Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5752
Gene name
LocationContig_59:35200..38161
Strand+
Gene length (bp)2961
Transcript length (bp)2634
Coding sequence length (bp)2634
Protein length (aa) 878

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00654 Voltage_CLC Voltage gated chloride channel 6.0E-80 309 686

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 121 869 3.0E-135
sp|P51791|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2 121 869 3.0E-135
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 121 869 4.0E-135
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 121 869 7.0E-135
sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 121 869 7.0E-135
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51792|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2 121 869 3.0E-135
sp|P51791|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2 121 869 3.0E-135
sp|Q9R279|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1 121 869 4.0E-135
sp|O18894|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3 121 869 7.0E-135
sp|P51790|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2 121 869 7.0E-135
sp|Q9TTU3|CLCN5_RABIT H(+)/Cl(-) exchange transporter 5 OS=Oryctolagus cuniculus GN=CLCN5 PE=2 SV=1 121 875 5.0E-127
sp|Q5RDJ7|CLCN3_PONAB H(+)/Cl(-) exchange transporter 3 OS=Pongo abelii GN=CLCN3 PE=2 SV=1 121 869 2.0E-126
sp|Q99P66|CLCN5_CAVPO H(+)/Cl(-) exchange transporter 5 OS=Cavia porcellus GN=CLCN5 PE=2 SV=1 121 875 3.0E-125
sp|Q5RBK4|CLCN5_PONAB H(+)/Cl(-) exchange transporter 5 OS=Pongo abelii GN=CLCN5 PE=2 SV=1 121 875 1.0E-123
sp|P51795|CLCN5_HUMAN H(+)/Cl(-) exchange transporter 5 OS=Homo sapiens GN=CLCN5 PE=1 SV=1 121 875 1.0E-123
sp|P51796|CLCN5_RAT H(+)/Cl(-) exchange transporter 5 OS=Rattus norvegicus GN=Clcn5 PE=2 SV=1 121 870 4.0E-123
sp|Q9GKE7|CLCN5_PIG H(+)/Cl(-) exchange transporter 5 OS=Sus scrofa GN=CLCN5 PE=2 SV=1 121 875 5.0E-123
sp|Q9WVD4|CLCN5_MOUSE H(+)/Cl(-) exchange transporter 5 OS=Mus musculus GN=Clcn5 PE=1 SV=1 121 875 9.0E-123
sp|P51793|CLCN4_HUMAN H(+)/Cl(-) exchange transporter 4 OS=Homo sapiens GN=CLCN4 PE=1 SV=2 104 870 6.0E-122
sp|P51794|CLCN4_RAT H(+)/Cl(-) exchange transporter 4 OS=Rattus norvegicus GN=Clcn4 PE=2 SV=1 121 870 9.0E-121
sp|Q61418|CLCN4_MOUSE H(+)/Cl(-) exchange transporter 4 OS=Mus musculus GN=Clcn4 PE=2 SV=2 121 870 4.0E-120
sp|P0C197|CLCNX_USTMA Probable chloride channel protein UM03490-D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11084 PE=3 SV=1 310 708 2.0E-88
sp|P37020|GEF1_YEAST Anion/proton exchange transporter GEF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEF1 PE=1 SV=2 121 868 2.0E-68
sp|O60159|YHYB_SCHPO Putative anion/proton exchange transporter C19C7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C7.11 PE=3 SV=2 310 875 6.0E-68
sp|O94287|YOO2_SCHPO Uncharacterized chloride channel protein C887.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.02 PE=3 SV=2 309 869 2.0E-47
sp|Q54C67|CLCF_DICDI Chloride channel protein F OS=Dictyostelium discoideum GN=clcF PE=3 SV=1 309 749 2.0E-45
sp|Q54AX6|CLCA_DICDI Chloride channel protein A OS=Dictyostelium discoideum GN=clcA PE=2 SV=1 310 765 6.0E-45
sp|Q9BMK9|CLH3_CAEEL Chloride channel protein clh-3 OS=Caenorhabditis elegans GN=clh-3 PE=1 SV=1 309 706 2.0E-44
sp|Q75JF3|CLCC_DICDI Chloride channel protein C OS=Dictyostelium discoideum GN=clcC PE=3 SV=1 310 709 3.0E-44
sp|Q86AZ6|CLCB_DICDI Chloride channel protein B OS=Dictyostelium discoideum GN=clcB PE=3 SV=1 310 709 2.0E-43
sp|Q64347|CLCN1_MOUSE Chloride channel protein 1 OS=Mus musculus GN=Clcn1 PE=1 SV=3 309 803 3.0E-42
sp|P35525|CLCN2_RAT Chloride channel protein 2 OS=Rattus norvegicus GN=Clcn2 PE=1 SV=1 309 724 3.0E-42
sp|P35523|CLCN1_HUMAN Chloride channel protein 1 OS=Homo sapiens GN=CLCN1 PE=1 SV=3 305 784 4.0E-42
sp|P92942|CLCB_ARATH Chloride channel protein CLC-b OS=Arabidopsis thaliana GN=CLC-B PE=1 SV=1 309 735 5.0E-42
sp|P35524|CLCN1_RAT Chloride channel protein 1 OS=Rattus norvegicus GN=Clcn1 PE=1 SV=1 309 803 6.0E-42
sp|P51788|CLCN2_HUMAN Chloride channel protein 2 OS=Homo sapiens GN=CLCN2 PE=1 SV=2 309 724 2.0E-41
sp|P51789|CLCN2_RABIT Chloride channel protein 2 OS=Oryctolagus cuniculus GN=CLCN2 PE=2 SV=1 309 724 3.0E-41
sp|Q9R0A1|CLCN2_MOUSE Chloride channel protein 2 OS=Mus musculus GN=Clcn2 PE=1 SV=2 309 724 3.0E-41
sp|Q9WU45|CLCN2_CAVPO Chloride channel protein 2 OS=Cavia porcellus GN=CLCN2 PE=2 SV=1 309 724 6.0E-41
sp|P92941|CLCA_ARATH Chloride channel protein CLC-a OS=Arabidopsis thaliana GN=CLC-A PE=1 SV=2 305 735 1.0E-40
sp|Q9MZT1|CLCN1_CANLF Chloride channel protein 1 OS=Canis lupus familiaris GN=CLCN1 PE=1 SV=1 309 784 2.0E-40
sp|Q9VGH7|CLCN2_DROME Chloride channel protein 2 OS=Drosophila melanogaster GN=ClC-a PE=2 SV=3 312 706 1.0E-39
sp|Q96282|CLCC_ARATH Chloride channel protein CLC-c OS=Arabidopsis thaliana GN=CLC-C PE=1 SV=1 309 712 2.0E-38
sp|P51799|CLCN7_RAT H(+)/Cl(-) exchange transporter 7 OS=Rattus norvegicus GN=Clcn7 PE=2 SV=1 310 866 1.0E-37
sp|O70496|CLCN7_MOUSE H(+)/Cl(-) exchange transporter 7 OS=Mus musculus GN=Clcn7 PE=1 SV=1 310 866 5.0E-37
sp|P35522|CICH_TORCA Chloride channel protein OS=Torpedo californica PE=1 SV=3 309 706 5.0E-37
sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidopsis thaliana GN=CLC-D PE=1 SV=2 309 875 7.0E-37
sp|P21564|CICH_TORMA Chloride channel protein OS=Torpedo marmorata PE=1 SV=1 309 706 9.0E-37
sp|Q4PKH3|CLCN7_BOVIN H(+)/Cl(-) exchange transporter 7 OS=Bos taurus GN=CLCN7 PE=2 SV=1 310 866 9.0E-34
sp|Q9W701|CLCKB_XENLA Chloride channel protein ClC-Kb OS=Xenopus laevis GN=clcnkb PE=1 SV=1 310 870 2.0E-33
sp|Q9TT16|CLCN6_RABIT Chloride transport protein 6 OS=Oryctolagus cuniculus GN=CLCN6 PE=2 SV=1 310 707 4.0E-33
sp|O35454|CLCN6_MOUSE Chloride transport protein 6 OS=Mus musculus GN=Clcn6 PE=1 SV=1 310 707 2.0E-32
sp|P51798|CLCN7_HUMAN H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens GN=CLCN7 PE=1 SV=2 310 872 2.0E-32
sp|P51797|CLCN6_HUMAN Chloride transport protein 6 OS=Homo sapiens GN=CLCN6 PE=1 SV=2 310 707 8.0E-32
sp|Q54LQ4|CLCE_DICDI Chloride channel protein E OS=Dictyostelium discoideum GN=clcE PE=3 SV=1 310 710 2.0E-27
sp|P51803|CLCKA_RABIT Chloride channel protein ClC-Ka OS=Oryctolagus cuniculus GN=CLCNKA PE=2 SV=1 310 856 1.0E-25
sp|P51804|CLCKB_RABIT Chloride channel protein ClC-Kb OS=Oryctolagus cuniculus GN=CLCNKB PE=2 SV=1 310 853 2.0E-25
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 306 519 1.0E-20
sp|Q1ZXJ0|CLCD_DICDI Chloride channel protein D OS=Dictyostelium discoideum GN=clcD PE=3 SV=1 566 865 3.0E-20
sp|Q06393|CLCKA_RAT Chloride channel protein ClC-Ka OS=Rattus norvegicus GN=Clcnka PE=1 SV=3 310 706 5.0E-19
sp|Q9WUB6|CLCKB_MOUSE Chloride channel protein ClC-Kb OS=Mus musculus GN=Clcnkb PE=1 SV=2 309 754 8.0E-19
sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=3 SV=2 309 453 1.0E-18
sp|P51800|CLCKA_HUMAN Chloride channel protein ClC-Ka OS=Homo sapiens GN=CLCNKA PE=1 SV=1 309 754 1.0E-18
sp|P51802|CLCKB_RAT Chloride channel protein ClC-Kb OS=Rattus norvegicus GN=Clcnkb PE=1 SV=1 309 754 4.0E-18
sp|Q9WUB7|CLCKA_MOUSE Chloride channel protein ClC-Ka OS=Mus musculus GN=Clcnka PE=1 SV=2 310 754 8.0E-18
sp|P51801|CLCKB_HUMAN Chloride channel protein ClC-Kb OS=Homo sapiens GN=CLCNKB PE=1 SV=3 309 706 3.0E-17
sp|A7MGR4|CLCA_CROS8 H(+)/Cl(-) exchange transporter ClcA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=clcA PE=3 SV=1 309 695 3.0E-14
sp|B5RHE1|CLCA_SALG2 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=clcA PE=3 SV=1 334 695 3.0E-13
sp|B4TK31|CLCA_SALHS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella heidelberg (strain SL476) GN=clcA PE=3 SV=1 334 695 4.0E-13
sp|B5FJ02|CLCA_SALDC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella dublin (strain CT_02021853) GN=clcA PE=3 SV=1 334 695 4.0E-13
sp|B5F8R6|CLCA_SALA4 H(+)/Cl(-) exchange transporter ClcA OS=Salmonella agona (strain SL483) GN=clcA PE=3 SV=1 334 695 4.0E-13
sp|B5Y1L4|CLCA_KLEP3 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae (strain 342) GN=clcA PE=3 SV=1 334 695 6.0E-13
sp|A9N0Q1|CLCA_SALPB H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=clcA PE=3 SV=1 334 695 1.0E-12
sp|B4SUY5|CLCA_SALNS H(+)/Cl(-) exchange transporter ClcA OS=Salmonella newport (strain SL254) GN=clcA PE=3 SV=1 334 695 1.0E-12
sp|B5R3G7|CLCA_SALEP H(+)/Cl(-) exchange transporter ClcA OS=Salmonella enteritidis PT4 (strain P125109) GN=clcA PE=3 SV=1 334 695 1.0E-12
sp|B4TXQ7|CLCA_SALSV H(+)/Cl(-) exchange transporter ClcA OS=Salmonella schwarzengrund (strain CVM19633) GN=clcA PE=3 SV=1 334 695 1.0E-12
sp|C0Q5R6|CLCA_SALPC H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi C (strain RKS4594) GN=clcA PE=3 SV=1 334 695 1.0E-12
sp|Q57T52|CLCA_SALCH H(+)/Cl(-) exchange transporter ClcA OS=Salmonella choleraesuis (strain SC-B67) GN=clcA PE=3 SV=1 334 695 1.0E-12
sp|Q8ZRP8|CLCA_SALTY H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clcA PE=1 SV=1 334 695 2.0E-12
sp|A8ALD3|CLCA_CITK8 H(+)/Cl(-) exchange transporter ClcA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clcA PE=3 SV=1 334 695 2.0E-12
sp|Q8Z9B3|CLCA_SALTI H(+)/Cl(-) exchange transporter ClcA OS=Salmonella typhi GN=clcA PE=3 SV=1 334 695 2.0E-12
sp|A9MPK6|CLCA_SALAR H(+)/Cl(-) exchange transporter ClcA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=clcA PE=3 SV=1 334 695 3.0E-12
sp|B5BL83|CLCA_SALPK H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain AKU_12601) GN=clcA PE=3 SV=1 334 695 6.0E-12
sp|Q5PD50|CLCA_SALPA H(+)/Cl(-) exchange transporter ClcA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clcA PE=3 SV=1 334 695 6.0E-12
sp|B1JK21|CLCA_YERPY H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=clcA PE=3 SV=1 334 742 4.0E-11
sp|A4TPW7|CLCA_YERPP H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis (strain Pestoides F) GN=clcA PE=3 SV=1 334 742 4.0E-11
sp|Q1CLU6|CLCA_YERPN H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=clcA PE=3 SV=1 334 742 4.0E-11
sp|A9R1E4|CLCA_YERPG H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=clcA PE=3 SV=1 334 742 4.0E-11
sp|Q8ZBM0|CLCA_YERPE H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis GN=clcA PE=3 SV=1 334 742 4.0E-11
sp|B2K549|CLCA_YERPB H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=clcA PE=3 SV=1 334 742 4.0E-11
sp|Q1C3X2|CLCA_YERPA H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=clcA PE=3 SV=1 334 742 4.0E-11
sp|A7FM08|CLCA_YERP3 H(+)/Cl(-) exchange transporter ClcA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clcA PE=3 SV=1 334 742 4.0E-11
sp|A6T4V9|CLCA_KLEP7 H(+)/Cl(-) exchange transporter ClcA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=clcA PE=3 SV=1 310 695 6.0E-11
sp|Q8ZEB3|CLCB_YERPE Voltage-gated ClC-type chloride channel ClcB OS=Yersinia pestis GN=clcB PE=3 SV=2 337 694 1.0E-10
sp|P60300|CLCG_ARATH Putative chloride channel-like protein CLC-g OS=Arabidopsis thaliana GN=CBSCLC6 PE=3 SV=2 545 849 9.0E-09
sp|Q8XTT4|CLCL_RALSO Putative chloride channel protein ClcB-like OS=Ralstonia solanacearum (strain GMI1000) GN=RSp0020 PE=3 SV=2 329 694 3.0E-08
sp|O60159|YHYB_SCHPO Putative anion/proton exchange transporter C19C7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19C7.11 PE=3 SV=2 110 227 9.0E-07
sp|Q325Y4|CLCA_SHIBS H(+)/Cl(-) exchange transporter ClcA OS=Shigella boydii serotype 4 (strain Sb227) GN=clcA PE=3 SV=1 355 677 1.0E-06
sp|Q3Z5K2|CLCA_SHISS H(+)/Cl(-) exchange transporter ClcA OS=Shigella sonnei (strain Ss046) GN=clcA PE=1 SV=1 355 695 2.0E-06
sp|B6HZD1|CLCA_ECOSE H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain SE11) GN=clcA PE=3 SV=1 355 695 2.0E-06
sp|B7N824|CLCA_ECOLU H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=clcA PE=3 SV=1 355 695 2.0E-06
sp|P37019|CLCA_ECOLI H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain K12) GN=clcA PE=1 SV=2 355 695 2.0E-06
sp|B1IQI5|CLCA_ECOLC H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=clcA PE=3 SV=1 355 695 2.0E-06
sp|B1XD25|CLCA_ECODH H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain K12 / DH10B) GN=clcA PE=3 SV=1 355 695 2.0E-06
sp|C4ZRP8|CLCA_ECOBW H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=clcA PE=3 SV=1 355 695 2.0E-06
sp|B7M196|CLCA_ECO8A H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O8 (strain IAI1) GN=clcA PE=3 SV=1 355 695 2.0E-06
sp|B7LGL7|CLCA_ECO55 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain 55989 / EAEC) GN=clcA PE=3 SV=1 355 695 2.0E-06
sp|B7UIK2|CLCA_ECO27 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=clcA PE=3 SV=1 355 695 2.0E-06
sp|A7ZHP7|CLCA_ECO24 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=clcA PE=3 SV=1 355 695 2.0E-06
sp|A7ZWA3|CLCA_ECOHS H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O9:H4 (strain HS) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|B7LWB6|CLCA_ESCF3 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|Q32JV3|CLCA_SHIDS H(+)/Cl(-) exchange transporter ClcA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|Q1RG33|CLCA_ECOUT H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain UTI89 / UPEC) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|B1LGV8|CLCA_ECOSM H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|Q8FL15|CLCA_ECOL6 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|Q0TLH6|CLCA_ECOL5 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|A1A7K1|CLCA_ECOK1 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O1:K1 / APEC GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|B7MP17|CLCA_ECO81 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O81 (strain ED1a) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|B7NIB8|CLCA_ECO7I H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|B5Z0D5|CLCA_ECO5E H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|P58244|CLCA_ECO57 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O157:H7 GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|B7MBD8|CLCA_ECO45 H(+)/Cl(-) exchange transporter ClcA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=clcA PE=3 SV=1 355 695 3.0E-06
sp|B2U300|CLCA_SHIB3 H(+)/Cl(-) exchange transporter ClcA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=clcA PE=3 SV=1 355 695 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006821 chloride transport Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005247 voltage-gated chloride channel activity Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0008308 voltage-gated anion channel activity No
GO:0005244 voltage-gated ion channel activity No
GO:0005253 anion channel activity No
GO:0015267 channel activity No
GO:0006820 anion transport No
GO:0008509 anion transmembrane transporter activity No
GO:0051179 localization No
GO:0015108 chloride transmembrane transporter activity No
GO:0005216 ion channel activity No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0022832 voltage-gated channel activity No
GO:0005575 cellular_component No
GO:0022836 gated channel activity No
GO:0003674 molecular_function No
GO:0005254 chloride channel activity No
GO:0008150 biological_process No
GO:0015698 inorganic anion transport No
GO:0022803 passive transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 162 180 18
2 235 254 19
3 325 347 22
4 389 411 22
5 423 445 22
6 460 482 22
7 503 522 19
8 561 583 22
9 590 612 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5752
MAMGDPEPPDPSSQASSPLTMRRPTSLRRRHSSGESDERSPLLAPPPRTTSRPRVRIRSGADSPRFPSLSRDQSY
AGSVFGARHHSRHESLSQRLLSAFAEGRGSIAGSKSSLFVDERVWYDQFTSTDWVHDAIADSHRVKALRSRRGFW
GRAAILYDGVQGWILSALSGFVVALIAYAVDVSEATVFDYKDGYCARAWYLGEQKCCPHGPCEDWKNWSEVVSIS
PLGPGWTEFTIYMSCVVGFAVFSCWLALWTETVVPSAYRLTTLDENFAALSPPQLSDEGQTDDSASPRRRSDADG
VNPPMVYYSAAGSGVAEVRVIISGFVLHGFLGFKTLVIKMISLVFSVSSGLSLGKEGPFVHMATCVGNIACRLFP
KYDQNDAKRREALSAAAAAGVAVAFGAPLGGVLFGLEEVAYFFPAKTLFRTFFCCIIAALSLKFLNPFGTHKIVM
FEVRYLVDWDFFELLGFIFVGVLGGAIGALFIKAHKHWAHSFRRIHVIKTYPMFEVFLVAAITGLMSYWNVLTKL
PVAKLLFNLASPCDHSSDGYEDELGLCVKSADDIPGVIRNLFIAFVIKGFLTVITFGIKVPSGIYIPSMVVGGLL
GRIVGHLMQWLVMSVPHWRIFGNCATAVEGTCVQPGVYGLIAAGATMCGTTRLSVTLAVILFELTGSLDYVLPFS
LSILVSKWTADAIEPHSIYDLLTSMNSYPFLDNKRKPVFTGDLEDIVPRLRRERVIDITDSPLVSATSLRAKLEV
LHRSAELDGGLPIVRYGVLVGLIPAPDLEYALDQLEDEDSSMCLMDRVPSIDDDDVCEADPTDFARYIDPAPVAL
DIRSPMDLVYECFVKLGLRYICVLKDGKYAGMTHKKTFVKYMRQLEEDGDWT*
Coding >Ophun1|5752
ATGGCCATGGGTGACCCTGAACCGCCGGACCCTTCTTCTCAAGCGTCGTCCCCTCTGACGATGCGCCGGCCTACC
TCCTTACGCCGACGTCACTCGAGCGGCGAGTCCGACGAGCGCTCGCCGCTACTGGCGCCGCCTCCGAGGACGACG
TCGAGGCCCCGAGTCCGAATCCGCAGCGGCGCCGACTCTCCCCGCTTCCCGTCCCTCTCTAGGGACCAGAGCTAC
GCAGGAAGCGTCTTTGGCGCACGTCATCACAGTCGACACGAGTCACTGAGTCAGAGACTGTTGTCAGCCTTTGCC
GAAGGGCGTGGGTCCATTGCGGGCTCCAAGAGCTCCCTGTTCGTCGACGAACGAGTTTGGTACGATCAGTTCACA
AGCACCGACTGGGTACACGATGCCATTGCCGATTCACACCGAGTCAAGGCCCTCCGCAGTAGAAGAGGCTTCTGG
GGCCGTGCCGCCATTTTGTATGACGGTGTTCAGGGCTGGATTCTCAGCGCGCTCTCGGGCTTCGTTGTCGCCCTC
ATTGCCTACGCCGTCGACGTGAGTGAAGCTACCGTCTTCGATTACAAAGACGGCTATTGTGCCAGGGCGTGGTAT
CTCGGGGAGCAGAAATGCTGTCCTCATGGCCCTTGCGAGGACTGGAAGAACTGGTCTGAAGTCGTCAGCATCAGC
CCTCTCGGTCCGGGGTGGACCGAATTCACCATTTACATGTCATGCGTCGTTGGCTTCGCCGTCTTTTCCTGCTGG
CTGGCCCTGTGGACGGAGACGGTGGTGCCATCGGCGTATCGCCTGACGACGCTTGACGAGAACTTCGCCGCGCTG
AGCCCTCCGCAGCTCTCGGACGAGGGCCAGACGGACGATTCGGCGAGTCCCCGGCGCCGGAGCGATGCCGATGGC
GTGAACCCGCCGATGGTTTATTACTCGGCAGCCGGCAGCGGTGTGGCCGAGGTGCGCGTCATCATCAGCGGCTTC
GTTCTGCACGGCTTCCTCGGCTTCAAGACGCTGGTCATCAAGATGATCTCGCTCGTCTTCAGCGTCTCGTCCGGC
CTCAGCCTGGGAAAGGAAGGGCCGTTTGTCCACATGGCAACGTGCGTCGGCAACATTGCCTGTCGATTGTTCCCC
AAGTACGACCAGAACGATGCCAAGCGACGAGAGGCCCTTTCAGCAGCGGCTGCGGCGGGCGTTGCTGTCGCCTTT
GGAGCACCGTTGGGGGGCGTCTTGTTCGGGCTCGAGGAGGTGGCCTACTTCTTCCCGGCCAAGACGCTGTTCCGG
ACTTTTTTCTGCTGCATCATCGCCGCCCTCTCGCTCAAGTTCCTCAACCCTTTCGGCACCCACAAGATCGTCATG
TTCGAGGTGCGCTACCTGGTCGACTGGGACTTTTTCGAGCTGCTGGGCTTCATCTTTGTCGGCGTCCTCGGCGGT
GCCATTGGCGCGCTCTTCATCAAGGCTCACAAGCACTGGGCCCATAGCTTCCGCCGCATTCATGTCATAAAGACC
TATCCCATGTTTGAAGTCTTTCTCGTCGCCGCCATCACCGGCCTCATGAGCTACTGGAACGTGCTGACGAAGCTG
CCCGTGGCCAAACTGCTCTTCAACCTGGCGTCTCCATGTGACCACTCGTCTGACGGCTACGAGGATGAGCTTGGC
CTGTGTGTGAAGTCGGCCGACGACATTCCGGGTGTCATTCGGAACCTCTTTATTGCGTTCGTTATCAAGGGGTTC
CTGACCGTCATCACCTTTGGCATTAAAGTTCCGTCTGGCATTTATATCCCATCCATGGTAGTGGGCGGTCTGCTG
GGCCGCATCGTGGGCCACCTGATGCAATGGCTGGTGATGTCGGTACCGCACTGGCGCATCTTTGGCAACTGTGCC
ACGGCAGTGGAAGGGACCTGTGTTCAACCCGGCGTGTACGGCCTCATAGCGGCCGGGGCGACCATGTGCGGGACG
ACCAGGCTATCGGTGACGCTGGCCGTCATCCTGTTTGAACTGACAGGCAGTCTGGACTATGTCCTCCCGTTTTCT
CTGTCCATCTTGGTTTCCAAGTGGACGGCGGACGCCATTGAGCCGCACAGCATCTACGACCTTCTCACGAGCATG
AACTCGTACCCGTTCCTCGACAACAAACGCAAGCCCGTCTTCACCGGCGACTTGGAGGACATTGTGCCGCGGCTG
CGACGAGAGCGAGTGATTGACATAACCGACTCGCCTCTGGTGTCGGCGACGAGCCTCCGGGCCAAGCTCGAAGTG
CTGCACCGGTCGGCCGAGCTGGACGGCGGGCTGCCGATTGTTCGGTACGGGGTACTGGTCGGGCTCATCCCGGCG
CCGGACCTGGAGTACGCGCTCGATCAGCTAGAGGACGAGGATTCCAGCATGTGTCTGATGGACCGGGTACCGAGT
ATCGACGACGACGACGTGTGCGAGGCGGACCCGACAGACTTTGCGCGCTACATCGATCCGGCGCCCGTTGCGCTG
GACATCCGGTCGCCGATGGACCTCGTGTACGAGTGCTTCGTCAAGCTAGGTCTCCGGTACATTTGCGTGCTCAAA
GATGGCAAATACGCGGGCATGACACACAAGAAGACGTTTGTCAAGTACATGAGGCAGCTCGAAGAGGACGGAGAC
TGGACTTGA
Transcript >Ophun1|5752
ATGGCCATGGGTGACCCTGAACCGCCGGACCCTTCTTCTCAAGCGTCGTCCCCTCTGACGATGCGCCGGCCTACC
TCCTTACGCCGACGTCACTCGAGCGGCGAGTCCGACGAGCGCTCGCCGCTACTGGCGCCGCCTCCGAGGACGACG
TCGAGGCCCCGAGTCCGAATCCGCAGCGGCGCCGACTCTCCCCGCTTCCCGTCCCTCTCTAGGGACCAGAGCTAC
GCAGGAAGCGTCTTTGGCGCACGTCATCACAGTCGACACGAGTCACTGAGTCAGAGACTGTTGTCAGCCTTTGCC
GAAGGGCGTGGGTCCATTGCGGGCTCCAAGAGCTCCCTGTTCGTCGACGAACGAGTTTGGTACGATCAGTTCACA
AGCACCGACTGGGTACACGATGCCATTGCCGATTCACACCGAGTCAAGGCCCTCCGCAGTAGAAGAGGCTTCTGG
GGCCGTGCCGCCATTTTGTATGACGGTGTTCAGGGCTGGATTCTCAGCGCGCTCTCGGGCTTCGTTGTCGCCCTC
ATTGCCTACGCCGTCGACGTGAGTGAAGCTACCGTCTTCGATTACAAAGACGGCTATTGTGCCAGGGCGTGGTAT
CTCGGGGAGCAGAAATGCTGTCCTCATGGCCCTTGCGAGGACTGGAAGAACTGGTCTGAAGTCGTCAGCATCAGC
CCTCTCGGTCCGGGGTGGACCGAATTCACCATTTACATGTCATGCGTCGTTGGCTTCGCCGTCTTTTCCTGCTGG
CTGGCCCTGTGGACGGAGACGGTGGTGCCATCGGCGTATCGCCTGACGACGCTTGACGAGAACTTCGCCGCGCTG
AGCCCTCCGCAGCTCTCGGACGAGGGCCAGACGGACGATTCGGCGAGTCCCCGGCGCCGGAGCGATGCCGATGGC
GTGAACCCGCCGATGGTTTATTACTCGGCAGCCGGCAGCGGTGTGGCCGAGGTGCGCGTCATCATCAGCGGCTTC
GTTCTGCACGGCTTCCTCGGCTTCAAGACGCTGGTCATCAAGATGATCTCGCTCGTCTTCAGCGTCTCGTCCGGC
CTCAGCCTGGGAAAGGAAGGGCCGTTTGTCCACATGGCAACGTGCGTCGGCAACATTGCCTGTCGATTGTTCCCC
AAGTACGACCAGAACGATGCCAAGCGACGAGAGGCCCTTTCAGCAGCGGCTGCGGCGGGCGTTGCTGTCGCCTTT
GGAGCACCGTTGGGGGGCGTCTTGTTCGGGCTCGAGGAGGTGGCCTACTTCTTCCCGGCCAAGACGCTGTTCCGG
ACTTTTTTCTGCTGCATCATCGCCGCCCTCTCGCTCAAGTTCCTCAACCCTTTCGGCACCCACAAGATCGTCATG
TTCGAGGTGCGCTACCTGGTCGACTGGGACTTTTTCGAGCTGCTGGGCTTCATCTTTGTCGGCGTCCTCGGCGGT
GCCATTGGCGCGCTCTTCATCAAGGCTCACAAGCACTGGGCCCATAGCTTCCGCCGCATTCATGTCATAAAGACC
TATCCCATGTTTGAAGTCTTTCTCGTCGCCGCCATCACCGGCCTCATGAGCTACTGGAACGTGCTGACGAAGCTG
CCCGTGGCCAAACTGCTCTTCAACCTGGCGTCTCCATGTGACCACTCGTCTGACGGCTACGAGGATGAGCTTGGC
CTGTGTGTGAAGTCGGCCGACGACATTCCGGGTGTCATTCGGAACCTCTTTATTGCGTTCGTTATCAAGGGGTTC
CTGACCGTCATCACCTTTGGCATTAAAGTTCCGTCTGGCATTTATATCCCATCCATGGTAGTGGGCGGTCTGCTG
GGCCGCATCGTGGGCCACCTGATGCAATGGCTGGTGATGTCGGTACCGCACTGGCGCATCTTTGGCAACTGTGCC
ACGGCAGTGGAAGGGACCTGTGTTCAACCCGGCGTGTACGGCCTCATAGCGGCCGGGGCGACCATGTGCGGGACG
ACCAGGCTATCGGTGACGCTGGCCGTCATCCTGTTTGAACTGACAGGCAGTCTGGACTATGTCCTCCCGTTTTCT
CTGTCCATCTTGGTTTCCAAGTGGACGGCGGACGCCATTGAGCCGCACAGCATCTACGACCTTCTCACGAGCATG
AACTCGTACCCGTTCCTCGACAACAAACGCAAGCCCGTCTTCACCGGCGACTTGGAGGACATTGTGCCGCGGCTG
CGACGAGAGCGAGTGATTGACATAACCGACTCGCCTCTGGTGTCGGCGACGAGCCTCCGGGCCAAGCTCGAAGTG
CTGCACCGGTCGGCCGAGCTGGACGGCGGGCTGCCGATTGTTCGGTACGGGGTACTGGTCGGGCTCATCCCGGCG
CCGGACCTGGAGTACGCGCTCGATCAGCTAGAGGACGAGGATTCCAGCATGTGTCTGATGGACCGGGTACCGAGT
ATCGACGACGACGACGTGTGCGAGGCGGACCCGACAGACTTTGCGCGCTACATCGATCCGGCGCCCGTTGCGCTG
GACATCCGGTCGCCGATGGACCTCGTGTACGAGTGCTTCGTCAAGCTAGGTCTCCGGTACATTTGCGTGCTCAAA
GATGGCAAATACGCGGGCATGACACACAAGAAGACGTTTGTCAAGTACATGAGGCAGCTCGAAGAGGACGGAGAC
TGGACTTGA
Gene >Ophun1|5752
ATGGCCATGGGTGACCCTGAACCGCCGGACCCTTCTTCTCAAGCGTCGTCCCCTCTGACGATGCGCCGGCCTACC
TCCTTACGCCGACGTCACTCGAGCGGCGAGTCCGACGAGCGCTCGCCGCTACTGGCGCCGCCTCCGAGGACGACG
TCGAGGCCCCGAGTCCGAATCCGCAGCGGCGCCGACTCTCCCCGCTTCCCGTCCCTCTCTAGGGACCAGAGCTAC
GCAGGTTAGTCGGCCCCCTGCTCCAAGTTGGCTTACACTCGGTCTTCCGCTGACGTCCAACTGGCTTATAGGAAG
CGTCTTTGGCGCACGTCATCACAGTCGACACGAGTCACTGAGTCAGAGACTGTTGTCAGCCTTTGCCGAAGGGCG
TGGGTCCATTGCGGGCTCCAAGAGCTCCCTGTTCGTCGACGAACGAGTTTGGTACGATCAGTTCACAAGCACCGA
CTGGGTACACGATGCCATTGCCGATTCACACCGAGTCAAGGCCCTCCGCAGTAGAAGAGGCTTCTGGGGCCGTGC
CGCCATTTTGTATGACGGTGTTCAGGGCTGGATTCTCAGCGCGCTCTCGGGCTTCGTTGTCGCCCTCATTGCCTA
CGCCGTCGACGTGAGTGAAGCTACCGTCTTCGATTACAAAGACGGCTATTGTGCCAGGGCGTGGTATCTCGGGGA
GCAGGTGAGGCCTTGGTTCGTAGGCCGCTGGCTTGCGCGTGCTTACGCGCTTGACAGAAATGCTGTCCTCATGGC
CCTTGCGAGGACTGGAAGAACTGGTCTGAAGTCGTCAGCATCAGCCCTCTCGGTCCGGGGTGGACCGAATTCACC
ATTTACATGTCATGCGTCGTTGGCTTCGCCGTCTTTTCCTGCTGGCTGGCCCTGTGGACGGAGACGGTGGTGCCA
TCGGCGTATCGCCTGACGACGCTTGACGAGAACTTCGCCGCGCTGAGCCCTCCGCAGCTCTCGGACGAGGGCCAG
ACGGACGATTCGGCGAGTCCCCGGCGCCGGAGCGATGCCGATGGCGTGAACCCGCCGATGGTTTATTACTCGGCA
GCCGGCAGCGGTGTGGCCGAGGTGCGCGTCATCATCAGCGGCTTCGTTCTGCACGGCTTCCTCGGCTTCAAGACG
CTGGTCATCAAGATGATCTCGCTCGTCTTCAGCGTCTCGTCCGGCCTCAGCCTGGGAAAGGAAGGGCCGTTTGTC
CACATGGCAACGTGCGTCGGCAACATTGCCTGTCGATTGTTCCCCAAGTACGACCAGAACGATGCCAAGCGACGA
GAGGCCCTTTCAGCAGCGGCTGCGGCGGGCGTTGCTGTCGCCTTTGGAGCACCGTTGGGGGGCGTCTTGTTCGGG
CTCGAGGAGGTGGCCTACTTCTTCCCGGCCAAGACGCTGTTCCGGACTTTTTTCTGCTGCATCATCGCCGCCCTC
TCGCTCAAGTTCCTCAACCCTTTCGGCACCCACAAGATCGTCATGTTCGAGGTGCGCTACCTGGTCGACTGGGAC
TTTTTCGAGCTGCTGGGCTTCATCTTTGTCGGCGTCCTCGGCGGTGCCATTGGCGCGCTCTTCATCAAGGCTCAC
AAGCACTGGGCCCATAGCTTCCGCCGCATTCATGTCATAAAGACCTATCCCATGTTTGAAGTCTTTCTCGTCGCC
GCCATCACCGGCCTCATGAGCTACTGGAACGTGCTGACGAAGCTGCCCGTGGCCAAACTGCTCTTCAACCTGGCG
TCTCCATGTGACCACTCGTCTGACGGCTACGAGGATGAGCTTGGCCTGTGTGTGAAGTCGGCCGACGACATTCCG
GGTGTCATTCGGAACCTCTTTATTGCGTTCGTTATCAAGGGGTTCCTGACCGTCATCACCTTTGGCATTGTGAGT
GGCGAGCAAGACGTTTCAACAGGGAATTGGCTAACGGACCGGATAGAAAGTTCCGTCTGGCATTTATATCCCATC
CATGGTAGTGGGCGGTCTGCTGGGCCGCATCGTGGGCCACCTGATGCAATGGCTGGTGATGTCGGTACCGCACTG
GCGCATCTTTGGCAACTGTGCCACGGCAGTGGAAGGGACCTGTGTTCAACCCGGCGTGTACGGCCTCATAGCGGC
CGGGGCGACCATGTGCGGGACGACCAGGCTATCGGTGACGCTGGCCGTCATCCTGTTTGAACTGACAGGCAGTCT
GGACTATGTCCTCCCGTTTTCTCTGTCCATCTTGGTTTCCAAGTGGACGGCGGACGCCATTGAGCCGCACAGCAT
CTACGTGAGCGTGTAGTTCCTGGGCAGAGGTTAGCGACTGACTGCTGCGGACAGGACCTTCTCACGAGCATGAAC
TCGTACCCGTTCCTCGACAACAAACGCAAGCCCGTCTTCACCGGCGACTTGGAGGACATTGTGCCGCGGCTGCGA
CGAGAGCGAGTGATTGACATAACCGACTCGCCTCTGGTGTCGGCGACGAGCCTCCGGGCCAAGCTCGAAGTGCTG
CACCGGTCGGCCGAGCTGGACGGCGGGCTGCCGATTGTTCGGTACGGGGTACTGGTCGGGCTCATCCCGGCGCCG
GACCTGGAGTACGCGCTCGATCAGCTAGAGGACGAGGATTCCAGCATGTGTCTGATGGACCGGGTACCGAGTATC
GACGACGACGACGTGTGCGAGGCGGACCCGACAGACTTTGCGCGCTACATCGATCCGGTGAGTCGGCCCGGGAAT
AGGTAGTGGCAGAAGGCGGCTGACGGGGTTGTGGCAGGCGCCCGTTGCGCTGGACATCCGGTCGCCGATGGACCT
CGTGTACGAGTGCTTCGTCAAGCTAGGTCTCCGGTACATTTGCGTGCTCAAAGATGGCAAATACGCGGGCATGGT
AAGCGGCACAGAGTCGACCAGTCAGGACGATGGGCTAAGACGACGCAGACACACAAGAAGACGTTTGTCAAGTAC
ATGAGGCAGCTCGAAGAGGACGGAGACTGGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail