Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5751
Gene name
LocationContig_59:32071..33877
Strand-
Gene length (bp)1806
Transcript length (bp)1806
Coding sequence length (bp)1806
Protein length (aa) 602

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09368 Sas10 Sas10 C-terminal domain 5.9E-27 527 601
PF04000 Sas10_Utp3 Sas10/Utp3/C1D family 2.1E-11 210 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTS0|YBH9_SCHPO Uncharacterized protein C3B8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.09 PE=1 SV=1 26 601 8.0E-65
sp|Q12136|SAS10_YEAST Something about silencing protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS10 PE=1 SV=1 110 601 1.0E-50
sp|Q9I7W5|SAS10_DROME Something about silencing protein 10 OS=Drosophila melanogaster GN=Sas10 PE=1 SV=2 527 601 7.0E-08
sp|Q9JI13|SAS10_MOUSE Something about silencing protein 10 OS=Mus musculus GN=Utp3 PE=1 SV=1 527 601 2.0E-07
sp|Q6AXX4|SAS10_RAT Something about silencing protein 10 OS=Rattus norvegicus GN=Utp3 PE=1 SV=1 527 601 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTS0|YBH9_SCHPO Uncharacterized protein C3B8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.09 PE=1 SV=1 26 601 8.0E-65
sp|Q12136|SAS10_YEAST Something about silencing protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAS10 PE=1 SV=1 110 601 1.0E-50
sp|Q9I7W5|SAS10_DROME Something about silencing protein 10 OS=Drosophila melanogaster GN=Sas10 PE=1 SV=2 527 601 7.0E-08
sp|Q9JI13|SAS10_MOUSE Something about silencing protein 10 OS=Mus musculus GN=Utp3 PE=1 SV=1 527 601 2.0E-07
sp|Q6AXX4|SAS10_RAT Something about silencing protein 10 OS=Rattus norvegicus GN=Utp3 PE=1 SV=1 527 601 2.0E-07
sp|Q9NQZ2|SAS10_HUMAN Something about silencing protein 10 OS=Homo sapiens GN=UTP3 PE=1 SV=1 527 601 2.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4348
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3822
Ophiocordyceps australis map64 (Brazil) OphauB2|6769
Ophiocordyceps camponoti-floridani Ophcf2|03657
Ophiocordyceps camponoti-rufipedis Ophun1|5751 (this protein)
Ophiocordyceps kimflemingae Ophio5|6391
Ophiocordyceps subramaniannii Hirsu2|8938

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5751
MGKKRKAHGRAPEPQGPREIDPADARLGPISTFEDVADSEDEYFLARDQILLDDEPVSKRRRKVDEVMELSDEEI
FPYQDNQSGLNDDARKKKRKGADDGDDEDDEDEDDDAGWWGSSKQAYYDADKIETEADALEEEAEAKRLQKKKLS
KMREEDFVFDGQEWLTGEPDAERDDETTTELLKDVQVAEDATSEERLKLLASGYPEFSYLVDEFQKLQPVLKTLE
AEAQNKPGQSLESIKYWILGCYIAALASYFAIFTSPARDGPDAQKPLPPSELRDHDVMETLVSCRKAWERVKLVK
CLRRSNDAVVSETEIVATAVDGIEDAKASKTEANKDEVTVAKQAKKRAKVKAIEDDVADLYDLPLGLGKSDKSRK
PTRPKADDDSDFGEEDGLDDKAAADKAKRRKSLRFYTSQIVQKANRRLEAGREAGGDADIPHRERLRDRQARLLA
EAEKRSKKTNKRGGDEDDDDDKEDKLASAIRADEDDYYNEVAQASKTKREEKAARYAAYAAANKADRVVEKEEVG
VDGKRKVTYAIQKNKGLAPKRSKDVRNPRVRRRKQFDAKQKKLRSMRSEWKGGEPVGGYQGERTGINAAVIKSIK
L*
Coding >Ophun1|5751
ATGGGCAAGAAGAGAAAGGCACACGGACGCGCTCCGGAACCCCAGGGGCCACGGGAGATTGACCCGGCCGATGCC
CGTCTGGGACCCATTTCGACGTTCGAAGATGTCGCCGACTCTGAAGACGAATACTTCTTGGCCCGAGACCAGATT
CTGCTTGACGACGAGCCGGTGTCTAAGCGGCGGAGAAAGGTTGATGAGGTCATGGAACTATCCGACGAGGAGATA
TTTCCGTATCAGGACAATCAGTCGGGATTGAATGACGATGCTCGCAAGAAAAAACGCAAAGGGGCCGACGATGGC
GACGACGAGGACGACGAGGACGAGGACGACGACGCCGGCTGGTGGGGTTCTTCTAAGCAGGCCTACTACGATGCG
GACAAGATTGAGACCGAGGCCGACGCCCTTGAGGAAGAGGCCGAGGCGAAGCGTCTGCAGAAGAAGAAGCTGTCC
AAGATGCGCGAGGAAGACTTTGTCTTTGATGGCCAGGAATGGCTCACTGGCGAACCCGACGCCGAGCGAGACGAC
GAAACGACCACGGAGCTTCTCAAGGACGTTCAAGTTGCCGAAGACGCGACGTCGGAAGAACGACTGAAGCTTCTC
GCGTCGGGATACCCCGAATTCTCGTATCTCGTCGACGAGTTTCAGAAATTGCAGCCAGTATTGAAGACGCTCGAG
GCCGAAGCTCAGAACAAACCGGGCCAGTCACTCGAGTCCATCAAGTACTGGATACTCGGGTGCTACATCGCGGCA
CTGGCCAGTTACTTTGCCATCTTCACCTCCCCGGCGCGTGACGGCCCCGACGCACAGAAACCACTGCCCCCATCA
GAACTGCGCGATCACGATGTCATGGAAACTCTCGTCTCTTGCCGCAAGGCCTGGGAAAGAGTCAAGCTTGTCAAG
TGTCTCCGGCGCTCGAACGATGCGGTAGTGTCCGAGACGGAAATTGTCGCGACGGCAGTCGATGGCATTGAAGAC
GCAAAAGCGAGCAAGACGGAGGCAAACAAAGATGAAGTCACCGTAGCTAAGCAAGCGAAGAAACGCGCCAAGGTC
AAGGCCATTGAGGACGACGTCGCCGACCTCTACGACCTGCCTCTCGGTCTCGGCAAGTCGGACAAGTCCAGGAAA
CCGACGAGGCCGAAAGCCGACGATGATTCCGACTTTGGCGAAGAAGACGGCCTGGACGACAAGGCAGCAGCGGAC
AAGGCTAAGCGACGAAAGAGTCTCCGGTTCTACACATCGCAGATTGTGCAAAAGGCCAATCGTCGACTTGAGGCG
GGTCGCGAAGCCGGCGGAGATGCCGACATTCCGCACAGGGAGCGATTGCGAGACCGCCAGGCTCGCCTTTTGGCC
GAGGCAGAGAAGCGAAGCAAAAAGACCAATAAGCGTGGGGGCGACGAGGATGACGATGACGACAAGGAGGACAAG
CTGGCCAGCGCCATACGGGCGGACGAGGACGACTACTACAACGAGGTAGCACAGGCGTCCAAGACGAAGCGAGAG
GAGAAGGCGGCCCGGTACGCGGCCTACGCAGCGGCGAACAAGGCCGACAGGGTGGTAGAAAAGGAGGAGGTTGGG
GTGGACGGCAAGAGGAAGGTGACGTACGCGATTCAGAAGAACAAGGGCCTGGCTCCGAAGAGAAGCAAGGATGTC
CGGAACCCGAGGGTCAGGAGGAGGAAGCAGTTTGATGCCAAGCAGAAGAAGCTGAGGAGCATGCGGTCGGAGTGG
AAAGGCGGCGAGCCGGTGGGCGGCTACCAGGGCGAGCGGACGGGCATCAATGCGGCGGTGATCAAGAGTATAAAG
CTGTAG
Transcript >Ophun1|5751
ATGGGCAAGAAGAGAAAGGCACACGGACGCGCTCCGGAACCCCAGGGGCCACGGGAGATTGACCCGGCCGATGCC
CGTCTGGGACCCATTTCGACGTTCGAAGATGTCGCCGACTCTGAAGACGAATACTTCTTGGCCCGAGACCAGATT
CTGCTTGACGACGAGCCGGTGTCTAAGCGGCGGAGAAAGGTTGATGAGGTCATGGAACTATCCGACGAGGAGATA
TTTCCGTATCAGGACAATCAGTCGGGATTGAATGACGATGCTCGCAAGAAAAAACGCAAAGGGGCCGACGATGGC
GACGACGAGGACGACGAGGACGAGGACGACGACGCCGGCTGGTGGGGTTCTTCTAAGCAGGCCTACTACGATGCG
GACAAGATTGAGACCGAGGCCGACGCCCTTGAGGAAGAGGCCGAGGCGAAGCGTCTGCAGAAGAAGAAGCTGTCC
AAGATGCGCGAGGAAGACTTTGTCTTTGATGGCCAGGAATGGCTCACTGGCGAACCCGACGCCGAGCGAGACGAC
GAAACGACCACGGAGCTTCTCAAGGACGTTCAAGTTGCCGAAGACGCGACGTCGGAAGAACGACTGAAGCTTCTC
GCGTCGGGATACCCCGAATTCTCGTATCTCGTCGACGAGTTTCAGAAATTGCAGCCAGTATTGAAGACGCTCGAG
GCCGAAGCTCAGAACAAACCGGGCCAGTCACTCGAGTCCATCAAGTACTGGATACTCGGGTGCTACATCGCGGCA
CTGGCCAGTTACTTTGCCATCTTCACCTCCCCGGCGCGTGACGGCCCCGACGCACAGAAACCACTGCCCCCATCA
GAACTGCGCGATCACGATGTCATGGAAACTCTCGTCTCTTGCCGCAAGGCCTGGGAAAGAGTCAAGCTTGTCAAG
TGTCTCCGGCGCTCGAACGATGCGGTAGTGTCCGAGACGGAAATTGTCGCGACGGCAGTCGATGGCATTGAAGAC
GCAAAAGCGAGCAAGACGGAGGCAAACAAAGATGAAGTCACCGTAGCTAAGCAAGCGAAGAAACGCGCCAAGGTC
AAGGCCATTGAGGACGACGTCGCCGACCTCTACGACCTGCCTCTCGGTCTCGGCAAGTCGGACAAGTCCAGGAAA
CCGACGAGGCCGAAAGCCGACGATGATTCCGACTTTGGCGAAGAAGACGGCCTGGACGACAAGGCAGCAGCGGAC
AAGGCTAAGCGACGAAAGAGTCTCCGGTTCTACACATCGCAGATTGTGCAAAAGGCCAATCGTCGACTTGAGGCG
GGTCGCGAAGCCGGCGGAGATGCCGACATTCCGCACAGGGAGCGATTGCGAGACCGCCAGGCTCGCCTTTTGGCC
GAGGCAGAGAAGCGAAGCAAAAAGACCAATAAGCGTGGGGGCGACGAGGATGACGATGACGACAAGGAGGACAAG
CTGGCCAGCGCCATACGGGCGGACGAGGACGACTACTACAACGAGGTAGCACAGGCGTCCAAGACGAAGCGAGAG
GAGAAGGCGGCCCGGTACGCGGCCTACGCAGCGGCGAACAAGGCCGACAGGGTGGTAGAAAAGGAGGAGGTTGGG
GTGGACGGCAAGAGGAAGGTGACGTACGCGATTCAGAAGAACAAGGGCCTGGCTCCGAAGAGAAGCAAGGATGTC
CGGAACCCGAGGGTCAGGAGGAGGAAGCAGTTTGATGCCAAGCAGAAGAAGCTGAGGAGCATGCGGTCGGAGTGG
AAAGGCGGCGAGCCGGTGGGCGGCTACCAGGGCGAGCGGACGGGCATCAATGCGGCGGTGATCAAGAGTATAAAG
CTGTAG
Gene >Ophun1|5751
ATGGGCAAGAAGAGAAAGGCACACGGACGCGCTCCGGAACCCCAGGGGCCACGGGAGATTGACCCGGCCGATGCC
CGTCTGGGACCCATTTCGACGTTCGAAGATGTCGCCGACTCTGAAGACGAATACTTCTTGGCCCGAGACCAGATT
CTGCTTGACGACGAGCCGGTGTCTAAGCGGCGGAGAAAGGTTGATGAGGTCATGGAACTATCCGACGAGGAGATA
TTTCCGTATCAGGACAATCAGTCGGGATTGAATGACGATGCTCGCAAGAAAAAACGCAAAGGGGCCGACGATGGC
GACGACGAGGACGACGAGGACGAGGACGACGACGCCGGCTGGTGGGGTTCTTCTAAGCAGGCCTACTACGATGCG
GACAAGATTGAGACCGAGGCCGACGCCCTTGAGGAAGAGGCCGAGGCGAAGCGTCTGCAGAAGAAGAAGCTGTCC
AAGATGCGCGAGGAAGACTTTGTCTTTGATGGCCAGGAATGGCTCACTGGCGAACCCGACGCCGAGCGAGACGAC
GAAACGACCACGGAGCTTCTCAAGGACGTTCAAGTTGCCGAAGACGCGACGTCGGAAGAACGACTGAAGCTTCTC
GCGTCGGGATACCCCGAATTCTCGTATCTCGTCGACGAGTTTCAGAAATTGCAGCCAGTATTGAAGACGCTCGAG
GCCGAAGCTCAGAACAAACCGGGCCAGTCACTCGAGTCCATCAAGTACTGGATACTCGGGTGCTACATCGCGGCA
CTGGCCAGTTACTTTGCCATCTTCACCTCCCCGGCGCGTGACGGCCCCGACGCACAGAAACCACTGCCCCCATCA
GAACTGCGCGATCACGATGTCATGGAAACTCTCGTCTCTTGCCGCAAGGCCTGGGAAAGAGTCAAGCTTGTCAAG
TGTCTCCGGCGCTCGAACGATGCGGTAGTGTCCGAGACGGAAATTGTCGCGACGGCAGTCGATGGCATTGAAGAC
GCAAAAGCGAGCAAGACGGAGGCAAACAAAGATGAAGTCACCGTAGCTAAGCAAGCGAAGAAACGCGCCAAGGTC
AAGGCCATTGAGGACGACGTCGCCGACCTCTACGACCTGCCTCTCGGTCTCGGCAAGTCGGACAAGTCCAGGAAA
CCGACGAGGCCGAAAGCCGACGATGATTCCGACTTTGGCGAAGAAGACGGCCTGGACGACAAGGCAGCAGCGGAC
AAGGCTAAGCGACGAAAGAGTCTCCGGTTCTACACATCGCAGATTGTGCAAAAGGCCAATCGTCGACTTGAGGCG
GGTCGCGAAGCCGGCGGAGATGCCGACATTCCGCACAGGGAGCGATTGCGAGACCGCCAGGCTCGCCTTTTGGCC
GAGGCAGAGAAGCGAAGCAAAAAGACCAATAAGCGTGGGGGCGACGAGGATGACGATGACGACAAGGAGGACAAG
CTGGCCAGCGCCATACGGGCGGACGAGGACGACTACTACAACGAGGTAGCACAGGCGTCCAAGACGAAGCGAGAG
GAGAAGGCGGCCCGGTACGCGGCCTACGCAGCGGCGAACAAGGCCGACAGGGTGGTAGAAAAGGAGGAGGTTGGG
GTGGACGGCAAGAGGAAGGTGACGTACGCGATTCAGAAGAACAAGGGCCTGGCTCCGAAGAGAAGCAAGGATGTC
CGGAACCCGAGGGTCAGGAGGAGGAAGCAGTTTGATGCCAAGCAGAAGAAGCTGAGGAGCATGCGGTCGGAGTGG
AAAGGCGGCGAGCCGGTGGGCGGCTACCAGGGCGAGCGGACGGGCATCAATGCGGCGGTGATCAAGAGTATAAAG
CTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail