Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5715
Gene name
LocationContig_584:368..1516
Strand-
Gene length (bp)1148
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02037 SAP SAP domain 3.9E-14 5 37

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9JIX8|ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus GN=Acin1 PE=1 SV=3 253 352 1.0E-08
sp|Q9UKV3|ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=2 253 352 2.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3537
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1506
Ophiocordyceps australis map64 (Brazil) OphauB2|4210
Ophiocordyceps camponoti-floridani Ophcf2|04006
Ophiocordyceps camponoti-rufipedis Ophun1|5715 (this protein)
Ophiocordyceps kimflemingae Ophio5|8583
Ophiocordyceps subramaniannii Hirsu2|6784

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5715
MSDWTKLKVTELKAELKSRGLPQAGLKAELVARLQAADDEAEASPEPDEKNEAPIAVEAEAVDEAEASDELVELV
PEPPLQGEEEEHVGDAPAELKPVVDEPPVQKSRTSRSPAPVVSASDETPVVDGQIRNGAESLEETPTGDGTVEAL
KRKRRSASPPSKDESFKRRRAEELAQNDTPSTQLETGDAQVDDRMETEDSAKPETTQAEFAPRSPSPRPERSVSA
ARPPLDPSPAAGEEPEHERNSFAAPVDPPYHPYTSAIYINNLMRPLREVDLQTHLIELAKLSGDDDDDEHVMIQK
FFVDTIRTHAFVVFGSTSTAARVRDSLHGKVWPQESNRKALFVDFVPADKEDGSPVGGCLRTDGRW*
Coding >Ophun1|5715
ATGTCGGACTGGACGAAGCTCAAGGTCACGGAGCTCAAGGCCGAGCTCAAAAGCAGAGGTCTTCCTCAGGCTGGT
CTGAAAGCCGAGCTGGTCGCCCGCCTGCAAGCCGCCGACGACGAGGCTGAAGCGAGCCCTGAGCCCGACGAAAAG
AACGAGGCTCCAATTGCTGTTGAGGCGGAGGCGGTGGACGAGGCCGAGGCTAGCGATGAACTTGTCGAGCTGGTG
CCTGAACCTCCCTTGCAAGGGGAAGAGGAGGAGCATGTCGGTGATGCGCCGGCTGAGTTGAAGCCTGTTGTCGAT
GAGCCGCCGGTGCAGAAGAGTCGGACGTCTCGCTCTCCCGCTCCGGTGGTGAGCGCATCGGATGAAACGCCTGTC
GTCGACGGACAGATTCGCAACGGAGCCGAATCCCTCGAGGAGACGCCGACTGGCGACGGCACCGTCGAGGCTCTC
AAGCGCAAGCGACGTTCTGCCAGTCCGCCCTCGAAAGATGAATCATTCAAGCGCCGGCGCGCAGAGGAGCTGGCC
CAAAACGACACTCCCTCGACTCAACTCGAGACTGGCGATGCCCAGGTCGATGACCGCATGGAGACCGAGGATTCC
GCCAAGCCGGAGACGACGCAGGCCGAGTTTGCGCCGCGCTCCCCTTCTCCCCGTCCCGAAAGGTCCGTCTCGGCA
GCCCGGCCGCCCTTGGATCCATCCCCGGCAGCGGGCGAAGAGCCAGAGCACGAGCGGAATTCATTTGCCGCTCCG
GTTGATCCTCCCTATCACCCGTACACGTCGGCCATCTACATCAACAACCTGATGCGACCATTGCGCGAAGTCGAC
CTGCAAACCCATCTCATCGAACTGGCCAAGCTTTCAGGCGACGACGACGACGACGAACACGTCATGATCCAGAAG
TTCTTCGTCGACACCATCCGCACGCACGCCTTTGTCGTCTTCGGCTCGACCTCGACAGCCGCCCGCGTCCGCGAC
AGCCTGCACGGGAAAGTCTGGCCGCAGGAGAGCAACCGAAAGGCCCTCTTCGTCGACTTCGTGCCCGCCGATAAA
GAAGACGGGTCTCCGGTGGGAGGTTGTCTACGAACCGACGGAAGATGGTGA
Transcript >Ophun1|5715
ATGTCGGACTGGACGAAGCTCAAGGTCACGGAGCTCAAGGCCGAGCTCAAAAGCAGAGGTCTTCCTCAGGCTGGT
CTGAAAGCCGAGCTGGTCGCCCGCCTGCAAGCCGCCGACGACGAGGCTGAAGCGAGCCCTGAGCCCGACGAAAAG
AACGAGGCTCCAATTGCTGTTGAGGCGGAGGCGGTGGACGAGGCCGAGGCTAGCGATGAACTTGTCGAGCTGGTG
CCTGAACCTCCCTTGCAAGGGGAAGAGGAGGAGCATGTCGGTGATGCGCCGGCTGAGTTGAAGCCTGTTGTCGAT
GAGCCGCCGGTGCAGAAGAGTCGGACGTCTCGCTCTCCCGCTCCGGTGGTGAGCGCATCGGATGAAACGCCTGTC
GTCGACGGACAGATTCGCAACGGAGCCGAATCCCTCGAGGAGACGCCGACTGGCGACGGCACCGTCGAGGCTCTC
AAGCGCAAGCGACGTTCTGCCAGTCCGCCCTCGAAAGATGAATCATTCAAGCGCCGGCGCGCAGAGGAGCTGGCC
CAAAACGACACTCCCTCGACTCAACTCGAGACTGGCGATGCCCAGGTCGATGACCGCATGGAGACCGAGGATTCC
GCCAAGCCGGAGACGACGCAGGCCGAGTTTGCGCCGCGCTCCCCTTCTCCCCGTCCCGAAAGGTCCGTCTCGGCA
GCCCGGCCGCCCTTGGATCCATCCCCGGCAGCGGGCGAAGAGCCAGAGCACGAGCGGAATTCATTTGCCGCTCCG
GTTGATCCTCCCTATCACCCGTACACGTCGGCCATCTACATCAACAACCTGATGCGACCATTGCGCGAAGTCGAC
CTGCAAACCCATCTCATCGAACTGGCCAAGCTTTCAGGCGACGACGACGACGACGAACACGTCATGATCCAGAAG
TTCTTCGTCGACACCATCCGCACGCACGCCTTTGTCGTCTTCGGCTCGACCTCGACAGCCGCCCGCGTCCGCGAC
AGCCTGCACGGGAAAGTCTGGCCGCAGGAGAGCAACCGAAAGGCCCTCTTCGTCGACTTCGTGCCCGCCGATAAA
GAAGACGGGTCTCCGGTGGGAGGTTGTCTACGAACCGACGGAAGATGGTGA
Gene >Ophun1|5715
ATGTCGGACTGGACGAAGCTCAAGGTCACGGAGCTCAAGGCCGAGCTCAAAAGCAGAGGTCTTCCTCAGGCTGGT
CTGAAAGCCGAGCTGGTCGCCCGCCTGCAAGCCGCCGACGACGAGGCTGAAGCGAGCCCTGAGCCCGACGAAAAG
AACGAGGCTCCAATTGCTGTTGAGGCGGAGGCGGTGGACGAGGCCGAGGCTAGCGATGAACTTGTCGAGCTGGTG
CCTGAACCTCCCTTGCAAGGGGAAGAGGAGGAGCATGTCGGTGATGCGCCGGCTGAGTTGAAGCCTGTTGTCGAT
GAGCCGCCGGTGCAGAAGAGTCGGACGTCTCGCTCTCCCGCTCCGGTGGTGAGCGCATCGGATGAAACGCCTGTC
GTCGACGGACAGATTCGCAACGGAGCCGAATCCCTCGAGGAGACGCCGACTGGCGACGGCACCGTCGAGGCTCTC
AAGCGCAAGCGACGTTCTGCCAGTCCGCCCTCGAAAGATGAATCATTCAAGCGCCGGCGCGCAGAGGAGCTGGCC
CAAAACGACACTCCCTCGACTCAACTCGAGACTGGCGATGCCCAGGTCGATGACCGCATGGAGACCGAGGATTCC
GCCAAGCCGGAGACGACGCAGGCCGAGTTTGCGCCGCGCTCCCCTTCTCCCCGTCCCGAAAGGTCCGTCTCGGCA
GCCCGGCCGCCCTTGGATCCATCCCCGGCAGCGGGCGAAGAGCCAGAGCACGAGCGGAATTCATTTGCCGCTCCG
GTTGATCCTCCCTATCACCCGTACACGTCGGCCATCTACATCAACAACCTGATGCGACCATTGCGCGAAGTCGAC
CTGCAAACCCATCTCATCGAACTGGCCAAGCTTTCAGGCGACGACGACGACGACGAACACGTCATGATCCAGAAG
TTCTTCGTCGACACCATCCGCACGCACGCCTTTGTCGTCTTCGGCTCGACCTCGACAGCCGCCCGCGTCCGCGAC
AGCCTGCACGGGAAAGTCTGGCCGCAGGAGAGCAACCGAAAGGCCCTCTTCGTCGACTTCGTGCCCGCCGATAAA
GTCGGGCAGTGGATCGAGCTGGAGGAGAGCCACATGAGCGGTGATAGGAAGACGGGTCTCCGGTGGGAGGTTGTC
TACGAACCGACGGAAGATGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail