Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5705
Gene name
LocationContig_582:62..3862
Strand-
Gene length (bp)3800
Transcript length (bp)3189
Coding sequence length (bp)3189
Protein length (aa) 1063

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 8.8E-104 488 801
PF00929 RNase_T Exonuclease 5.1E-21 877 1050
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 2.8E-05 495 809

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CQ09|PAN2_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN2 PE=3 SV=1 22 1051 0.0E+00
sp|Q2GSV2|PAN2_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN2 PE=3 SV=2 1 1055 0.0E+00
sp|P0CQ08|PAN2_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN2 PE=3 SV=1 22 1051 0.0E+00
sp|Q09798|PAN2_SCHPO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pan2 PE=3 SV=2 25 1050 0.0E+00
sp|A4RF51|PAN2_MAGO7 PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN2 PE=3 SV=3 1 1050 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CQ09|PAN2_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN2 PE=3 SV=1 22 1051 0.0E+00
sp|Q2GSV2|PAN2_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN2 PE=3 SV=2 1 1055 0.0E+00
sp|P0CQ08|PAN2_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN2 PE=3 SV=1 22 1051 0.0E+00
sp|Q09798|PAN2_SCHPO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pan2 PE=3 SV=2 25 1050 0.0E+00
sp|A4RF51|PAN2_MAGO7 PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN2 PE=3 SV=3 1 1050 0.0E+00
sp|A2QW83|PAN2_ASPNC PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pan2 PE=3 SV=1 1 1051 0.0E+00
sp|A1CEK7|PAN2_ASPCL PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pan2 PE=3 SV=1 1 1051 0.0E+00
sp|Q4WHP6|PAN2_ASPFU PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pan2 PE=3 SV=1 1 1051 0.0E+00
sp|A1DFN6|PAN2_NEOFI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pan2 PE=3 SV=1 1 1051 0.0E+00
sp|Q0UPL5|PAN2_PHANO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAN2 PE=3 SV=1 1 1051 0.0E+00
sp|Q2ULU6|PAN2_ASPOR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pan2 PE=3 SV=1 1 1051 0.0E+00
sp|Q5BBL5|PAN2_EMENI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan2 PE=3 SV=1 1 1051 0.0E+00
sp|P0C581|PAN2_NEUCR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan2 PE=1 SV=2 4 1051 0.0E+00
sp|Q1E873|PAN2_COCIM PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Coccidioides immitis (strain RS) GN=PAN2 PE=3 SV=2 1 1051 0.0E+00
sp|Q0CJU7|PAN2_ASPTN PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pan2 PE=3 SV=1 1 1055 0.0E+00
sp|Q8BGF7|PAN2_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Mus musculus GN=Pan2 PE=1 SV=1 1 1055 3.0E-169
sp|Q6IE70|PAN2_RAT PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Rattus norvegicus GN=Pan2 PE=2 SV=1 1 1055 6.0E-168
sp|Q504Q3|PAN2_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Homo sapiens GN=PAN2 PE=1 SV=3 1 1055 1.0E-165
sp|Q6C462|PAN2_YARLI PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN2 PE=3 SV=2 1 1057 2.0E-165
sp|Q6BZ78|PAN2_DEBHA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN2 PE=3 SV=2 1 1046 4.0E-163
sp|A5DAD0|PAN2_PICGU PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN2 PE=3 SV=3 1 1051 2.0E-161
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Gallus gallus GN=PAN2 PE=2 SV=1 16 1055 9.0E-161
sp|Q6CMN5|PAN2_KLULA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN2 PE=3 SV=1 25 1059 6.0E-152
sp|A3LRV8|PAN2_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN2 PE=3 SV=2 1 1058 6.0E-150
sp|Q754X1|PAN2_ASHGO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN2 PE=3 SV=2 26 1054 3.0E-144
sp|Q5APK0|PAN2_CANAL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN2 PE=3 SV=1 1 1051 1.0E-138
sp|A5E1W0|PAN2_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN2 PE=3 SV=1 25 1055 3.0E-136
sp|P53010|PAN2_YEAST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN2 PE=1 SV=1 25 1059 2.0E-118
sp|Q6FS70|PAN2_CANGA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN2 PE=3 SV=1 25 1055 1.0E-102
sp|P53015|YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans GN=F31E3.4 PE=4 SV=1 791 1055 2.0E-33
sp|P53015|YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans GN=F31E3.4 PE=4 SV=1 25 714 1.0E-20
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 867 1051 9.0E-14
sp|Q2T9U5|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1 923 1060 2.0E-12
sp|A1A5R7|REXON_RAT Putative RNA exonuclease NEF-sp OS=Rattus norvegicus PE=2 SV=1 923 1060 3.0E-12
sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 923 1060 1.0E-11
sp|Q5REE2|AEN_PONAB Apoptosis-enhancing nuclease OS=Pongo abelii GN=AEN PE=2 SV=1 868 1051 1.0E-11
sp|Q9GZR2|REXO4_HUMAN RNA exonuclease 4 OS=Homo sapiens GN=REXO4 PE=1 SV=2 923 1062 3.0E-11
sp|Q8WTP8|AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens GN=AEN PE=1 SV=2 868 1051 3.0E-11
sp|Q6PAQ4|REXO4_MOUSE RNA exonuclease 4 OS=Mus musculus GN=Rexo4 PE=2 SV=2 858 1050 2.0E-10
sp|Q4R9F7|REXON_MACFA Putative RNA exonuclease NEF-sp OS=Macaca fascicularis GN=QtsA-10054 PE=2 SV=1 923 1060 3.0E-10
sp|Q5A3Q0|REXO4_CANAL RNA exonuclease 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX4 PE=3 SV=1 866 1061 1.0E-09
sp|Q757I9|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1 874 1052 1.0E-09
sp|P53331|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1 936 1051 6.0E-09
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 874 1062 1.0E-08
sp|Q2YDK1|I20L2_BOVIN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Bos taurus GN=ISG20L2 PE=2 SV=1 873 1051 4.0E-08
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 873 1059 6.0E-08
sp|Q08237|REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX4 PE=1 SV=1 874 1053 8.0E-08
sp|Q9H9L3|I20L2_HUMAN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens GN=ISG20L2 PE=1 SV=1 873 1051 1.0E-07
sp|Q6DEW6|REXO4_XENTR RNA exonuclease 4 OS=Xenopus tropicalis GN=rexo4 PE=2 SV=1 877 1050 3.0E-07
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 874 1056 3.0E-07
sp|Q6CE69|REXO4_YARLI RNA exonuclease 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=REX4 PE=3 SV=1 873 1051 3.0E-07
sp|P0CQ44|REXO4_CRYNJ RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=REX4 PE=3 SV=1 873 1051 6.0E-07
sp|P0CQ45|REXO4_CRYNB RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=REX4 PE=3 SV=1 873 1051 6.0E-07
sp|Q6AXU3|I20L2_RAT Interferon-stimulated 20 kDa exonuclease-like 2 OS=Rattus norvegicus GN=Isg20l2 PE=2 SV=1 873 1051 7.0E-07
sp|Q96AZ6|ISG20_HUMAN Interferon-stimulated gene 20 kDa protein OS=Homo sapiens GN=ISG20 PE=1 SV=2 872 1060 3.0E-06
sp|Q66UW5|ISG20_PIG Interferon-stimulated gene 20 kDa protein OS=Sus scrofa GN=Isg20 PE=1 SV=2 872 1060 4.0E-06
sp|A3KPE8|SDN1_ARATH Small RNA degrading nuclease 1 OS=Arabidopsis thaliana GN=SDN1 PE=2 SV=1 917 1049 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0070647 protein modification by small protein conjugation or removal No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0006508 proteolysis No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0008234 cysteine-type peptidase activity No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4736
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|113
Ophiocordyceps australis map64 (Brazil) OphauB2|7026
Ophiocordyceps camponoti-floridani Ophcf2|01141
Ophiocordyceps camponoti-rufipedis Ophun1|5705 (this protein)
Ophiocordyceps kimflemingae Ophio5|1746
Ophiocordyceps subramaniannii Hirsu2|9998

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5705
MDGDWDEVSRIPFPPSGVHAMPTPVTTMTFDTSQELLWTGNDYGRVMSFLGTEQQRYTSFKAHQALDGPVRQILV
NDKGVIALGSRDIHMALRRGPPIWHIRHDEMVELRCITFTSKGASEILVAGLQNKMLLIDINKGEVIEQLHSEYH
YTAMKRGRYICAATKHGAVHLLDPTNFSVVRIWNAHSALVNDIDAQHDFIVTCGYSLRQGQNYMLDPFLNVFDIK
KMSSMAPIPFPAGAAYVRMHPRMLTTSIVVSQSGQMHVVDLMNPNTSNVRQANVLSYLSMFEIAPSGEAMALADA
ECFIHLWGSPSKLHFVDLPAPVEFATPEEPMPPIDWTSETPLNSVGLPYYREVLASAMPDTVSDVGAPPQRFDVQ
FVSSLKTADFGMYGRNTRGVRRNQVENTRNVNRSASAGLKAPKFLSEKARESAKSDVKSADDKTDDLTSPTGETI
SGHKKSDVPMMYRNVEIKYSKFGVDDFDFGFYNKTRYSGLEIHISNSYANSLLQVMNFTPLIRNMALQHAATSCI
NDLCLLCELGFLFDMLQKADGSICQATNLLRTLSGHPQAAPLGLLEEDSHGSSLNLMLQGLTRFLLDKIVADFKS
MPPASSALEQVLATSATSSIRCMNCRSEYTRPGSTFVTDLLYPSHKSSGRNSKMPRVTFSQILKSSIERETTSKG
WCGRCQRYQTIATRKTIHNIPAVLMLNTAITNQDHRMLWSTPGFLPDEIGIIVDQGQFYCYEGEDLKLHLQRGMH
SITVYSLIGMAVNIEGGQTQKPHLVSVVNVAHSEPQSPGQSQWHLFNDFLVRSISREEALTFNQSWKTPSVVAFQ
VKHANNKMDTGWKDHLDTSILYHDLSPSLHPENQTYRILDHETERPGPGTIVALDTEFVAVRQPEIEMNSDGERE
TIRPIVYALARASVLRGQGEKEGTAFVDDYIAIKEPIVDYLTSYSGIREEDLDPRLSKHSLLSLKMAYKKLWILL
NLGCKFLGHGLKQDFRVINIHVPKAQVIDTIDLFYLKSRLRKLSLAFLAWYLLKEDIQMETHDSIEDSRTALRLY
RNQLQAAARRRR*
Coding >Ophun1|5705
ATGGATGGAGACTGGGACGAGGTTTCCCGCATCCCCTTTCCGCCCTCGGGCGTACACGCGATGCCCACGCCCGTG
ACTACCATGACGTTCGATACCTCGCAGGAGCTGCTCTGGACAGGAAACGACTACGGACGCGTCATGTCCTTTCTC
GGAACCGAGCAGCAGAGGTACACGTCGTTCAAGGCCCATCAGGCCCTAGATGGACCAGTGCGACAGATCCTGGTC
AACGACAAGGGCGTGATAGCACTGGGCTCAAGAGACATACATATGGCCCTGAGAAGAGGACCCCCTATTTGGCAC
ATCAGACACGATGAAATGGTCGAGCTGCGGTGCATAACCTTCACCTCGAAAGGAGCTTCGGAGATACTCGTCGCT
GGACTCCAGAACAAGATGCTTCTCATCGACATCAACAAGGGTGAGGTCATCGAGCAGCTGCATAGCGAGTATCAT
TATACCGCCATGAAGAGAGGCCGTTACATCTGCGCCGCCACCAAGCACGGAGCTGTCCATCTCCTGGATCCTACC
AACTTTTCCGTCGTTAGAATCTGGAACGCCCATTCGGCGCTGGTCAACGACATTGACGCGCAACACGACTTCATC
GTCACTTGCGGGTACTCCTTACGGCAGGGACAGAACTACATGCTGGATCCGTTCCTCAACGTATTCGACATCAAG
AAAATGTCCTCCATGGCCCCGATACCTTTCCCGGCCGGGGCCGCCTACGTGCGGATGCACCCGCGTATGCTCACG
ACCAGCATTGTCGTGTCCCAGTCCGGTCAGATGCATGTCGTGGACCTTATGAACCCAAACACAAGCAACGTCCGA
CAAGCCAACGTCCTCTCCTACTTGAGCATGTTTGAGATTGCTCCTTCGGGCGAAGCCATGGCGCTCGCCGATGCC
GAATGCTTCATCCATTTATGGGGCTCACCTTCCAAGCTGCATTTCGTCGACCTGCCGGCTCCGGTAGAGTTTGCA
ACTCCGGAGGAACCCATGCCACCTATCGACTGGACGTCTGAGACACCCTTGAACTCGGTCGGTCTGCCGTACTAT
CGAGAGGTTCTGGCGTCTGCAATGCCCGACACCGTTTCCGACGTCGGCGCTCCCCCCCAGCGGTTCGATGTGCAG
TTCGTCAGCAGCCTTAAGACGGCAGACTTTGGTATGTATGGCCGGAACACCCGTGGCGTCCGACGAAACCAGGTC
GAGAACACGCGCAACGTCAACAGGTCCGCCAGCGCCGGACTCAAGGCCCCCAAGTTTCTGAGCGAGAAGGCTCGT
GAGTCCGCTAAGAGCGACGTCAAGAGCGCCGACGATAAGACGGACGATCTCACCAGTCCTACGGGGGAAACCATA
TCCGGACATAAGAAATCCGACGTGCCCATGATGTACAGAAACGTGGAGATCAAGTATAGCAAGTTTGGCGTGGAC
GACTTTGATTTTGGCTTCTACAACAAGACGCGGTACTCCGGCTTGGAAATTCACATTTCCAACTCGTACGCCAAC
TCGCTGCTCCAGGTGATGAACTTTACACCCCTGATTCGCAACATGGCTCTCCAGCATGCCGCGACGTCGTGTATC
AACGATCTTTGCCTGCTGTGCGAGCTTGGGTTCCTGTTCGACATGCTGCAGAAAGCTGACGGGTCTATTTGCCAA
GCAACCAATTTGCTTAGGACGCTGAGCGGTCATCCCCAAGCCGCTCCTCTGGGACTTCTCGAGGAGGACTCCCAT
GGGTCGTCGTTGAACCTCATGCTGCAGGGCCTCACCCGCTTCCTCCTCGACAAGATTGTGGCCGATTTCAAGAGC
ATGCCTCCGGCGTCTTCGGCTCTGGAACAGGTTCTCGCAACGTCGGCTACAAGCTCCATCAGATGCATGAACTGC
AGGAGTGAGTACACGAGGCCCGGTTCGACGTTCGTTACCGACCTTCTCTACCCTTCCCATAAATCGTCAGGCCGC
AACAGCAAGATGCCCCGTGTCACCTTCTCCCAAATTCTGAAGAGCAGCATCGAGAGAGAGACGACATCTAAGGGA
TGGTGTGGCCGGTGTCAGCGATATCAGACCATTGCGACGAGAAAGACGATTCATAACATTCCGGCCGTGCTGATG
CTCAACACGGCCATCACGAACCAGGACCATCGAATGCTCTGGTCAACCCCCGGGTTTCTCCCAGACGAGATTGGC
ATCATTGTCGACCAAGGCCAGTTTTACTGCTACGAGGGCGAAGACCTCAAGCTTCACCTCCAGCGGGGCATGCAC
AGCATCACTGTCTACTCGCTCATCGGCATGGCCGTGAATATCGAGGGCGGTCAGACGCAGAAGCCCCATCTCGTA
TCCGTGGTCAACGTTGCCCATTCCGAGCCTCAGTCGCCGGGACAGAGCCAGTGGCATCTGTTCAATGACTTCCTG
GTCCGCTCTATCAGTAGAGAAGAGGCCCTGACCTTTAACCAGTCCTGGAAGACGCCTTCGGTTGTGGCCTTTCAG
GTTAAGCACGCCAACAACAAGATGGACACCGGGTGGAAGGATCATCTCGATACATCCATCCTCTATCACGACCTC
AGCCCAAGCTTGCACCCCGAGAACCAGACATATCGGATCCTGGACCACGAGACGGAACGCCCCGGGCCGGGGACC
ATTGTGGCCCTTGACACGGAGTTTGTCGCGGTGCGGCAGCCGGAGATCGAGATGAACTCGGACGGAGAGCGGGAG
ACGATCCGTCCCATTGTCTATGCGCTCGCTCGAGCGTCGGTGTTGCGAGGACAGGGCGAGAAGGAAGGGACGGCG
TTCGTGGACGACTACATTGCCATAAAGGAACCCATCGTCGACTACCTGACGTCGTACTCGGGCATCCGGGAGGAG
GATCTGGACCCGAGACTCTCCAAGCACAGTCTCTTGTCGCTCAAGATGGCATACAAGAAGCTCTGGATCCTGCTC
AACCTCGGCTGCAAATTCCTCGGTCACGGGCTGAAGCAGGACTTTCGCGTCATCAACATCCACGTGCCCAAGGCA
CAAGTCATAGACACCATCGACCTCTTCTACCTCAAGTCACGTCTGCGCAAGCTATCACTGGCCTTCCTGGCTTGG
TATCTCCTCAAAGAGGACATCCAGATGGAGACGCACGATTCCATCGAAGACTCGCGCACCGCCCTCAGGCTGTAC
CGCAATCAACTTCAAGCCGCCGCGCGCCGACGTCGATAG
Transcript >Ophun1|5705
ATGGATGGAGACTGGGACGAGGTTTCCCGCATCCCCTTTCCGCCCTCGGGCGTACACGCGATGCCCACGCCCGTG
ACTACCATGACGTTCGATACCTCGCAGGAGCTGCTCTGGACAGGAAACGACTACGGACGCGTCATGTCCTTTCTC
GGAACCGAGCAGCAGAGGTACACGTCGTTCAAGGCCCATCAGGCCCTAGATGGACCAGTGCGACAGATCCTGGTC
AACGACAAGGGCGTGATAGCACTGGGCTCAAGAGACATACATATGGCCCTGAGAAGAGGACCCCCTATTTGGCAC
ATCAGACACGATGAAATGGTCGAGCTGCGGTGCATAACCTTCACCTCGAAAGGAGCTTCGGAGATACTCGTCGCT
GGACTCCAGAACAAGATGCTTCTCATCGACATCAACAAGGGTGAGGTCATCGAGCAGCTGCATAGCGAGTATCAT
TATACCGCCATGAAGAGAGGCCGTTACATCTGCGCCGCCACCAAGCACGGAGCTGTCCATCTCCTGGATCCTACC
AACTTTTCCGTCGTTAGAATCTGGAACGCCCATTCGGCGCTGGTCAACGACATTGACGCGCAACACGACTTCATC
GTCACTTGCGGGTACTCCTTACGGCAGGGACAGAACTACATGCTGGATCCGTTCCTCAACGTATTCGACATCAAG
AAAATGTCCTCCATGGCCCCGATACCTTTCCCGGCCGGGGCCGCCTACGTGCGGATGCACCCGCGTATGCTCACG
ACCAGCATTGTCGTGTCCCAGTCCGGTCAGATGCATGTCGTGGACCTTATGAACCCAAACACAAGCAACGTCCGA
CAAGCCAACGTCCTCTCCTACTTGAGCATGTTTGAGATTGCTCCTTCGGGCGAAGCCATGGCGCTCGCCGATGCC
GAATGCTTCATCCATTTATGGGGCTCACCTTCCAAGCTGCATTTCGTCGACCTGCCGGCTCCGGTAGAGTTTGCA
ACTCCGGAGGAACCCATGCCACCTATCGACTGGACGTCTGAGACACCCTTGAACTCGGTCGGTCTGCCGTACTAT
CGAGAGGTTCTGGCGTCTGCAATGCCCGACACCGTTTCCGACGTCGGCGCTCCCCCCCAGCGGTTCGATGTGCAG
TTCGTCAGCAGCCTTAAGACGGCAGACTTTGGTATGTATGGCCGGAACACCCGTGGCGTCCGACGAAACCAGGTC
GAGAACACGCGCAACGTCAACAGGTCCGCCAGCGCCGGACTCAAGGCCCCCAAGTTTCTGAGCGAGAAGGCTCGT
GAGTCCGCTAAGAGCGACGTCAAGAGCGCCGACGATAAGACGGACGATCTCACCAGTCCTACGGGGGAAACCATA
TCCGGACATAAGAAATCCGACGTGCCCATGATGTACAGAAACGTGGAGATCAAGTATAGCAAGTTTGGCGTGGAC
GACTTTGATTTTGGCTTCTACAACAAGACGCGGTACTCCGGCTTGGAAATTCACATTTCCAACTCGTACGCCAAC
TCGCTGCTCCAGGTGATGAACTTTACACCCCTGATTCGCAACATGGCTCTCCAGCATGCCGCGACGTCGTGTATC
AACGATCTTTGCCTGCTGTGCGAGCTTGGGTTCCTGTTCGACATGCTGCAGAAAGCTGACGGGTCTATTTGCCAA
GCAACCAATTTGCTTAGGACGCTGAGCGGTCATCCCCAAGCCGCTCCTCTGGGACTTCTCGAGGAGGACTCCCAT
GGGTCGTCGTTGAACCTCATGCTGCAGGGCCTCACCCGCTTCCTCCTCGACAAGATTGTGGCCGATTTCAAGAGC
ATGCCTCCGGCGTCTTCGGCTCTGGAACAGGTTCTCGCAACGTCGGCTACAAGCTCCATCAGATGCATGAACTGC
AGGAGTGAGTACACGAGGCCCGGTTCGACGTTCGTTACCGACCTTCTCTACCCTTCCCATAAATCGTCAGGCCGC
AACAGCAAGATGCCCCGTGTCACCTTCTCCCAAATTCTGAAGAGCAGCATCGAGAGAGAGACGACATCTAAGGGA
TGGTGTGGCCGGTGTCAGCGATATCAGACCATTGCGACGAGAAAGACGATTCATAACATTCCGGCCGTGCTGATG
CTCAACACGGCCATCACGAACCAGGACCATCGAATGCTCTGGTCAACCCCCGGGTTTCTCCCAGACGAGATTGGC
ATCATTGTCGACCAAGGCCAGTTTTACTGCTACGAGGGCGAAGACCTCAAGCTTCACCTCCAGCGGGGCATGCAC
AGCATCACTGTCTACTCGCTCATCGGCATGGCCGTGAATATCGAGGGCGGTCAGACGCAGAAGCCCCATCTCGTA
TCCGTGGTCAACGTTGCCCATTCCGAGCCTCAGTCGCCGGGACAGAGCCAGTGGCATCTGTTCAATGACTTCCTG
GTCCGCTCTATCAGTAGAGAAGAGGCCCTGACCTTTAACCAGTCCTGGAAGACGCCTTCGGTTGTGGCCTTTCAG
GTTAAGCACGCCAACAACAAGATGGACACCGGGTGGAAGGATCATCTCGATACATCCATCCTCTATCACGACCTC
AGCCCAAGCTTGCACCCCGAGAACCAGACATATCGGATCCTGGACCACGAGACGGAACGCCCCGGGCCGGGGACC
ATTGTGGCCCTTGACACGGAGTTTGTCGCGGTGCGGCAGCCGGAGATCGAGATGAACTCGGACGGAGAGCGGGAG
ACGATCCGTCCCATTGTCTATGCGCTCGCTCGAGCGTCGGTGTTGCGAGGACAGGGCGAGAAGGAAGGGACGGCG
TTCGTGGACGACTACATTGCCATAAAGGAACCCATCGTCGACTACCTGACGTCGTACTCGGGCATCCGGGAGGAG
GATCTGGACCCGAGACTCTCCAAGCACAGTCTCTTGTCGCTCAAGATGGCATACAAGAAGCTCTGGATCCTGCTC
AACCTCGGCTGCAAATTCCTCGGTCACGGGCTGAAGCAGGACTTTCGCGTCATCAACATCCACGTGCCCAAGGCA
CAAGTCATAGACACCATCGACCTCTTCTACCTCAAGTCACGTCTGCGCAAGCTATCACTGGCCTTCCTGGCTTGG
TATCTCCTCAAAGAGGACATCCAGATGGAGACGCACGATTCCATCGAAGACTCGCGCACCGCCCTCAGGCTGTAC
CGCAATCAACTTCAAGCCGCCGCGCGCCGACGTCGATAG
Gene >Ophun1|5705
ATGGATGGAGACTGGGACGAGGTTCGTCATATACCCACGTCGTCCATGTGCCGACGCGCTTCAGGAAGCCTGCTG
ATGCATCGTTTTCCAGGTTTCCCGCATCCCCTTTCCGCCCTCGGGCGTACACGCGATGCCCACGCCCGTGACTAC
CATGACGTTCGATACCTCGCAGGAGCTGCTCTGGACAGGAAACGACTACGTACGTACAATCCCTTCCAGACATCT
TGTTATGCGACTGACAGCTCGGACAGGGACGCGTCATGTCCTTTCTCGGAACCGAGCAGCAGAGGTACACGTCGT
TCAAGGCCCATCAGGCCCTAGATGGACCAGTGCGACAGATCCTGGTCAACGACAAGGGCGTGATAGCACTGGGCT
CAAGAGACATACATATGGCCCTGAGAAGAGGACCCCCTATTTGGCACATCAGGTATGTCTTTTCCACTGGTCCGC
GAGACCAAATCTAACCATGCGTCCTTTAGACACGATGAAATGGTCGAGCTGCGGTGCATAACCTTCACCTCGAAA
GGAGCTTCGGAGATACTCGTCGCTGGACTCCAGAACAAGATGCTTCTCATCGACATCAACAAGGGTGAGGTCATC
GAGCAGCTGCATAGCGAGTATCATTATACCGCCATGAAGAGAGGCCGTTACATCTGCGCCGCCACCAAGCACGGA
GCTGTCCATCTCCTGGATCCTACCAACTTTTCCGTCGTTAGAATCTGGAACGCCCATTCGGCGCTGGTCAACGAC
ATTGACGCGCAACACGACTTCATCGTCACTTGCGGGTACTCCTTACGGCAGGGACAGAACTACATGCTGGATCCG
TTCCTCAACGTATTCGACATCAAGAAAATGTCCTCCATGGCCCCGATACCTTTCCCGGCCGGGGCCGCCTACGTG
CGGATGCACCCGCGTATGCTCACGACCAGCATTGTCGTGTCCCAGTCCGGTCAGATGCATGTCGTGGACCTTATG
AACCCAAACACAAGCAACGTCCGACAAGCCAACGTCCTCTCCTACTTGAGCATGTTTGAGATTGCTCCTTCGGGC
GAAGCCATGGCGCTCGCCGATGCCGAATGCTTCATCCATTTATGGGGCTCACCTTCCAAGCTGCATTTCGTCGAC
CTGCCGGCTCCGGTAGAGTTTGCAACTCCGGAGGAACCCATGCCACCTATCGACTGGACGTCTGAGACGTAAGAT
GAACCCCCCCCCCCCTTGTCGTGTCGACGAACAAGACTGACATGGCTGATAGACCCTTGAACTCGGTCGGTCTGC
CGTACTATCGAGAGGTTCTGGCGTCTGCAATGCCCGACACCGTTTCCGACGTCGGCGCTCCCCCCCAGCGGTTCG
ATGTGCAGTTCGTCAGCAGCCTTAAGACGGCAGACTTTGGTATGTATGGCCGGAACACCCGTGGCGTCCGACGAA
ACCAGGTCGAGAACACGCGCAACGTCAACAGGTCCGCCAGCGCCGGACTCAAGGCCCCCAAGTTTCTGAGCGAGA
AGGCTCGTGAGTCCGCTAAGAGCGACGTCAAGAGCGCCGACGATAAGACGGACGATCTCACCAGTCCTACGGGGG
AAACCATATCCGGACATAAGAAATCCGACGTGCCCATGATGTACAGAAACGTGGAGATCAAGTATAGCAAGTTTG
GCGTGGACGACTTTGATTTTGGGTACGTCCGTTCCCGAGTTCTGCACAAGGTCAGACTGCTAAGAAAAGGGTGCA
GCTTCTACAACAAGACGCGGTACTCCGGCTTGGAAATTCACATTTCCAACTCGTACGCCAACTCGCTGCTCCAGG
TGATGAACTTTACACCCCTGATTCGCAACATGGCTCTCCAGCATGCCGCGACGTCGTGTATCAACGATCTTTGCC
TGCTGTGCGAGCTTGGGTTCCTGTTCGACATGCTGCAGAAAGCTGACGGGTCTATTTGCCAAGCAACCAATTTGC
TTAGGACGCTGAGCGGTCATCCCCAAGGTGAGCGAGCCCATGACTGTTTTCGAGCGTTGTGCTGACAGCTATGCA
GCCGCTCCTCTGGGACTTCTCGAGGAGGACTCCCATGGGTCGTCGTTGAACCTCATGCTGCAGGGCCTCACCCGC
TTCCTCCTCGACAAGATTGTGGCCGATTTCAAGAGCATGCCTCCGGCGTCTTCGGCTCTGGAACAGGTATGAGCC
CGTCGGCGTCTGTGAATCCTGACACTGACGTCTGTCTGACAGGTTCTCGCAACGTCGGCTACAAGCTCCATCAGA
TGCATGAACTGCAGGAGTGAGTACACGAGGCCCGGTTCGACGTTCGTTACCGACCTTCTCTACCCTTCCCATGTG
AGGAAGCCTTGGACTCTTTATGGCTGGCCCGTTGCTTATCCGCCGCAGAAATCGTCAGGCCGCAACAGCAAGATG
CCCCGTGTCACCTTCTCCCAAATTCTGAAGAGCAGCATCGAGAGAGAGACGACATCTAAGGGATGGTGTGGCCGG
TGTCAGCGATATCAGACCATTGCGACGAGAAAGACGATTCATAACATTCCGGCCGTGCTGATGCTCAACACGGCC
ATCACGAACCAGGACCATCGAATGCTCTGGTCAACCCCCGGGTTTCTCCCAGACGAGATTGGCATCATTGTCGAC
CAAGGCCAGTTTTACTGCTACGAGGGCGAAGACCTCAAGCTTCACCTCCAGCGGGGCATGCACAGCATCACTGTC
TACTCGCTCATCGGCATGGCCGTGAATATCGAGGGCGGTCAGACGCAGAAGCCCCATCTCGTATCCGTGGTCAAC
GGTGAGTTGTTCTCCCCATAACGGCTTCACCTCTGCTGACTTACCGCGGTTAGTTGCCCATTCCGAGCCTCAGTC
GCCGGGACAGAGCCAGTGGCATCTGTTCAATGACTTCCTGGTCCGCTCTATCAGTAGAGAAGAGGCCCTGACCTT
TAACCAGTCCTGGAAGACGCCTTCGGTTGTGGCCTTTCAGGTTAAGCACGCCAACAACAAGATGGACACCGGGTG
GAAGGATCATCTCGATACATCCATCCTCTATCACGACCTCAGGTAAGCAAGCGGTTCCTTCAACTGTGGATGAGC
ACTAACTCGGATGATAGCCCAAGCTTGCACCCCGAGAACCAGACATATCGGATCCTGGACCACGAGACGGAACGC
CCCGGGCCGGGGACCATTGTGGCCCTTGACACGGAGTTTGTCGCGGTGCGGCAGCCGGAGATCGAGATGAACTCG
GACGGAGAGCGGGAGACGATCCGTCCCATTGTCTATGCGCTCGCTCGAGCGTCGGTGTTGCGAGGACAGGGCGAG
AAGGAAGGGACGGCGTTCGTGGACGACTACATTGCCATAAAGGAACCCATCGTCGACTACCTGACGTCGTACTCG
GGCATCCGGGAGGAGGATCTGGACCCGAGACTCTCCAAGCACAGTCTCTTGTCGCTCAAGATGGCATACAAGAAG
CTCTGGATCCTGCTCAACCTCGGCTGCAAATTCCTCGGTCACGGGCTGAAGCAGGACTTTCGCGTCATCAACATC
CACGTGCCCAAGGCACAAGTCATAGACACCATCGACCTCTTCTACCTCAAGTCACGTCTGCGCAAGCTATCACTG
GCCTTCCTGGCTTGGTATCTCCTCAAAGAGGACATCCAGATGGAGACGCACGATTCCATCGAAGACTCGCGCACC
GCCCTCAGGCTGTACCGCAAGTACCTCGAATTCCAAGACGCCGGCGTTCTCGAAGCCATGCTCCAGGACATATAC
CGCGTCGGCCGCGAAGTCAACTTCAAGCCGCCGCGCGCCGACGTCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail