Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5733
Gene name
LocationContig_588:1017..1812
Strand+
Gene length (bp)795
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5149
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5806
Ophiocordyceps australis map64 (Brazil) OphauB2|2741
Ophiocordyceps camponoti-floridani Ophcf2|04027
Ophiocordyceps camponoti-rufipedis Ophun1|5733 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3576

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5733
MSSGDVTPGKLPWTEDAKFKDDGKTINWSKIKMEGRTTKSLQNMWTKIVKEIAEIEAKDQAGDGHDTPAKSARKP
SEARTAAKRRTPTKKRAAEASDKSEASKKVKRSGPDEKGTDSE*
Coding >Ophun1|5733
ATGTCTTCCGGAGACGTTACGCCTGGCAAGCTCCCCTGGACCGAGGATGCAAAGTTCAAGGACGACGGCAAGACC
ATCAACTGGAGCAAAATCAAAATGGAAGGCAGAACGACAAAGAGCTTGCAGAACATGTGGACCAAGATCGTCAAG
GAGATTGCCGAAATCGAGGCCAAGGACCAGGCAGGCGATGGCCATGACACACCCGCTAAGTCCGCCCGGAAGCCG
TCTGAGGCTCGGACCGCCGCCAAGCGCCGGACTCCAACCAAGAAGAGAGCTGCGGAGGCATCCGACAAGAGCGAA
GCCTCCAAGAAAGTGAAGCGATCTGGCCCAGATGAAAAGGGGACCGACAGCGAGTAA
Transcript >Ophun1|5733
ATGTCTTCCGGAGACGTTACGCCTGGCAAGCTCCCCTGGACCGAGGATGCAAAGTTCAAGGACGACGGCAAGACC
ATCAACTGGAGCAAAATCAAAATGGAAGGCAGAACGACAAAGAGCTTGCAGAACATGTGGACCAAGATCGTCAAG
GAGATTGCCGAAATCGAGGCCAAGGACCAGGCAGGCGATGGCCATGACACACCCGCTAAGTCCGCCCGGAAGCCG
TCTGAGGCTCGGACCGCCGCCAAGCGCCGGACTCCAACCAAGAAGAGAGCTGCGGAGGCATCCGACAAGAGCGAA
GCCTCCAAGAAAGTGAAGCGATCTGGCCCAGATGAAAAGGGGACCGACAGCGAGTAA
Gene >Ophun1|5733
ATGTCTTCCGGAGACGTTACGCCTGGCAAGCTCCCCTGGACCGAGGATGCAAAGGTACCTAAGCTTGATGAGATT
TCCTGTTTTCCGCGTCTTCCTTTGCCTTTCGTCCATGCCATCTATGAGCCGAACAGCTCTCTCTTCCTTCACACT
TCTCATCTTTCGCGCTTCTCTCCCTCCACGCTTCTCTTCCTCTACACACGCTTCTCTTCCTCCACGGTTCTCCAC
GGCTCTCCTCCTTCACGCTCCACATTCTAGAGCCAGCATCTCTGCCGTTTTCCGCCTCACACTCTGGATTCACGC
ACTTCTTCCCACCTTGCAGGCTTCGCTTACATGTACGGTTCTCATAGCTTCAGCTTTTGCTCCGCATCATCGGTC
AGTTCAAGGACGACGGCAAGACCATCAACTGGAGCAAAATCAAAATGGAAGGCAGAACGACAAAGAGCTTGCAGA
ACATGTGGACCAAGATCGTCAAGGAGATTGCCGAAATCGAGGCCAAGGACCAGGCAGGCGATGGCCATGACACAC
GTAAGAACAACGACCCTTTCCCACGAGCTTTCCGCTAATTAATTCACTTCTCTAGCCGCTAAGTCCGCCCGGAAG
CCGTCTGAGGCTCGGACCGCCGCCAAGCGCCGGACTCCAACCAAGAAGAGAGCTGCGGGTGAGTCTCTCTGCTGG
TTTCACTTCGGTCGACCATGACTAAAGGTTGTCGACTTGATAGAGGCATCCGACAAGAGCGAAGCCTCCAAGAAA
GTGAAGCGATCTGGCCCAGATGAAAAGGGGACCGACAGCGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail