Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5748
Gene name
LocationContig_59:23904..25878
Strand-
Gene length (bp)1974
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 7.7E-52 138 397
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.5E-27 137 385
PF00498 FHA FHA domain 2.7E-11 40 99

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 43 404 1.0E-44
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 42 409 3.0E-35
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 135 439 9.0E-34
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 133 397 1.0E-33
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 133 397 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 43 404 1.0E-44
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 42 409 3.0E-35
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 135 439 9.0E-34
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 133 397 1.0E-33
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 133 397 2.0E-33
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 133 397 4.0E-33
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 41 340 4.0E-33
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 127 397 4.0E-32
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 115 400 4.0E-32
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 140 398 4.0E-32
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 127 397 5.0E-32
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 140 397 5.0E-32
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 132 397 9.0E-32
sp|P24719|MEK1_YEAST Meiosis-specific serine/threonine-protein kinase MEK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEK1 PE=3 SV=1 39 410 2.0E-31
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 132 411 3.0E-31
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 132 399 4.0E-31
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 133 398 2.0E-30
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 138 399 3.0E-30
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 138 398 3.0E-30
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 138 399 7.0E-30
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 132 334 1.0E-29
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 131 454 2.0E-29
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 125 400 2.0E-29
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 131 458 5.0E-29
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 94 347 5.0E-29
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 132 399 9.0E-29
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 42 333 3.0E-28
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 132 411 4.0E-28
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 132 411 4.0E-28
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 138 397 4.0E-28
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 132 399 4.0E-28
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 132 400 6.0E-28
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 140 440 8.0E-28
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 140 440 8.0E-28
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 132 399 9.0E-28
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 140 440 1.0E-27
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 132 411 1.0E-27
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 132 397 2.0E-27
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 43 398 3.0E-27
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 132 399 3.0E-27
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 126 334 4.0E-27
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 132 397 4.0E-27
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 132 397 4.0E-27
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 138 397 6.0E-27
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 117 397 7.0E-27
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 132 397 7.0E-27
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 132 397 8.0E-27
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 117 397 9.0E-27
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 132 397 1.0E-26
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 132 334 1.0E-26
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 68 398 2.0E-26
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 132 346 2.0E-26
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 124 399 2.0E-26
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 138 407 2.0E-26
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 138 399 3.0E-26
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 138 394 3.0E-26
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 61 334 4.0E-26
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 138 398 4.0E-26
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 138 414 4.0E-26
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 138 334 4.0E-26
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 116 415 4.0E-26
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 130 398 5.0E-26
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 132 397 5.0E-26
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 132 334 5.0E-26
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 132 399 6.0E-26
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 140 397 7.0E-26
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 138 404 8.0E-26
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 138 398 8.0E-26
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 138 441 1.0E-25
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 138 441 1.0E-25
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 138 397 1.0E-25
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 138 399 2.0E-25
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 132 407 2.0E-25
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 138 398 2.0E-25
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 43 398 2.0E-25
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 132 415 4.0E-25
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 138 441 4.0E-25
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 138 396 5.0E-25
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 28 334 6.0E-25
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 132 334 6.0E-25
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 121 399 6.0E-25
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 132 334 6.0E-25
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 137 427 6.0E-25
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 126 333 7.0E-25
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 138 397 8.0E-25
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 140 397 8.0E-25
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 138 397 8.0E-25
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 123 334 9.0E-25
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 138 397 9.0E-25
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 138 397 1.0E-24
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 102 424 1.0E-24
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 137 397 1.0E-24
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 137 397 1.0E-24
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 138 397 1.0E-24
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 140 397 1.0E-24
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 133 399 1.0E-24
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 131 333 1.0E-24
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 123 334 1.0E-24
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 68 409 2.0E-24
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 123 398 2.0E-24
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 133 398 2.0E-24
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 123 398 2.0E-24
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 122 334 2.0E-24
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 126 402 2.0E-24
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 140 400 3.0E-24
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 131 397 3.0E-24
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 113 397 3.0E-24
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 129 398 3.0E-24
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 138 397 3.0E-24
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 131 333 3.0E-24
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 138 397 3.0E-24
sp|O94547|SRK1_SCHPO Serine/threonine-protein kinase srk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srk1 PE=1 SV=1 131 333 3.0E-24
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 138 397 3.0E-24
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 130 398 4.0E-24
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 119 333 4.0E-24
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 131 333 4.0E-24
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 132 399 4.0E-24
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 128 399 5.0E-24
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 123 399 5.0E-24
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 138 398 6.0E-24
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 129 334 7.0E-24
sp|Q86HN7|PLK_DICDI Probable serine/threonine-protein kinase PLK OS=Dictyostelium discoideum GN=PLK PE=3 SV=1 140 333 7.0E-24
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 132 397 7.0E-24
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 129 333 7.0E-24
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 131 333 7.0E-24
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 140 333 8.0E-24
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 131 333 8.0E-24
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 140 333 9.0E-24
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 133 444 9.0E-24
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 140 333 9.0E-24
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 138 398 9.0E-24
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 140 397 9.0E-24
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 101 399 1.0E-23
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 130 333 1.0E-23
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 130 333 1.0E-23
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 123 350 1.0E-23
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 140 398 1.0E-23
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 140 398 1.0E-23
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 131 333 1.0E-23
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 140 398 1.0E-23
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 130 333 1.0E-23
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 140 333 1.0E-23
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 140 333 1.0E-23
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 140 333 1.0E-23
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 138 334 1.0E-23
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 130 333 1.0E-23
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 129 397 1.0E-23
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 126 398 1.0E-23
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 132 397 1.0E-23
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 131 333 1.0E-23
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 129 333 1.0E-23
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 133 333 1.0E-23
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 140 397 2.0E-23
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 109 333 2.0E-23
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 140 397 2.0E-23
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 109 333 2.0E-23
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 138 333 2.0E-23
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 137 398 2.0E-23
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 138 333 2.0E-23
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 140 397 2.0E-23
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 138 402 2.0E-23
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 140 399 2.0E-23
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 132 333 2.0E-23
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 129 333 2.0E-23
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 138 398 2.0E-23
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 130 397 2.0E-23
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 138 398 2.0E-23
sp|Q8CEE6|PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus GN=Pask PE=1 SV=3 140 333 2.0E-23
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 138 334 3.0E-23
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 138 333 3.0E-23
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 126 397 3.0E-23
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 132 334 3.0E-23
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 140 399 3.0E-23
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 126 397 3.0E-23
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 138 334 4.0E-23
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 138 346 4.0E-23
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 138 397 4.0E-23
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 138 346 4.0E-23
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 138 334 4.0E-23
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 132 334 4.0E-23
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 138 397 4.0E-23
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 140 399 4.0E-23
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 113 334 4.0E-23
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 131 333 4.0E-23
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 132 399 4.0E-23
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 140 399 4.0E-23
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 130 333 4.0E-23
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 132 399 5.0E-23
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 117 399 5.0E-23
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 116 398 5.0E-23
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 126 397 5.0E-23
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 126 397 5.0E-23
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 126 397 5.0E-23
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 140 399 6.0E-23
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 135 334 6.0E-23
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 131 418 6.0E-23
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 140 397 6.0E-23
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 126 397 7.0E-23
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 126 397 7.0E-23
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 119 405 7.0E-23
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 138 399 7.0E-23
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 138 398 8.0E-23
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 138 334 8.0E-23
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protein At5g21222 OS=Arabidopsis thaliana GN=ATC401 PE=2 SV=1 132 411 1.0E-22
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 138 346 1.0E-22
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 132 334 1.0E-22
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 130 397 1.0E-22
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 112 401 1.0E-22
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 140 397 1.0E-22
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 138 399 1.0E-22
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 138 398 1.0E-22
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 129 431 1.0E-22
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 138 333 2.0E-22
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 133 397 2.0E-22
sp|A4IFM7|MYLK2_BOVIN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Bos taurus GN=MYLK2 PE=2 SV=1 136 415 2.0E-22
sp|Q9HBH9|MKNK2_HUMAN MAP kinase-interacting serine/threonine-protein kinase 2 OS=Homo sapiens GN=MKNK2 PE=1 SV=3 129 334 2.0E-22
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 138 407 2.0E-22
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 140 427 2.0E-22
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 138 399 2.0E-22
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 108 405 2.0E-22
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 115 398 2.0E-22
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 126 401 2.0E-22
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 129 431 2.0E-22
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 137 405 2.0E-22
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 129 398 2.0E-22
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 138 400 2.0E-22
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 138 398 2.0E-22
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 124 334 2.0E-22
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 124 334 2.0E-22
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 138 399 2.0E-22
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 124 334 2.0E-22
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 124 334 2.0E-22
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 126 398 2.0E-22
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 133 397 2.0E-22
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 139 398 2.0E-22
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 138 398 2.0E-22
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 96 400 2.0E-22
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 138 346 3.0E-22
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 129 334 3.0E-22
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 128 334 3.0E-22
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 138 398 3.0E-22
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 132 402 3.0E-22
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 133 397 3.0E-22
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 138 399 3.0E-22
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 132 333 3.0E-22
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 129 334 3.0E-22
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 126 401 3.0E-22
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 140 333 3.0E-22
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 137 396 3.0E-22
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 137 396 3.0E-22
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 111 334 3.0E-22
sp|P07313|MYLK2_RABIT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Oryctolagus cuniculus GN=MYLK2 PE=1 SV=3 136 415 3.0E-22
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 129 333 4.0E-22
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 129 397 4.0E-22
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 137 396 4.0E-22
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 138 334 4.0E-22
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 137 398 4.0E-22
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 125 398 4.0E-22
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 133 397 4.0E-22
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 126 334 4.0E-22
sp|Q5SUV5|MYLK4_MOUSE Myosin light chain kinase family member 4 OS=Mus musculus GN=Mylk4 PE=1 SV=2 133 403 5.0E-22
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 138 397 5.0E-22
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 126 397 5.0E-22
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 111 334 6.0E-22
sp|A8C984|MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio GN=mylk3 PE=2 SV=1 138 408 6.0E-22
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 135 398 6.0E-22
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 137 402 6.0E-22
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 131 334 6.0E-22
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 132 399 6.0E-22
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 138 397 6.0E-22
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 126 334 6.0E-22
sp|O59697|PPK25_SCHPO Serine/threonine-protein kinase ppk25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk25 PE=1 SV=1 135 399 7.0E-22
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 129 334 7.0E-22
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 138 333 7.0E-22
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 138 334 7.0E-22
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 138 346 7.0E-22
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 121 352 7.0E-22
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 126 397 7.0E-22
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 138 334 7.0E-22
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 111 420 7.0E-22
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 138 334 8.0E-22
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 129 334 8.0E-22
sp|P20689|MYLK2_RAT Myosin light chain kinase 2, skeletal/cardiac muscle OS=Rattus norvegicus GN=Mylk2 PE=1 SV=2 136 415 8.0E-22
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 138 346 8.0E-22
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 138 334 8.0E-22
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 138 334 9.0E-22
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 137 337 9.0E-22
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 138 334 9.0E-22
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 184 358 9.0E-22
sp|Q8CDB0|MKNK2_MOUSE MAP kinase-interacting serine/threonine-protein kinase 2 OS=Mus musculus GN=Mknk2 PE=1 SV=3 129 334 9.0E-22
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 116 333 9.0E-22
sp|Q5U2N4|MKNK2_RAT MAP kinase-interacting serine/threonine-protein kinase 2 OS=Rattus norvegicus GN=Mknk2 PE=2 SV=1 129 334 9.0E-22
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 138 406 1.0E-21
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 132 333 1.0E-21
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 129 398 1.0E-21
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 129 334 1.0E-21
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 123 398 1.0E-21
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 121 352 1.0E-21
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 140 333 1.0E-21
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 124 397 1.0E-21
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 138 346 1.0E-21
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 129 333 1.0E-21
sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 128 417 1.0E-21
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 131 399 1.0E-21
sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 128 417 1.0E-21
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 106 346 1.0E-21
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 121 402 2.0E-21
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 138 333 2.0E-21
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 138 334 2.0E-21
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 131 407 2.0E-21
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 138 333 2.0E-21
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 133 398 2.0E-21
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 138 397 2.0E-21
sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 128 417 2.0E-21
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 140 334 2.0E-21
sp|Q8BHI9|NIM1_MOUSE Serine/threonine-protein kinase NIM1 OS=Mus musculus GN=Nim1k PE=2 SV=1 140 398 2.0E-21
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 126 334 2.0E-21
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 129 397 2.0E-21
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 109 405 2.0E-21
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 109 405 2.0E-21
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 133 428 2.0E-21
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 140 390 2.0E-21
sp|Q8IY84|NIM1_HUMAN Serine/threonine-protein kinase NIM1 OS=Homo sapiens GN=NIM1K PE=1 SV=1 140 398 2.0E-21
sp|Q8VCR8|MYLK2_MOUSE Myosin light chain kinase 2, skeletal/cardiac muscle OS=Mus musculus GN=Mylk2 PE=1 SV=2 136 415 2.0E-21
sp|Q15746|MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens GN=MYLK PE=1 SV=4 133 405 2.0E-21
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 108 346 2.0E-21
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 138 333 2.0E-21
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 140 333 2.0E-21
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 129 398 2.0E-21
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 137 397 2.0E-21
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 140 333 2.0E-21
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 133 398 2.0E-21
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 138 346 2.0E-21
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 140 333 2.0E-21
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 131 402 2.0E-21
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 138 349 2.0E-21
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 129 334 2.0E-21
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 140 333 2.0E-21
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 42 413 2.0E-21
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 140 333 2.0E-21
sp|Q9D411|TSSK4_MOUSE Testis-specific serine/threonine-protein kinase 4 OS=Mus musculus GN=Tssk4 PE=2 SV=1 138 379 2.0E-21
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 139 334 2.0E-21
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 128 399 3.0E-21
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 137 337 3.0E-21
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 138 397 3.0E-21
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 140 398 3.0E-21
sp|Q9H1R3|MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens GN=MYLK2 PE=1 SV=3 136 415 3.0E-21
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 139 398 3.0E-21
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 140 398 3.0E-21
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 112 397 3.0E-21
sp|Q5N942|SAPK4_ORYSJ Serine/threonine-protein kinase SAPK4 OS=Oryza sativa subsp. japonica GN=SAPK4 PE=2 SV=2 131 397 3.0E-21
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 124 399 3.0E-21
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 133 406 4.0E-21
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 133 406 4.0E-21
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 121 428 4.0E-21
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 129 397 4.0E-21
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 138 399 4.0E-21
sp|Q9FKW4|CDPKS_ARATH Calcium-dependent protein kinase 28 OS=Arabidopsis thaliana GN=CPK28 PE=1 SV=1 127 398 4.0E-21
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 111 334 4.0E-21
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 184 358 4.0E-21
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 138 333 4.0E-21
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 111 398 4.0E-21
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 120 333 4.0E-21
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 126 397 5.0E-21
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 129 334 5.0E-21
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 138 346 5.0E-21
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 130 410 6.0E-21
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 133 419 6.0E-21
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 140 333 6.0E-21
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 119 489 6.0E-21
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 132 398 6.0E-21
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 135 414 6.0E-21
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 138 401 6.0E-21
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 140 333 6.0E-21
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 140 333 6.0E-21
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 138 334 6.0E-21
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 133 398 7.0E-21
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 124 400 7.0E-21
sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 128 397 7.0E-21
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 129 334 7.0E-21
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 126 397 7.0E-21
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 138 398 7.0E-21
sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 128 397 7.0E-21
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 112 420 8.0E-21
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 140 398 8.0E-21
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 140 333 8.0E-21
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 129 397 8.0E-21
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 129 333 8.0E-21
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 138 395 9.0E-21
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 138 333 9.0E-21
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 140 399 9.0E-21
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 138 398 9.0E-21
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 138 398 9.0E-21
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 111 420 1.0E-20
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 131 402 1.0E-20
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 133 397 1.0E-20
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 126 397 1.0E-20
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 140 334 1.0E-20
sp|P0C5D6|SAPK3_ORYSJ Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. japonica GN=SAPK3 PE=1 SV=1 129 484 1.0E-20
sp|A2ZAB5|SAPK3_ORYSI Serine/threonine-protein kinase SAPK3 OS=Oryza sativa subsp. indica GN=SAPK3 PE=1 SV=2 129 484 1.0E-20
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 138 399 1.0E-20
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 138 398 1.0E-20
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 139 394 1.0E-20
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 140 397 1.0E-20
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 137 410 1.0E-20
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 137 410 1.0E-20
sp|Q28824|MYLK_BOVIN Myosin light chain kinase, smooth muscle OS=Bos taurus GN=MYLK PE=1 SV=1 133 405 1.0E-20
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 137 410 1.0E-20
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 132 346 1.0E-20
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 137 410 1.0E-20
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 137 399 1.0E-20
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 139 417 1.0E-20
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 133 432 2.0E-20
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 138 328 2.0E-20
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 129 397 2.0E-20
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 129 334 2.0E-20
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 137 399 2.0E-20
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 121 401 2.0E-20
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 133 401 2.0E-20
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 121 401 2.0E-20
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 140 398 2.0E-20
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 129 334 2.0E-20
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 140 401 2.0E-20
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 137 399 2.0E-20
sp|Q86YV6|MYLK4_HUMAN Myosin light chain kinase family member 4 OS=Homo sapiens GN=MYLK4 PE=1 SV=2 133 403 2.0E-20
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 140 334 2.0E-20
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 133 397 3.0E-20
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 116 333 3.0E-20
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 139 417 3.0E-20
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 121 401 3.0E-20
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 137 337 3.0E-20
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 131 334 3.0E-20
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 140 399 3.0E-20
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 129 398 3.0E-20
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 139 417 3.0E-20
sp|Q6PDN3|MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus GN=Mylk PE=1 SV=3 133 405 3.0E-20
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 140 332 3.0E-20
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 110 334 4.0E-20
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 129 334 4.0E-20
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 137 337 4.0E-20
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 41 397 4.0E-20
sp|Q61241|TSSK1_MOUSE Testis-specific serine/threonine-protein kinase 1 OS=Mus musculus GN=Tssk1b PE=1 SV=2 140 404 4.0E-20
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 138 397 4.0E-20
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 140 399 4.0E-20
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 138 397 4.0E-20
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 111 397 4.0E-20
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 138 398 4.0E-20
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 138 469 5.0E-20
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 129 398 5.0E-20
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 138 401 5.0E-20
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 138 332 5.0E-20
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 111 397 5.0E-20
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 140 333 5.0E-20
sp|O14019|HAL4_SCHPO Serine/threonine-protein kinase hal4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hal4 PE=1 SV=1 129 398 5.0E-20
sp|A2YNT8|SAPK2_ORYSI Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. indica GN=SAPK2 PE=2 SV=2 131 399 5.0E-20
sp|Q0D4J7|SAPK2_ORYSJ Serine/threonine-protein kinase SAPK2 OS=Oryza sativa subsp. japonica GN=SAPK2 PE=1 SV=1 131 399 6.0E-20
sp|O54863|TSSK2_MOUSE Testis-specific serine/threonine-protein kinase 2 OS=Mus musculus GN=Tssk2 PE=1 SV=2 140 438 6.0E-20
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 140 397 6.0E-20
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 131 334 6.0E-20
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 140 398 6.0E-20
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 129 398 6.0E-20
sp|O42844|KCC2_SCHPO Calcium/calmodulin-dependent protein kinase type II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk2 PE=1 SV=1 131 398 7.0E-20
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 138 334 7.0E-20
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 133 398 7.0E-20
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 138 398 7.0E-20
sp|P11799|MYLK_CHICK Myosin light chain kinase, smooth muscle OS=Gallus gallus GN=Mylk PE=1 SV=2 133 405 8.0E-20
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 137 337 8.0E-20
sp|P29294|MYLK_RABIT Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus GN=MYLK PE=1 SV=2 133 405 8.0E-20
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 133 405 9.0E-20
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 138 397 9.0E-20
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 140 428 9.0E-20
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 138 398 1.0E-19
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 140 333 1.0E-19
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 138 397 1.0E-19
sp|Q9YGW0|MKNK1_XENLA MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus laevis GN=mknk1 PE=2 SV=2 129 334 1.0E-19
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 140 394 1.0E-19
sp|Q75LR7|SAPK1_ORYSJ Serine/threonine-protein kinase SAPK1 OS=Oryza sativa subsp. japonica GN=SAPK1 PE=1 SV=1 131 399 1.0E-19
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 140 412 1.0E-19
sp|Q9XUJ7|DKF1_CAEEL Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis elegans GN=dkf-1 PE=1 SV=1 135 398 1.0E-19
sp|Q96PF2|TSSK2_HUMAN Testis-specific serine/threonine-protein kinase 2 OS=Homo sapiens GN=TSSK2 PE=1 SV=2 140 401 1.0E-19
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 126 333 1.0E-19
sp|Q9FFP9|SRK2H_ARATH Serine/threonine-protein kinase SRK2H OS=Arabidopsis thaliana GN=SRK2H PE=1 SV=1 131 396 1.0E-19
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 140 333 1.0E-19
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 111 333 1.0E-19
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 140 394 1.0E-19
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 133 402 2.0E-19
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 140 336 2.0E-19
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 138 334 2.0E-19
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 140 390 2.0E-19
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 119 334 2.0E-19
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 138 334 2.0E-19
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 140 328 2.0E-19
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 138 334 2.0E-19
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 111 333 2.0E-19
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 140 398 2.0E-19
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 140 402 2.0E-19
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 138 334 2.0E-19
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 125 398 2.0E-19
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 119 334 2.0E-19
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 111 333 2.0E-19
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 138 397 2.0E-19
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 140 399 2.0E-19
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 177 397 2.0E-19
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 129 428 3.0E-19
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 139 334 3.0E-19
sp|Q96RG2|PASK_HUMAN PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens GN=PASK PE=1 SV=3 110 333 3.0E-19
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 138 397 3.0E-19
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 140 332 3.0E-19
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 131 399 3.0E-19
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 140 415 3.0E-19
sp|A8XWC4|DKF1_CAEBR Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis briggsae GN=dkf-1 PE=3 SV=2 102 334 3.0E-19
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 131 399 3.0E-19
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 133 333 5.0E-18
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 109 421 1.0E-17
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 119 398 3.0E-13
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 124 398 7.0E-11
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 179 398 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0005515 protein binding Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0043412 macromolecule modification No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5748
MTRFSTLAVIRTQGMFSFYHSATLDAHILHSPRIGDGFNTLVSRRHCEVYVVVYDEFVSNVYVRDRNTRNGTFVN
KVRIGSGTGISPSHLLQDGDVIEIYPNWTMTFHDEQNLKASPRTGIQEMECKLFEEKYSISQRCLGSGAEGTVYL
ATEVETRKQLVCKIVDLSKLKGKNAPEDIRRRLQEADVLRQLQHPNVLCYVDAAVSPYSLYTFTELATGGDLWSF
LYQRPCVGEFDTRVIVRQLAQALDYIHRKGVIHRDLKPENILLAYSPNVACPRILLSDFGACAVPRRSRMLTHAG
TVNYQAPEILDDSGPHTASVDMWSLGIVTLTLLTHGMDVSLKGLDRMTQEEIRVFVEETTLCLERYSEFCRHFVM
LCLRTAPIFRMTSTQARNHRWLRRPERHLQYFEKLERISRSNWKACDVLRPMPLQLPDVKKGHTRLDGLDNASQK
DPSPEAEAADEGSQYFESVRSERDVASADTATVAGDKSSWDLSRPKTQTNKPQRLSPKQTTQPASVSDQKAVQQK
LYPLIRRHTPAGEETDKRELIIEELKRANVKFLPDIPASSTTHGARTGKGEYSSPSRQKRQRQQ*
Coding >Ophun1|5748
ATGACGAGGTTCTCAACATTGGCCGTCATCCGCACTCAAGGCATGTTCTCCTTCTATCACTCAGCTACTCTGGAT
GCTCATATCTTGCATAGCCCGCGCATCGGGGATGGCTTCAATACCCTTGTCTCTCGCCGGCACTGCGAGGTCTAC
GTCGTGGTATATGACGAGTTCGTCAGCAACGTGTACGTTCGAGACCGCAACACACGAAACGGAACCTTTGTCAAC
AAAGTCCGGATCGGCTCTGGAACGGGCATCTCGCCCAGTCATCTGCTGCAGGACGGCGACGTCATTGAGATCTAC
CCCAACTGGACCATGACCTTCCATGATGAGCAAAACCTCAAGGCCAGCCCCAGAACAGGCATCCAGGAGATGGAG
TGCAAGCTGTTTGAGGAAAAGTACAGCATCAGCCAGCGCTGTCTCGGCTCAGGTGCAGAAGGCACGGTGTATCTT
GCCACCGAAGTCGAGACGAGGAAGCAGTTGGTTTGCAAGATTGTCGATCTGAGCAAGCTCAAAGGCAAGAATGCT
CCCGAGGACATCCGGCGAAGGTTGCAGGAAGCTGATGTTCTTCGTCAGCTCCAACATCCCAACGTCTTGTGCTAT
GTCGACGCAGCAGTTTCGCCTTACTCACTATACACATTCACCGAGCTGGCTACAGGAGGTGACTTGTGGTCCTTT
CTCTACCAACGCCCCTGCGTAGGAGAATTCGACACTCGCGTCATTGTTCGCCAGCTGGCTCAAGCCCTCGACTAC
ATCCACAGAAAAGGCGTCATTCATCGCGACCTGAAGCCCGAAAACATTCTCCTGGCGTACTCGCCCAATGTCGCT
TGTCCCCGCATTCTGCTGTCTGATTTCGGGGCTTGTGCGGTTCCTCGTCGAAGCAGGATGCTCACACACGCCGGA
ACTGTCAATTATCAAGCTCCGGAGATTCTGGACGATTCCGGGCCACATACAGCTTCTGTCGATATGTGGTCTCTC
GGCATCGTGACCCTCACTCTCCTTACTCACGGCATGGATGTTAGTCTGAAGGGTCTGGACCGGATGACGCAAGAA
GAGATCCGGGTATTTGTCGAGGAAACTACCCTGTGTCTAGAGCGCTACTCGGAGTTCTGCCGACATTTCGTCATG
CTCTGTCTCCGGACCGCCCCAATCTTCCGGATGACTTCGACACAGGCTCGCAACCACAGGTGGCTGCGCCGGCCA
GAAAGGCATCTCCAATACTTTGAGAAGCTGGAACGCATATCCAGGAGTAACTGGAAGGCCTGTGACGTTCTGCGC
CCGATGCCGCTTCAGCTGCCCGACGTGAAGAAGGGGCATACTCGTCTCGACGGCCTGGATAATGCCTCGCAAAAG
GACCCGAGCCCCGAAGCAGAGGCGGCGGACGAGGGGTCGCAGTATTTCGAGTCAGTGCGGTCTGAGAGGGATGTT
GCTTCTGCGGACACTGCCACCGTCGCCGGAGACAAGTCCTCGTGGGATCTCAGTCGCCCCAAGACACAGACGAAT
AAACCGCAGCGTCTATCGCCGAAGCAGACGACACAGCCTGCTTCAGTCTCCGATCAGAAGGCGGTCCAGCAGAAG
TTGTACCCTTTGATCAGGCGTCATACCCCAGCAGGCGAAGAGACGGACAAGAGGGAGCTGATCATAGAGGAGCTG
AAACGAGCCAACGTCAAATTCCTGCCTGACATCCCCGCCTCGTCGACGACACACGGAGCGAGGACGGGCAAGGGA
GAATACAGTTCGCCCAGCCGGCAGAAGCGGCAGCGGCAGCAGTAG
Transcript >Ophun1|5748
ATGACGAGGTTCTCAACATTGGCCGTCATCCGCACTCAAGGCATGTTCTCCTTCTATCACTCAGCTACTCTGGAT
GCTCATATCTTGCATAGCCCGCGCATCGGGGATGGCTTCAATACCCTTGTCTCTCGCCGGCACTGCGAGGTCTAC
GTCGTGGTATATGACGAGTTCGTCAGCAACGTGTACGTTCGAGACCGCAACACACGAAACGGAACCTTTGTCAAC
AAAGTCCGGATCGGCTCTGGAACGGGCATCTCGCCCAGTCATCTGCTGCAGGACGGCGACGTCATTGAGATCTAC
CCCAACTGGACCATGACCTTCCATGATGAGCAAAACCTCAAGGCCAGCCCCAGAACAGGCATCCAGGAGATGGAG
TGCAAGCTGTTTGAGGAAAAGTACAGCATCAGCCAGCGCTGTCTCGGCTCAGGTGCAGAAGGCACGGTGTATCTT
GCCACCGAAGTCGAGACGAGGAAGCAGTTGGTTTGCAAGATTGTCGATCTGAGCAAGCTCAAAGGCAAGAATGCT
CCCGAGGACATCCGGCGAAGGTTGCAGGAAGCTGATGTTCTTCGTCAGCTCCAACATCCCAACGTCTTGTGCTAT
GTCGACGCAGCAGTTTCGCCTTACTCACTATACACATTCACCGAGCTGGCTACAGGAGGTGACTTGTGGTCCTTT
CTCTACCAACGCCCCTGCGTAGGAGAATTCGACACTCGCGTCATTGTTCGCCAGCTGGCTCAAGCCCTCGACTAC
ATCCACAGAAAAGGCGTCATTCATCGCGACCTGAAGCCCGAAAACATTCTCCTGGCGTACTCGCCCAATGTCGCT
TGTCCCCGCATTCTGCTGTCTGATTTCGGGGCTTGTGCGGTTCCTCGTCGAAGCAGGATGCTCACACACGCCGGA
ACTGTCAATTATCAAGCTCCGGAGATTCTGGACGATTCCGGGCCACATACAGCTTCTGTCGATATGTGGTCTCTC
GGCATCGTGACCCTCACTCTCCTTACTCACGGCATGGATGTTAGTCTGAAGGGTCTGGACCGGATGACGCAAGAA
GAGATCCGGGTATTTGTCGAGGAAACTACCCTGTGTCTAGAGCGCTACTCGGAGTTCTGCCGACATTTCGTCATG
CTCTGTCTCCGGACCGCCCCAATCTTCCGGATGACTTCGACACAGGCTCGCAACCACAGGTGGCTGCGCCGGCCA
GAAAGGCATCTCCAATACTTTGAGAAGCTGGAACGCATATCCAGGAGTAACTGGAAGGCCTGTGACGTTCTGCGC
CCGATGCCGCTTCAGCTGCCCGACGTGAAGAAGGGGCATACTCGTCTCGACGGCCTGGATAATGCCTCGCAAAAG
GACCCGAGCCCCGAAGCAGAGGCGGCGGACGAGGGGTCGCAGTATTTCGAGTCAGTGCGGTCTGAGAGGGATGTT
GCTTCTGCGGACACTGCCACCGTCGCCGGAGACAAGTCCTCGTGGGATCTCAGTCGCCCCAAGACACAGACGAAT
AAACCGCAGCGTCTATCGCCGAAGCAGACGACACAGCCTGCTTCAGTCTCCGATCAGAAGGCGGTCCAGCAGAAG
TTGTACCCTTTGATCAGGCGTCATACCCCAGCAGGCGAAGAGACGGACAAGAGGGAGCTGATCATAGAGGAGCTG
AAACGAGCCAACGTCAAATTCCTGCCTGACATCCCCGCCTCGTCGACGACACACGGAGCGAGGACGGGCAAGGGA
GAATACAGTTCGCCCAGCCGGCAGAAGCGGCAGCGGCAGCAGTAG
Gene >Ophun1|5748
ATGACGAGGTTCTCAACATTGGCCGTCATCCGCACTCAAGGCATGTTCTCCTTCTATCACTCAGCTACTCTGGAT
GCTCATATCTTGCATAGCCCGCGCATCGGGGATGGCTTCAATACCCTTGTCTCTCGCCGGCACTGCGAGGTCTAC
GTCGTGGTATATGACGAGTTCGTCAGCAACGTGTACGTTCGAGACCGCAACACACGAAACGGAACCTTTGTCAAC
AAAGTCCGGATCGGCTCTGGAACGGGCATCTCGCCCAGTCATCTGCTGCAGGACGGCGACGTCATTGAGATCTAC
CCCAACTGGACCATGACCTTCCATGATGAGCAAAACCTCAAGGCCAGCCCCAGAACAGGCATCCAGGAGATGGAG
TGCAAGGTCTTCGCTTTTCGGGGTGTTTACCATAAAGAGTCTGCAATCTGACAAGCTTCAGCTGTTTGAGGAAAA
GTACAGCATCAGCCAGCGCTGTCTCGGCTCAGGTGCAGAAGGCACGGTGTATCTTGCCACCGAAGTCGAGACGAG
GAAGCAGTTGGTTTGCAAGATTGTCGATCTGAGCAAGCTCAAAGGCAAGAATGCTCCCGAGGACATCCGGCGAAG
GTTGCAGGAAGCTGATGTTCTTCGTCAGCTCCAACATGTAAGTGCCATGCCCTTTGCCTACCGACTCAGACGCCG
CTTACACGCTTGCAGCCCAACGTCTTGTGCTATGTCGACGCAGCAGTTTCGCCTTACTCACTGTAAGACGATGCC
ACGGCTGGTATCTGATGATTGCTGATGAATCCAGATACACATTCACCGAGCTGGCTACAGGAGGTGACTTGTGGT
CCTTTCTCTACCAACGCCCCTGCGTAGGAGAATTCGACACTCGCGTCATTGTTCGCCAGCTGGCTCAAGCCCTCG
ACTACATCCACAGAAAAGGCGTCATTCATCGCGACCTGAAGCCCGAAAACATTCTCCTGGCGTACTCGCCCAATG
TCGCTTGTCCCCGCATTCTGCTGTCTGATTTCGGGGCTTGTGCGGTTCCTCGTCGAAGCAGGATGCTCACACACG
CCGGAACTGTCAATTATCAAGCTCCGTGAGTCTTCAAAGCGGAAACATGGGGAATCGCAACTGACGCGCCGCAGG
GAGATTCTGGACGATTCCGGGCCACATACAGCTTCTGTCGATATGTGGTCTCTCGGCATCGTGACCCTCACTCTC
CTTACTCACGGCATGGATGTTAGTCTGAAGGGTCTGGACCGGATGACGCAAGAAGAGATCCGGGTATTTGTCGAG
GAAACTACCCTGTGTCTAGAGCGCTACTCGGAGTTCTGCCGACATTTCGTCATGCTCTGTCTCCGGACCGCCCCA
ATCTTCCGGATGACTTCGACACAGGCTCGCAACCACAGGTGGCTGCGCCGGCCAGAAAGGCATCTCCAATACTTT
GAGAAGCTGGAACGCATATCCAGGAGTAACTGGAAGGCCTGTGACGTTCTGCGCCCGATGCCGCTTCAGCTGCCC
GACGTGAAGAAGGGGCATACTCGTCTCGACGGCCTGGATAATGCCTCGCAAAAGGACCCGAGCCCCGAAGCAGAG
GCGGCGGACGAGGGGTCGCAGTATTTCGAGTCAGTGCGGTCTGAGAGGGATGTTGCTTCTGCGGACACTGCCACC
GTCGCCGGAGACAAGTCCTCGTGGGATCTCAGTCGCCCCAAGACACAGACGAATAAACCGCAGCGTCTATCGCCG
AAGCAGACGACACAGCCTGCTTCAGTCTCCGATCAGAAGGCGGTCCAGCAGAAGTTGTACCCTTTGATCAGGCGT
CATACCCCAGCAGGCGAAGAGACGGACAAGAGGGAGCTGATCATAGAGGAGCTGAAACGAGCCAACGTCAAATTC
CTGCCTGACATCCCCGCCTCGTCGACGACACACGGAGCGAGGACGGGCAAGGGAGAATACAGTTCGCCCAGCCGG
CAGAAGCGGCAGCGGCAGCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail