Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5747
Gene name
LocationContig_59:22436..23345
Strand+
Gene length (bp)909
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06414 Zeta_toxin Zeta toxin 1.3E-38 33 215
PF13671 AAA_33 AAA domain 1.0E-06 38 163

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q97QZ1|PEZT_STRPN Toxin PezT OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pezT PE=1 SV=1 35 185 4.0E-10
sp|Q93CM1|ZTOX_ENTHR Toxin zeta OS=Enterococcus hirae PE=3 SV=1 24 234 2.0E-09
sp|Q54944|ZTOX_STRPY Toxin zeta OS=Streptococcus pyogenes PE=1 SV=3 34 185 3.0E-09
sp|P0A4M2|ZTOX_STRAG Toxin zeta OS=Streptococcus agalactiae PE=3 SV=1 34 185 1.0E-08
sp|P0A4M1|ZTOX_ENTFL Toxin zeta OS=Enterococcus faecalis PE=3 SV=1 34 185 1.0E-08

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016301 kinase activity Yes
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0097159 organic cyclic compound binding No
GO:0016740 transferase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup8354
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|5747 (this protein)
Ophiocordyceps kimflemingae Ophio5|774

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5747
MPPNHRLPPQASTNIFTTLILPSELPPPQTPLPTPTAILLTGQTGSGKSTLSPPLLSALSRGCGSATHLIADTFK
TYHPEYARLAAESSARASAATGPDARRWLAMAVGEVVRRRAHLVVESACRHFEDWEEMVRVLRGGGYRLVVVLLA
VPAGLSRLGIAVRFYLPGPDSSVLDARLTPAAVHDESYGGVAQAAAFLDANPGLADRILLVRRGGLVASVGEGGL
LAALTGEREGLLTGEEKSRARRDLERLAGCEGAEVLCETLKELLRPFLDGGERGGAGLMPLVVVDDEAGDGDNVL
RL*
Coding >Ophun1|5747
ATGCCACCCAACCACCGCCTCCCCCCCCAAGCCTCCACCAACATCTTCACAACCCTCATCCTCCCTTCCGAGCTG
CCCCCCCCCCAAACACCACTCCCCACCCCAACCGCCATCCTCCTAACCGGCCAAACCGGGTCCGGAAAAAGCACG
CTCTCGCCCCCGCTCCTCTCGGCTCTAAGCCGGGGATGCGGCTCGGCAACGCACCTCATCGCCGATACCTTCAAG
ACCTATCACCCCGAGTACGCGCGTCTGGCTGCTGAGTCTTCGGCCCGGGCTTCGGCGGCTACGGGTCCGGATGCG
AGGAGGTGGCTTGCCATGGCGGTCGGGGAGGTTGTGAGGCGGAGGGCGCATCTTGTCGTTGAGAGTGCCTGTCGT
CATTTCGAGGATTGGGAGGAGATGGTGCGGGTGTTGAGGGGGGGAGGGTATAGGCTTGTGGTTGTTTTGTTGGCT
GTTCCTGCTGGGCTGAGCAGGTTGGGCATTGCTGTTCGCTTCTATCTACCTGGGCCTGACAGCTCGGTGCTGGAC
GCGAGACTTACGCCTGCGGCTGTGCATGATGAGTCGTATGGGGGGGTGGCACAGGCTGCCGCCTTTCTCGACGCG
AATCCTGGCCTCGCGGATCGGATCCTGCTTGTGAGAAGGGGGGGGTTGGTTGCTTCTGTGGGGGAGGGGGGGCTG
CTGGCTGCGTTGACGGGCGAGAGGGAAGGGTTATTAACGGGGGAAGAGAAGAGTAGGGCAAGGAGAGATCTGGAG
AGGTTGGCTGGGTGTGAGGGTGCGGAGGTGTTGTGTGAGACGTTGAAGGAGTTGCTGCGGCCGTTTTTGGATGGC
GGTGAGCGGGGGGGTGCTGGGTTGATGCCTCTTGTTGTTGTTGACGACGAAGCTGGTGATGGAGACAATGTGCTT
CGGCTGTAG
Transcript >Ophun1|5747
ATGCCACCCAACCACCGCCTCCCCCCCCAAGCCTCCACCAACATCTTCACAACCCTCATCCTCCCTTCCGAGCTG
CCCCCCCCCCAAACACCACTCCCCACCCCAACCGCCATCCTCCTAACCGGCCAAACCGGGTCCGGAAAAAGCACG
CTCTCGCCCCCGCTCCTCTCGGCTCTAAGCCGGGGATGCGGCTCGGCAACGCACCTCATCGCCGATACCTTCAAG
ACCTATCACCCCGAGTACGCGCGTCTGGCTGCTGAGTCTTCGGCCCGGGCTTCGGCGGCTACGGGTCCGGATGCG
AGGAGGTGGCTTGCCATGGCGGTCGGGGAGGTTGTGAGGCGGAGGGCGCATCTTGTCGTTGAGAGTGCCTGTCGT
CATTTCGAGGATTGGGAGGAGATGGTGCGGGTGTTGAGGGGGGGAGGGTATAGGCTTGTGGTTGTTTTGTTGGCT
GTTCCTGCTGGGCTGAGCAGGTTGGGCATTGCTGTTCGCTTCTATCTACCTGGGCCTGACAGCTCGGTGCTGGAC
GCGAGACTTACGCCTGCGGCTGTGCATGATGAGTCGTATGGGGGGGTGGCACAGGCTGCCGCCTTTCTCGACGCG
AATCCTGGCCTCGCGGATCGGATCCTGCTTGTGAGAAGGGGGGGGTTGGTTGCTTCTGTGGGGGAGGGGGGGCTG
CTGGCTGCGTTGACGGGCGAGAGGGAAGGGTTATTAACGGGGGAAGAGAAGAGTAGGGCAAGGAGAGATCTGGAG
AGGTTGGCTGGGTGTGAGGGTGCGGAGGTGTTGTGTGAGACGTTGAAGGAGTTGCTGCGGCCGTTTTTGGATGGC
GGTGAGCGGGGGGGTGCTGGGTTGATGCCTCTTGTTGTTGTTGACGACGAAGCTGGTGATGGAGACAATGTGCTT
CGGCTGTAG
Gene >Ophun1|5747
ATGCCACCCAACCACCGCCTCCCCCCCCAAGCCTCCACCAACATCTTCACAACCCTCATCCTCCCTTCCGAGCTG
CCCCCCCCCCAAACACCACTCCCCACCCCAACCGCCATCCTCCTAACCGGCCAAACCGGGTCCGGAAAAAGCACG
CTCTCGCCCCCGCTCCTCTCGGCTCTAAGCCGGGGATGCGGCTCGGCAACGCACCTCATCGCCGATACCTTCAAG
ACCTATCACCCCGAGTACGCGCGTCTGGCTGCTGAGTCTTCGGCCCGGGCTTCGGCGGCTACGGGTCCGGATGCG
AGGAGGTGGCTTGCCATGGCGGTCGGGGAGGTTGTGAGGCGGAGGGCGCATCTTGTCGTTGAGAGTGCCTGTCGT
CATTTCGAGGATTGGGAGGAGATGGTGCGGGTGTTGAGGGGGGGAGGGTATAGGCTTGTGGTTGTTTTGTTGGCT
GTTCCTGCTGGGCTGAGCAGGTTGGGCATTGCTGTTCGCTTCTATCTACCTGGGCCTGACAGCTCGGTGCTGGAC
GCGAGACTTACGCCTGCGGCTGTGCATGATGAGTCGTATGGGGGGGTGGCACAGGCTGCCGCCTTTCTCGACGCG
AATCCTGGCCTCGCGGATCGGATCCTGCTTGTGAGAAGGGGGGGGTTGGTTGCTTCTGTGGGGGAGGGGGGGCTG
CTGGCTGCGTTGACGGGCGAGAGGGAAGGGTTATTAACGGGGGAAGAGAAGAGTAGGGCAAGGAGAGATCTGGAG
AGGTTGGCTGGGTGTGAGGGTGCGGAGGTGTTGTGTGAGACGTTGAAGGAGTTGCTGCGGCCGTTTTTGGATGGC
GGTGAGCGGGGGGGTGCTGGGTTGATGCCTCTTGTTGTTGTTGACGACGAAGCTGGTGATGGAGACAATGTGCTT
CGGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail