Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5732
Gene name
LocationContig_587:9731..10825
Strand+
Gene length (bp)1094
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 3.3E-10 238 303
PF09011 HMG_box_2 HMG-box domain 2.5E-09 237 296

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3032
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6831
Ophiocordyceps australis map64 (Brazil) OphauB2|5482
Ophiocordyceps camponoti-floridani Ophcf2|04670
Ophiocordyceps camponoti-rufipedis Ophun1|5732 (this protein)
Ophiocordyceps kimflemingae Ophio5|3300
Ophiocordyceps subramaniannii Hirsu2|5235

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5732
MFMSLSRVVARRVTPSGLVWASVSARRVIPVLSARAFSGSAFVLAPTTAKAKKAPAAKKAPATKKTTAAKKKSTA
TAAKKKKKAPAKVKAKAKAKAKKPAVVKKKKKVFKYQRKQMSPEEREKAKLRYLKMLSLWRMPKCRPATPWSLYV
ATHYPKGNDETATTKLNRLFNEYSKATAAEMEAWKAQTEDNDKFNKKELERWIKSHPVEVVYLANIARRRLIRLC
NKGAKFIPDDRQPKRPRNALAIYMSSQLPGQKNPGDRQADVFKAAVEKWNALSDAEKKPYVDQAKAENERCKGRH
EKFTQAAIQYWVDNMPKRKPTVPRKRAALKSKAKAAKA*
Coding >Ophun1|5732
ATGTTCATGTCGTTGAGCCGTGTCGTCGCCCGCCGGGTGACGCCGTCGGGCCTCGTCTGGGCTTCCGTCTCGGCC
CGTCGCGTCATCCCCGTCTTGTCGGCGCGTGCCTTTTCCGGCTCGGCTTTTGTTCTCGCTCCGACGACGGCAAAG
GCCAAGAAGGCCCCGGCTGCCAAGAAAGCTCCCGCTACCAAGAAGACCACCGCCGCAAAGAAGAAGTCGACTGCG
ACCGCCGCAAAGAAGAAGAAGAAGGCTCCGGCCAAGGTCAAGGCCAAGGCTAAGGCCAAGGCCAAGAAGCCGGCA
GTCGTCAAGAAGAAGAAGAAGGTGTTCAAGTACCAGAGGAAGCAGATGAGCCCCGAGGAGAGAGAAAAGGCCAAG
CTGCGCTACCTCAAGATGCTCTCTTTGTGGAGGATGCCGAAATGTCGGCCTGCTACGCCGTGGTCGCTATATGTA
GCCACCCACTATCCCAAAGGAAACGACGAGACCGCGACCACGAAGCTCAATCGTCTCTTTAACGAGTACTCCAAG
GCTACCGCCGCTGAGATGGAGGCCTGGAAAGCCCAGACGGAAGACAACGATAAATTTAACAAGAAGGAGCTCGAG
AGGTGGATCAAGTCGCACCCCGTCGAGGTCGTCTACCTGGCCAACATCGCCCGTCGCCGTCTCATTCGCCTTTGC
AACAAAGGAGCCAAATTTATCCCAGACGATCGTCAGCCCAAGCGCCCGCGCAACGCTCTGGCGATCTACATGTCA
TCGCAGCTGCCGGGACAAAAGAATCCGGGAGACCGCCAGGCTGACGTCTTCAAAGCCGCCGTCGAGAAGTGGAAC
GCGTTGAGCGACGCTGAGAAGAAGCCGTATGTTGATCAAGCCAAGGCTGAAAACGAGCGCTGCAAGGGCCGGCAC
GAAAAGTTCACCCAGGCTGCCATTCAATACTGGGTGGACAACATGCCCAAACGCAAGCCCACGGTCCCGAGAAAA
CGTGCAGCCCTCAAGAGTAAGGCAAAGGCGGCCAAGGCCTAG
Transcript >Ophun1|5732
ATGTTCATGTCGTTGAGCCGTGTCGTCGCCCGCCGGGTGACGCCGTCGGGCCTCGTCTGGGCTTCCGTCTCGGCC
CGTCGCGTCATCCCCGTCTTGTCGGCGCGTGCCTTTTCCGGCTCGGCTTTTGTTCTCGCTCCGACGACGGCAAAG
GCCAAGAAGGCCCCGGCTGCCAAGAAAGCTCCCGCTACCAAGAAGACCACCGCCGCAAAGAAGAAGTCGACTGCG
ACCGCCGCAAAGAAGAAGAAGAAGGCTCCGGCCAAGGTCAAGGCCAAGGCTAAGGCCAAGGCCAAGAAGCCGGCA
GTCGTCAAGAAGAAGAAGAAGGTGTTCAAGTACCAGAGGAAGCAGATGAGCCCCGAGGAGAGAGAAAAGGCCAAG
CTGCGCTACCTCAAGATGCTCTCTTTGTGGAGGATGCCGAAATGTCGGCCTGCTACGCCGTGGTCGCTATATGTA
GCCACCCACTATCCCAAAGGAAACGACGAGACCGCGACCACGAAGCTCAATCGTCTCTTTAACGAGTACTCCAAG
GCTACCGCCGCTGAGATGGAGGCCTGGAAAGCCCAGACGGAAGACAACGATAAATTTAACAAGAAGGAGCTCGAG
AGGTGGATCAAGTCGCACCCCGTCGAGGTCGTCTACCTGGCCAACATCGCCCGTCGCCGTCTCATTCGCCTTTGC
AACAAAGGAGCCAAATTTATCCCAGACGATCGTCAGCCCAAGCGCCCGCGCAACGCTCTGGCGATCTACATGTCA
TCGCAGCTGCCGGGACAAAAGAATCCGGGAGACCGCCAGGCTGACGTCTTCAAAGCCGCCGTCGAGAAGTGGAAC
GCGTTGAGCGACGCTGAGAAGAAGCCGTATGTTGATCAAGCCAAGGCTGAAAACGAGCGCTGCAAGGGCCGGCAC
GAAAAGTTCACCCAGGCTGCCATTCAATACTGGGTGGACAACATGCCCAAACGCAAGCCCACGGTCCCGAGAAAA
CGTGCAGCCCTCAAGAGTAAGGCAAAGGCGGCCAAGGCCTAG
Gene >Ophun1|5732
ATGTTCATGTCGTTGAGCCGTGTCGTCGCCCGCCGGGTGACGCCGTCGGGCCTCGTCTGGGCTTCCGTCTCGGCC
CGTCGCGTCATCCCCGTCTTGTCGGCGCGTGCCTTTTCCGGCTCGGCTTTTGTTCTCGCTCCGACGACGGCAAAG
GCCAAGAAGGCCCCGGCTGCCAAGAAAGCTCCCGCTACCAAGAAGACCACCGCCGCAAAGAAGAAGTCGACTGCG
ACCGCCGCAAAGAAGAAGAAGAAGGCTCCGGCCAAGGTCAAGGCCAAGGCTAAGGCCAAGGCCAAGAAGCCGGCA
GTCGTCAAGAAGAAGAAGAAGGTGTTCAAGTACCAGAGGAAGCAGATGAGCCCCGAGGAGAGAGAAAAGGCCAAG
CTGCGCTACCTCAAGATGCTCTCTTTGTGGAGGATGCCGAAATGTCGGCCTGCTACGCCGTGGTCGCTATATGTA
GCCACCCACTATCCCAAAGGAAACGACGAGACCGCGACCACGAAGCTCAATCGTCTCTTTAACGAGTACTCCAAG
GCTACCGCCGCTGAGATGGAGGTAGGATATCTCTCTGTTTATGTCTTTACCGCGCAGGCTTTCCTTTGCTGACCG
AGGCCTCGTCCGTTTCCTCTTAGGCCTGGAAAGCCCAGACGGAAGACAACGATAAATTTAACAAGAAGGAGCTCG
AGAGGTGGATCAAGTCGCACCCCGTCGAGGTCGTCTACCTGGCCAACATCGCCCGTCGCCGTCTCATTCGCCTTT
GCAACAAAGGAGCCAAATTTATCCCAGACGATCGTCAGCCCAAGCGCCCGCGCAACGCTCTGGCGATCTACATGT
CATCGCAGCTGCCGGGACAAAAGAATCCGGGAGACCGCCAGGCTGACGTCTTCAAAGCCGCCGTCGAGAAGTGGA
ACGCGTTGAGCGACGCTGAGAAGAAGCCGTATGTTGATCAAGCCAAGGCTGAAAACGAGCGCTGCAAGGGCCGGC
ACGAAAAGTTCACCCAGGCTGCCATTCAATACTGGGTGGACAACATGCCCAAACGCAAGCCCACGGTCCCGAGAA
AACGTGCAGCCCTCAAGAGTAAGGCAAAGGCGGCCAAGGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail