Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5725
Gene name
LocationContig_586:3758..4358
Strand-
Gene length (bp)600
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04758 Ribosomal_S30 Ribosomal protein S30 4.9E-26 3 56

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT63|RS30_SCHPO 40S ribosomal protein S30-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps3002 PE=3 SV=1 1 55 1.0E-22
sp|P0CT62|RS30A_SCHPO 40S ribosomal protein S30-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps3001 PE=3 SV=1 1 55 1.0E-22
sp|P0CX34|RS30B_YEAST 40S ribosomal protein S30-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS30B PE=1 SV=1 1 55 9.0E-16
sp|P0CX33|RS30A_YEAST 40S ribosomal protein S30-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS30A PE=1 SV=1 1 55 9.0E-16
sp|Q9W6Y0|RS30_ORYLA 40S ribosomal protein S30 OS=Oryzias latipes GN=fau PE=3 SV=2 3 58 4.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT63|RS30_SCHPO 40S ribosomal protein S30-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps3002 PE=3 SV=1 1 55 1.0E-22
sp|P0CT62|RS30A_SCHPO 40S ribosomal protein S30-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps3001 PE=3 SV=1 1 55 1.0E-22
sp|P0CX34|RS30B_YEAST 40S ribosomal protein S30-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS30B PE=1 SV=1 1 55 9.0E-16
sp|P0CX33|RS30A_YEAST 40S ribosomal protein S30-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS30A PE=1 SV=1 1 55 9.0E-16
sp|Q9W6Y0|RS30_ORYLA 40S ribosomal protein S30 OS=Oryzias latipes GN=fau PE=3 SV=2 3 58 4.0E-12
sp|P49689|RS30_ARATH 40S ribosomal protein S30 OS=Arabidopsis thaliana GN=RPS30A PE=3 SV=3 1 56 8.0E-12
sp|P62864|RS30_RAT 40S ribosomal protein S30 OS=Rattus norvegicus GN=Fau PE=1 SV=1 3 56 7.0E-11
sp|P0C2F0|RS30_PONAB 40S ribosomal protein S30 OS=Pongo abelii GN=FAU PE=3 SV=1 3 56 7.0E-11
sp|P62863|RS30_PIG 40S ribosomal protein S30 OS=Sus scrofa GN=FAU PE=3 SV=1 3 56 7.0E-11
sp|P62867|RS30_MUSSI 40S ribosomal protein S30 OS=Mus spicilegus GN=Fau PE=3 SV=1 3 56 7.0E-11
sp|P62862|RS30_MOUSE 40S ribosomal protein S30 OS=Mus musculus GN=Fau PE=1 SV=1 3 56 7.0E-11
sp|P62861|RS30_HUMAN 40S ribosomal protein S30 OS=Homo sapiens GN=FAU PE=1 SV=1 3 56 7.0E-11
sp|P62860|RS30_CRIGR 40S ribosomal protein S30 OS=Cricetulus griseus GN=FAU PE=3 SV=1 3 56 7.0E-11
sp|P62866|RS30_BOVIN 40S ribosomal protein S30 OS=Bos taurus GN=FAU PE=3 SV=1 3 56 7.0E-11
sp|O96269|RS30_PLAF7 40S ribosomal protein S30 OS=Plasmodium falciparum (isolate 3D7) GN=RPS30 PE=1 SV=1 1 56 8.0E-11
sp|Q556Y1|RS30_DICDI 40S ribosomal protein S30 OS=Dictyostelium discoideum GN=rps30-1 PE=3 SV=1 1 56 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup8290
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|5725 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5725
MGKVHGSLARAGKVKSQTPKVEPQEKPKQPKGRALKRLKYTRRFVNVVLTGGKRKASSDVGREGLILADNGIDEP
ESDFLIGCLAGRHGSSWSRYSRWMVMEDTWAFRKVHLLNLEGRKEMFVGKGSISACRECDEARQLDQTSCFPSIQ
RSMNVASQSMTVEHQDATVTAPKRLNPGHMSQSLFQSPSSSSPVLKPPV*
Coding >Ophun1|5725
ATGGGCAAGGTTCACGGCTCTCTCGCCCGTGCGGGCAAGGTCAAATCGCAGACTCCCAAGGTCGAGCCCCAAGAG
AAGCCGAAACAACCCAAGGGACGAGCCCTGAAGCGCTTGAAATACACGCGGCGATTCGTCAACGTTGTCTTGACC
GGCGGCAAGCGCAAGGCGAGTAGCGACGTTGGGCGTGAAGGCTTGATCTTGGCTGACAACGGAATAGATGAACCC
GAATCCGACTTCTTGATCGGCTGTTTGGCAGGGAGACATGGGTCGTCGTGGTCGAGATATTCGAGATGGATGGTC
ATGGAGGATACTTGGGCTTTTCGCAAGGTGCATTTACTCAATCTGGAGGGGCGCAAGGAGATGTTTGTTGGCAAA
GGGAGCATCTCGGCCTGTCGAGAGTGCGACGAAGCGCGCCAGCTTGACCAGACGTCCTGTTTTCCGTCAATACAA
AGGTCCATGAATGTCGCGTCTCAGTCCATGACAGTCGAGCATCAAGACGCGACAGTCACGGCACCTAAGCGTCTT
AATCCTGGCCACATGAGCCAGTCTCTCTTTCAGAGTCCCAGCTCATCATCGCCAGTACTAAAGCCGCCCGTGTAG
Transcript >Ophun1|5725
ATGGGCAAGGTTCACGGCTCTCTCGCCCGTGCGGGCAAGGTCAAATCGCAGACTCCCAAGGTCGAGCCCCAAGAG
AAGCCGAAACAACCCAAGGGACGAGCCCTGAAGCGCTTGAAATACACGCGGCGATTCGTCAACGTTGTCTTGACC
GGCGGCAAGCGCAAGGCGAGTAGCGACGTTGGGCGTGAAGGCTTGATCTTGGCTGACAACGGAATAGATGAACCC
GAATCCGACTTCTTGATCGGCTGTTTGGCAGGGAGACATGGGTCGTCGTGGTCGAGATATTCGAGATGGATGGTC
ATGGAGGATACTTGGGCTTTTCGCAAGGTGCATTTACTCAATCTGGAGGGGCGCAAGGAGATGTTTGTTGGCAAA
GGGAGCATCTCGGCCTGTCGAGAGTGCGACGAAGCGCGCCAGCTTGACCAGACGTCCTGTTTTCCGTCAATACAA
AGGTCCATGAATGTCGCGTCTCAGTCCATGACAGTCGAGCATCAAGACGCGACAGTCACGGCACCTAAGCGTCTT
AATCCTGGCCACATGAGCCAGTCTCTCTTTCAGAGTCCCAGCTCATCATCGCCAGTACTAAAGCCGCCCGTGTAG
Gene >Ophun1|5725
ATGGGCAAGGTTCACGGCTCTCTCGCCCGTGCGGGCAAGGTCAAATCGCAGACTCCCAAGGTCGAGCCCCAAGAG
AAGCCGAAACAACCCAAGGGACGAGCCCTGAAGCGCTTGAAATACACGCGGCGATTCGTCAACGTTGTCTTGACC
GGCGGCAAGCGCAAGGCGAGTAGCGACGTTGGGCGTGAAGGCTTGATCTTGGCTGACAACGGAATAGATGAACCC
GAATCCGACTTCTTGATCGGCTGTTTGGCAGGGAGACATGGGTCGTCGTGGTCGAGATATTCGAGATGGATGGTC
ATGGAGGATACTTGGGCTTTTCGCAAGGTGCATTTACTCAATCTGGAGGGGCGCAAGGAGATGTTTGTTGGCAAA
GGGAGCATCTCGGCCTGTCGAGAGTGCGACGAAGCGCGCCAGCTTGACCAGACGTCCTGTTTTCCGTCAATACAA
AGGTCCATGAATGTCGCGTCTCAGTCCATGACAGTCGAGCATCAAGACGCGACAGTCACGGCACCTAAGCGTCTT
AATCCTGGCCACATGAGCCAGTCTCTCTTTCAGAGTCCCAGCTCATCATCGCCAGTACTAAAGCCGCCCGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail