Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5728
Gene name
LocationContig_587:553..972
Strand-
Gene length (bp)419
Transcript length (bp)252
Coding sequence length (bp)252
Protein length (aa) 84

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like 4.7E-21 27 74

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P22289|QCR9_YEAST Cytochrome b-c1 complex subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QCR9 PE=1 SV=2 27 73 3.0E-07
sp|Q6CJX2|QCR9_KLULA Cytochrome b-c1 complex subunit 9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=QCR9 PE=3 SV=3 27 71 2.0E-06

GO

GO Term Description Terminal node
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c Yes
GO:0005750 mitochondrial respiratory chain complex III Yes
GO:0032991 protein-containing complex No
GO:0044237 cellular metabolic process No
GO:0019646 aerobic electron transport chain No
GO:1902494 catalytic complex No
GO:0009987 cellular process No
GO:1990351 transporter complex No
GO:0009060 aerobic respiration No
GO:0008152 metabolic process No
GO:0045275 respiratory chain complex III No
GO:0045333 cellular respiration No
GO:0098798 mitochondrial protein-containing complex No
GO:0006091 generation of precursor metabolites and energy No
GO:0098796 membrane protein complex No
GO:0022904 respiratory electron transport chain No
GO:0070069 cytochrome complex No
GO:0005575 cellular_component No
GO:0098803 respiratory chain complex No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0008150 biological_process No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:1902495 transmembrane transporter complex No
GO:1990204 oxidoreductase complex No
GO:0022900 electron transport chain No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5728
MPALQASLGRKWRASTSPSTDGRPSSSLFKTNYAMLATIFGAGFVFEMGFNSTMNKFWDNYNRGRQWKDIRSRYV
EEDAEEGI*
Coding >Ophun1|5728
ATGCCAGCTCTACAGGCAAGTCTCGGCCGGAAATGGCGCGCGAGCACGAGCCCGAGCACTGACGGGAGGCCCTCC
AGCTCGCTCTTCAAGACCAACTACGCCATGCTAGCAACGATTTTCGGTGCTGGCTTCGTTTTTGAGATGGGCTTC
AATTCGACCATGAACAAGTTCTGGGACAACTACAACCGAGGCCGCCAATGGAAGGACATCCGAAGCAGATATGTC
GAGGAGGATGCAGAGGAGGGCATCTGA
Transcript >Ophun1|5728
ATGCCAGCTCTACAGGCAAGTCTCGGCCGGAAATGGCGCGCGAGCACGAGCCCGAGCACTGACGGGAGGCCCTCC
AGCTCGCTCTTCAAGACCAACTACGCCATGCTAGCAACGATTTTCGGTGCTGGCTTCGTTTTTGAGATGGGCTTC
AATTCGACCATGAACAAGTTCTGGGACAACTACAACCGAGGCCGCCAATGGAAGGACATCCGAAGCAGATATGTC
GAGGAGGATGCAGAGGAGGGCATCTGA
Gene >Ophun1|5728
ATGGTAAGGGCACGGGTTTCTTCGGCCGCAAGCTTCGCTAATTTGTGGCGCTCAAGTCTCTCGGTAGCCAGCTCT
ACAGGCAAGTCTCGGCCGGAAATGGCGCGCGAGCACGAGCCCGAGCACTGACGGGAGGCCCTCCAGCTCGCTCTT
CAAGACCAACTACGCCATGCTAGCAACGATTTTCGGTGCTGGCTTCGTTTTTGAGATGTTCGTCGTCTCTCCGCG
CGGGATGGCGTATGGCTGACAGCCGTGACAGGGGCTTCAATTCGACCATGAACAAGTTCTGGGACAACTACAACC
GAGGCGTGCGTACAGGACGGTGTCGGTTCAGGGAGACTTGTGGCTAACATGGAATACAGCGCCAATGGAAGGACA
TCCGAAGCAGATATGTCGAGGAGGATGCAGAGGAGGGCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail