTGCGCAGCACAAAGGCCACGCCCTCCCTGGCGTGAAGCCGCGTG
GCAGACCTGCCCAGCAGCCGGTTCACCACGTCCACCACGTCGACCTCGACGTCGAGCGGGGCGTACGTCGTGGCG
TCGTGGAAGATGAAGTTGAAGGCGGAGCGGAGGCCGACGTCCCAGAGGAGGGGGAAGTCGGGCGTGTCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail