Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5700
Gene name
LocationContig_580:3947..11644
Strand-
Gene length (bp)7697
Transcript length (bp)7617
Coding sequence length (bp)7617
Protein length (aa) 2539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14222 MOR2-PAG1_N Cell morphogenesis N-terminal 5.4E-231 310 896
PF14225 MOR2-PAG1_C Cell morphogenesis C-terminal 6.7E-85 1931 2209
PF14228 MOR2-PAG1_mid Cell morphogenesis central region 7.9E-06 935 1414
PF14228 MOR2-PAG1_mid Cell morphogenesis central region 2.3E-16 1417 1649
PF14228 MOR2-PAG1_mid Cell morphogenesis central region 9.1E-11 1722 1885

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40468|TAO3_YEAST Cell morphogenesis protein PAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAO3 PE=1 SV=1 177 2396 0.0E+00
sp|Q9HDV6|MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mor2 PE=4 SV=1 882 2429 6.0E-170
sp|O94915|FRYL_HUMAN Protein furry homolog-like OS=Homo sapiens GN=FRYL PE=1 SV=2 180 1660 4.0E-69
sp|Q5TBA9|FRY_HUMAN Protein furry homolog OS=Homo sapiens GN=FRY PE=1 SV=1 136 1681 3.0E-53
sp|E9Q8I9|FRY_MOUSE Protein furry homolog OS=Mus musculus GN=Fry PE=1 SV=1 180 1681 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40468|TAO3_YEAST Cell morphogenesis protein PAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAO3 PE=1 SV=1 177 2396 0.0E+00
sp|Q9HDV6|MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mor2 PE=4 SV=1 882 2429 6.0E-170
sp|O94915|FRYL_HUMAN Protein furry homolog-like OS=Homo sapiens GN=FRYL PE=1 SV=2 180 1660 4.0E-69
sp|Q5TBA9|FRY_HUMAN Protein furry homolog OS=Homo sapiens GN=FRY PE=1 SV=1 136 1681 3.0E-53
sp|E9Q8I9|FRY_MOUSE Protein furry homolog OS=Mus musculus GN=Fry PE=1 SV=1 180 1681 2.0E-52
sp|Q9HDV6|MOR2_SCHPO Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mor2 PE=4 SV=1 171 676 2.0E-45
sp|Q9VT28|FRY_DROME Protein furry OS=Drosophila melanogaster GN=fry PE=1 SV=2 180 895 8.0E-38
sp|Q9VT28|FRY_DROME Protein furry OS=Drosophila melanogaster GN=fry PE=1 SV=2 936 1660 1.0E-15
sp|Q9VT28|FRY_DROME Protein furry OS=Drosophila melanogaster GN=fry PE=1 SV=2 1792 1925 1.0E-11
sp|O94915|FRYL_HUMAN Protein furry homolog-like OS=Homo sapiens GN=FRYL PE=1 SV=2 1776 1922 1.0E-08
sp|E9Q8I9|FRY_MOUSE Protein furry homolog OS=Mus musculus GN=Fry PE=1 SV=1 1795 1922 3.0E-06
sp|Q5TBA9|FRY_HUMAN Protein furry homolog OS=Homo sapiens GN=FRY PE=1 SV=1 1807 1922 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5700
MAPSQPRPDNDAAEPEAVWDRPGRPRYSPSISRDSSADTLVAPRSAPPRPDPSKSPASYGHHRQTSIVHGFQHSR
HGSLNAQSGPLSPQMIAAAGSERPEMQSVAARLEADSSRPNTALAAPIANTNGLAMERSASAADTSPPGAAHRKH
ERMQSKSRRDPPTHQPHPSRHHRDEQKTVGDYALHVLFTSFIAQAEEKLNECITVPFDPEPQIERICGPGVDAAF
DQLIVALGHIASPKPKALIDSMMLWRKNKSDAANEARGQLRNHHPGGPLLRRNTEPTQVGLTGPDGVPLTTTSIS
SKQEHVAQQERRSTVSIYILCRVLLEVIKESNLSSITPEMEDKLESIIFGQLKIADSEQLMLSPLKLANWNLFAQ
LLGYMSNINFAGVTRRFIDDLESSLQDRVVRSPTSYGGRDPEGKVDLVLGGMKHLRIKVSPEAAWEESCDFLASL
GRLFDRSRGPRVKTAFCQVLETLLLPIAAKASNSHLLHPKWSDVVAAIAPRLGQMFLKPRHWTVAFPLTATLLCV
SSPDNFATQWLHLILSLQTKAKDRLSRPLCLQVISRLIWTYLYRTNDNLQSATRKLDDVMKLVLPSSKRSVISSD
PAVTQPLIQIIRIIGFKYPEHCFRTIIFPLINAELFGVNKELRVEQLDPDRVVVGIRAFLCIVSDLERGEQGRPP
FPRYPEAAWSADRLPSPPSLSSSSRHIPLASTSVSAPDQEGVSRPVLTHVLSDGVRDYYLQFCQILGKITIACDN
TFGGQAALDEKFSSPGPKTPITETFNFSRRDEHQSAADQKQAFYELLHVAVQALPRCLSVDIPFNSLINLLCTGT
AHVQTNIAESSSNSLKAIARHCHAQQVTMGFARFIFNFDDRYSTMSDGGMLGPGHIESTLRLYVELLQIWIEEIR
QKSRDAAASQADASASDKRAKKLDLSSVWAEVDQAEARGLFFLCSQSHRVRRFAVTVLRLITEFDRALAKDEVEN
KESLRLINILENDSSQVMDFNDEHLSVAERSRLQRGLQTTNSKGVVVELCTSDVTYDTTLWFKIFPNLIRIAFDK
CPFAVAMCRDLICNRILQMYRPITLLSEPSRGLYYGSDQASGRMPARSPATQPEVLIEQWKLYLIFACSTLADPG
IQAPNPAKEAQHARKQSKPVAADGIVTARTLFKYLIPLLSSTSASVRDAVVVAMGSINIHIYRTLLEELQGHASR
CNDDGRARIHQRTNSAPRRNRKMDLLRTEITHVFKLTSHFLREPQVYQSEFFLSNLTSYAKDLKLFLMDGEVQMD
WEFQKLRRHYCGLMEALFEGINKSKDPSRWMTFESRKSAFSLMEEWCGFSPNQSQILAREDTMRQSLLDQQGLGE
RGGLTAAMEIEKRNLRTAALSAMAALCAGPISVMTESGSTLQFDMRRMLNWIETIFSNGSDRMNVTGRRALKNLI
VHNQEYPYLLEHCIGRCYLAEQPKVLGSYFSVAVAVLQEQSGYPCPFWKVLGLGLFSLGNDLSEMRSKASTMLRT
MEARQQRNSKIQDFDISISDKTQAVYKLAQFEISKRLAKQHTELAFHVVSEFTCYFKDLQPAAQRNVIAVVLPWI
QTIDLRLDPNGGPTAQSYNLLANLLELTIKSGAALHNEVQALWQALATGPYPGNVRLVLDFMMQLCLERREQNFV
EYAKQIVVFLSTTTSTPGIKVVEFLLMQITPRAMVPNEKRDPMPPPPDVNKLPYCADLGEVLPVGTKQAGYSLGQ
LSLILLVDLMVSPVQLTADNIPRLLQVVTVLWDHYTPLVQEQAREMLVHLIHELVISCVDDDAKQPIEDLVDLIR
RHDRSVVWSYEDSNGKVENEQNKVPRGMELLTAEVIKTFERPFPGIREKWGRLSLTWATSCPVRHLACRSFQVFR
CVLASLDQYMLADMLVRLSNTIADEDPEIQSFSMEILTTLKTLMAKLDSERLLTFPQLFWTTCACLESINEREFL
EAVEMLNQLMAKIDMRSSTVRRLIADGKPPQWEGPFEGIQPLLYKGLRSSVCWQPTLDTLDRLVRLPSDGLVGDD
TRLFFVLLANLPRFLRDMDSFGVGTSASSPTTTTTTTTTSAATAAAAQLAHESCLATAAILLDETDKQGGLGAIG
VALDGYVNGKLRDGDEFLSHMLSGLKSNYLPRMEFAMVTFLMGLLTNSLSWVKMQTMRVLRLVIPVVEMRNPELS
CHGSDLISPLLRLLQTDLCMEALGVLDNIMTMSGSQMDKHHLRMSMTRSTSRAVRKEYERTQSLFGIPESSGWSI
PVPARKTEVTRANMHAAFHTCQGKEGTSVETTPTPEVEFHTEDFPYGYYDVGPPPDRTETMLSDEGRADAVAIAG
GDLVTKLDSLDDFFDEPSSPHTDDDGRSSRTVTEFTPDAYESGTELYDEQILPILHEATTNNTSFQNGFADRPIF
TPRDVPPNTMNPGAFTAGMPPRPGLHSRSVTSPSTSGPFHPLSAAGSGGGDVMVSDDDYLSGGFSDADDERVDTR
HMDGAFFLESMIKGARQGPHSGGRRFISRSRDEAPRDKTMTPATPRVPNKMFSTKVPGPGDGV*
Coding >Ophun1|5700
ATGGCCCCGTCTCAACCACGGCCCGACAACGACGCAGCTGAGCCCGAGGCCGTCTGGGATCGCCCGGGCCGCCCC
CGTTACAGTCCGAGCATCTCCCGCGACTCGTCGGCCGATACCCTCGTCGCGCCCCGATCCGCGCCGCCTCGCCCC
GACCCGTCCAAGTCTCCGGCCTCGTACGGCCATCATCGCCAGACCTCCATCGTCCACGGCTTCCAGCACTCGCGA
CATGGCAGTCTCAACGCGCAGTCCGGCCCTCTCAGCCCGCAAATGATAGCTGCCGCTGGCTCGGAGCGGCCAGAG
ATGCAGTCGGTCGCTGCCCGATTGGAGGCCGACTCCTCGCGCCCAAACACGGCCCTGGCTGCCCCAATCGCAAAC
ACAAACGGCCTCGCCATGGAGAGATCCGCTTCTGCCGCTGACACGTCGCCTCCGGGTGCTGCTCATCGCAAGCAC
GAGAGGATGCAGAGCAAGTCTCGTCGCGACCCGCCCACCCATCAGCCTCATCCTTCGCGCCATCACCGGGACGAG
CAGAAGACGGTGGGCGATTATGCGCTGCACGTCCTCTTCACCTCGTTCATCGCCCAGGCCGAGGAGAAGCTCAAC
GAGTGCATCACCGTTCCCTTCGATCCCGAGCCCCAGATCGAGCGCATATGCGGCCCCGGTGTCGATGCCGCCTTC
GATCAGCTCATCGTCGCCCTCGGCCACATCGCCAGCCCCAAGCCAAAGGCCCTCATCGACTCCATGATGCTGTGG
CGAAAGAACAAGAGCGACGCCGCCAACGAAGCCCGCGGTCAGCTCCGTAATCACCACCCCGGAGGCCCGTTGCTG
CGTAGGAACACGGAGCCAACCCAGGTCGGCCTCACCGGACCGGATGGCGTGCCTCTCACCACCACATCCATATCT
TCCAAGCAGGAACACGTCGCCCAGCAGGAGCGCCGCTCCACAGTCTCCATCTACATCCTTTGCCGCGTCTTGTTA
GAAGTCATCAAGGAGAGCAACCTTTCTTCCATAACGCCAGAAATGGAGGACAAGCTCGAGAGCATCATCTTTGGC
CAGCTCAAGATTGCCGACTCGGAGCAGCTCATGCTCTCGCCCCTGAAGCTCGCCAACTGGAACCTATTCGCTCAG
CTGCTGGGCTACATGAGCAACATCAACTTCGCCGGCGTCACGAGACGATTCATCGATGACTTGGAAAGCTCGCTG
CAGGACCGCGTCGTCCGGAGCCCAACATCGTATGGCGGCCGCGACCCGGAGGGCAAGGTCGATCTCGTCCTCGGC
GGCATGAAGCATCTGCGCATCAAAGTCTCGCCAGAGGCGGCCTGGGAAGAGTCTTGCGACTTTCTCGCCTCCCTG
GGCCGCCTCTTCGATAGATCCCGCGGCCCCAGGGTCAAGACGGCGTTTTGCCAGGTTCTCGAGACTCTACTTCTT
CCCATTGCCGCCAAGGCGAGCAACAGCCATCTCTTACATCCCAAGTGGTCCGACGTCGTTGCCGCCATTGCGCCG
CGCTTGGGCCAAATGTTCCTCAAGCCGAGGCACTGGACCGTGGCCTTTCCCCTGACGGCCACTCTGCTGTGCGTC
TCGTCTCCCGATAACTTTGCCACTCAGTGGCTTCACCTCATCTTGTCGCTGCAGACAAAGGCCAAGGATCGCCTG
TCCCGGCCGCTGTGTCTGCAGGTCATCTCTCGCCTCATCTGGACCTATCTCTACCGCACCAACGACAACCTCCAG
AGCGCCACGCGGAAGCTCGACGACGTCATGAAGCTCGTCTTGCCGTCGTCAAAGCGGAGCGTCATCTCCTCCGAC
CCTGCCGTCACCCAGCCCCTGATACAAATAATCCGCATCATCGGGTTCAAGTACCCGGAGCACTGCTTCCGGACC
ATCATCTTTCCCCTCATCAATGCCGAGCTGTTTGGCGTCAACAAGGAGTTGAGGGTCGAGCAGCTGGATCCCGAC
AGGGTCGTCGTCGGCATCCGAGCCTTTCTGTGCATCGTGTCGGACCTGGAAAGGGGCGAGCAAGGCCGTCCCCCC
TTTCCGCGGTATCCAGAAGCCGCTTGGTCGGCGGACAGACTCCCCTCGCCGCCATCGCTGTCGTCTTCCTCTCGT
CATATACCTCTAGCATCGACCAGTGTGTCTGCTCCCGATCAGGAGGGCGTATCGCGGCCCGTTTTGACGCACGTG
CTGAGCGATGGGGTGCGCGACTACTATCTGCAGTTCTGCCAGATTCTGGGCAAGATCACGATAGCCTGTGACAAT
ACGTTTGGCGGCCAGGCGGCCTTGGACGAAAAGTTCAGCAGCCCCGGCCCCAAGACGCCCATCACGGAAACGTTC
AACTTTTCTCGCCGCGACGAGCATCAAAGCGCCGCCGACCAGAAGCAGGCCTTTTACGAGCTGCTTCACGTTGCC
GTCCAGGCTCTTCCGCGGTGCCTCTCGGTCGATATACCCTTCAACTCGCTCATCAACCTCCTGTGCACCGGCACG
GCGCATGTACAGACCAATATTGCCGAGTCGTCGTCCAACTCGCTCAAGGCCATCGCGAGGCATTGCCATGCCCAG
CAGGTGACCATGGGCTTCGCTCGCTTCATCTTCAACTTTGACGACCGCTACTCCACCATGTCTGACGGCGGCATG
CTCGGGCCCGGCCACATCGAAAGCACGCTGCGGCTGTACGTCGAACTGCTACAGATCTGGATCGAGGAGATACGG
CAAAAGTCTCGAGACGCCGCCGCCTCGCAGGCAGATGCCAGCGCTTCGGACAAGAGGGCCAAGAAGTTGGACTTG
TCGAGCGTGTGGGCAGAGGTGGATCAAGCAGAGGCTCGCGGCCTGTTCTTCCTCTGCTCTCAGTCACATCGCGTT
CGTCGTTTCGCCGTCACCGTCTTGCGGCTCATCACCGAGTTTGACAGGGCGTTGGCCAAGGACGAGGTCGAGAAC
AAGGAGTCTCTCCGGCTCATCAACATTCTAGAGAACGACTCGAGCCAAGTCATGGACTTTAACGACGAGCATCTT
TCCGTGGCTGAGCGAAGCCGGCTGCAACGCGGGCTCCAGACTACCAACAGCAAAGGTGTCGTGGTTGAGCTCTGC
ACCAGCGACGTCACCTACGACACCACGCTGTGGTTCAAGATATTCCCCAACCTGATCCGGATCGCCTTTGACAAG
TGCCCATTCGCCGTTGCCATGTGTCGAGACCTCATCTGCAACCGCATTCTTCAAATGTATCGACCCATCACTCTC
TTGTCAGAACCGTCCCGCGGCCTCTACTACGGCAGTGACCAGGCGAGCGGACGGATGCCGGCCCGGTCGCCGGCT
ACGCAGCCCGAGGTCCTCATCGAGCAGTGGAAGCTCTACCTCATCTTTGCCTGCTCGACCCTCGCGGACCCTGGC
ATCCAGGCGCCTAACCCGGCCAAGGAAGCTCAACACGCGCGGAAACAGTCCAAGCCTGTGGCGGCCGACGGCATC
GTCACCGCGAGGACGCTGTTCAAGTACCTCATCCCCTTGCTGTCGTCGACCTCGGCTTCGGTACGAGACGCTGTC
GTGGTCGCCATGGGATCCATCAATATCCACATCTACCGAACGTTGCTGGAGGAGCTACAGGGTCACGCGTCTCGG
TGCAACGACGATGGCCGTGCTCGGATCCACCAGCGGACCAACAGCGCGCCCAGGAGAAACCGAAAGATGGACCTG
CTCCGGACCGAGATTACGCACGTCTTTAAGCTCACGTCACACTTCCTCCGCGAACCCCAGGTGTATCAGTCCGAG
TTTTTCCTCTCCAACCTGACGTCGTACGCCAAAGATCTGAAGCTGTTCCTGATGGACGGCGAGGTCCAGATGGAT
TGGGAATTTCAGAAGCTGCGTCGCCATTACTGCGGATTGATGGAGGCTCTCTTCGAAGGCATCAACAAGTCCAAG
GACCCTTCCCGGTGGATGACGTTTGAGTCTCGAAAGTCTGCCTTTTCTCTCATGGAGGAGTGGTGCGGCTTCTCT
CCGAACCAGTCCCAGATCCTCGCCCGAGAGGACACGATGCGTCAGTCTCTTCTTGACCAGCAGGGACTGGGAGAG
CGCGGAGGTCTTACGGCTGCCATGGAGATTGAGAAGCGCAACCTCCGGACGGCGGCTCTCAGCGCCATGGCTGCC
CTCTGCGCAGGACCCATCAGCGTCATGACAGAAAGCGGCTCGACGCTTCAGTTTGACATGCGGCGGATGCTTAAC
TGGATAGAGACGATATTCAGCAACGGCAGCGACAGGATGAACGTGACGGGGCGACGGGCGTTGAAGAACCTCATC
GTGCACAACCAAGAGTATCCGTATCTGCTCGAGCACTGTATCGGGCGCTGCTACCTGGCCGAGCAACCCAAGGTG
CTGGGCAGCTACTTTTCCGTCGCTGTGGCGGTGTTACAGGAACAGAGCGGCTATCCTTGTCCGTTCTGGAAAGTC
CTCGGGCTCGGACTCTTCAGTCTGGGCAACGACCTGAGCGAGATGCGGTCCAAGGCGTCGACGATGCTCCGGACG
ATGGAGGCTCGACAACAACGCAACTCCAAGATCCAGGACTTTGACATTAGCATCTCAGACAAGACGCAGGCCGTC
TATAAGCTGGCGCAGTTTGAAATCTCCAAGCGGCTCGCCAAGCAGCACACGGAGCTCGCGTTCCACGTCGTGTCC
GAGTTTACGTGCTACTTCAAGGACCTGCAGCCGGCGGCGCAGCGAAACGTCATTGCCGTGGTGCTGCCCTGGATC
CAGACCATTGACCTCCGGCTGGATCCCAATGGCGGCCCGACGGCGCAGTCGTACAATCTGCTGGCCAACCTGCTC
GAGCTCACCATCAAGTCTGGCGCGGCGCTGCACAACGAGGTACAGGCGCTGTGGCAGGCGTTGGCGACGGGGCCG
TATCCAGGCAACGTGCGTCTCGTGCTCGACTTTATGATGCAGCTGTGTCTTGAGCGGCGCGAGCAGAACTTTGTC
GAGTATGCCAAACAGATTGTCGTCTTCCTATCAACAACGACGAGCACGCCGGGTATCAAGGTGGTCGAGTTTCTA
CTGATGCAGATCACGCCTCGAGCCATGGTTCCCAACGAGAAGAGGGATCCCATGCCTCCGCCACCAGACGTCAAT
AAGCTGCCCTACTGCGCTGACCTCGGCGAAGTACTCCCCGTCGGCACCAAGCAGGCCGGCTACTCGCTAGGCCAG
CTGTCGCTCATCCTGCTCGTCGACCTGATGGTCTCGCCCGTGCAGCTGACGGCGGACAACATCCCGCGCCTGCTA
CAGGTGGTGACGGTCCTGTGGGATCACTACACGCCCCTGGTCCAGGAGCAGGCACGCGAGATGCTGGTGCACCTG
ATTCACGAGCTCGTCATCTCTTGCGTCGACGACGACGCCAAGCAGCCCATCGAAGACCTGGTCGATCTCATCCGC
CGTCACGACCGGTCCGTCGTCTGGAGCTACGAGGACAGCAACGGCAAGGTGGAGAACGAGCAGAACAAGGTGCCG
CGCGGGATGGAGCTTCTCACCGCAGAGGTCATCAAGACGTTTGAAAGGCCCTTTCCCGGCATCCGTGAGAAATGG
GGCCGGCTGTCGTTGACGTGGGCCACCTCCTGTCCCGTCCGACACTTGGCCTGCCGATCCTTTCAGGTCTTCCGC
TGCGTGCTCGCCTCGCTGGATCAGTACATGCTCGCAGATATGCTGGTACGGCTGTCCAACACCATTGCGGATGAG
GATCCGGAGATCCAGTCCTTTTCCATGGAGATCCTCACCACTCTCAAGACGCTCATGGCCAAACTCGACTCAGAG
AGACTCCTCACCTTCCCGCAACTCTTCTGGACAACATGCGCATGCCTTGAATCCATCAACGAGCGCGAATTCCTC
GAAGCCGTCGAGATGCTCAACCAACTCATGGCCAAAATCGACATGCGCTCCTCCACCGTCCGAAGACTCATCGCC
GACGGGAAACCCCCTCAATGGGAGGGCCCCTTTGAAGGCATCCAGCCTTTACTATATAAAGGTCTCCGCTCCTCC
GTCTGCTGGCAGCCTACGCTCGACACGCTCGATCGTCTCGTCCGCCTACCGAGCGATGGTCTCGTCGGCGATGAT
ACTAGGCTTTTCTTCGTCTTGCTCGCTAACCTGCCGCGCTTCCTCCGCGACATGGACTCTTTCGGCGTGGGAACG
AGCGCGTCATCACCGACGACGACGACGACGACGACGACGACATCGGCAGCTACAGCGGCAGCAGCTCAACTCGCG
CACGAATCATGCCTCGCCACAGCAGCCATCCTCCTCGACGAAACAGACAAACAAGGCGGTCTCGGAGCCATCGGC
GTCGCCCTCGACGGCTACGTAAACGGCAAACTCCGCGACGGCGACGAGTTCCTAAGCCACATGCTCTCCGGCCTC
AAATCCAACTACCTCCCTCGCATGGAGTTCGCAATGGTAACCTTCCTCATGGGCCTGCTCACCAACTCGCTCAGC
TGGGTAAAGATGCAAACGATGCGCGTCCTCCGTCTCGTCATCCCCGTCGTCGAAATGCGCAACCCAGAGCTATCC
TGCCACGGCTCGGACCTCATCTCCCCGCTTCTACGACTGCTGCAGACGGATCTTTGCATGGAGGCTCTCGGCGTG
CTGGATAATATCATGACCATGTCGGGGAGTCAGATGGATAAGCATCATCTGCGGATGAGCATGACGCGCTCAACC
TCACGAGCCGTACGGAAGGAATACGAACGAACGCAGAGCCTATTCGGCATCCCCGAGTCTTCGGGCTGGTCCATC
CCCGTCCCAGCCCGCAAGACCGAAGTGACACGCGCCAACATGCACGCCGCCTTCCATACCTGCCAGGGCAAAGAA
GGCACATCGGTGGAAACGACGCCCACGCCAGAAGTCGAGTTCCACACCGAGGATTTCCCCTACGGATACTACGAT
GTCGGCCCGCCGCCGGACCGGACAGAGACGATGCTCTCGGACGAGGGCCGCGCTGACGCCGTGGCTATCGCGGGC
GGCGATCTGGTGACCAAGCTCGATAGCCTGGATGATTTCTTCGACGAGCCTTCCAGTCCGCACACAGACGACGAC
GGACGCTCTTCCCGGACCGTCACGGAGTTTACGCCCGATGCCTACGAGTCCGGCACAGAGCTCTACGACGAGCAG
ATCCTGCCCATCCTGCACGAAGCAACCACCAACAACACGTCGTTCCAGAATGGCTTTGCCGACCGGCCCATCTTC
ACGCCCAGAGACGTCCCGCCGAATACCATGAACCCGGGCGCTTTTACCGCGGGCATGCCTCCGAGGCCGGGCCTG
CATTCGCGCTCCGTCACGTCGCCCTCTACCTCGGGGCCTTTCCATCCGCTGTCGGCGGCGGGGAGCGGTGGTGGC
GATGTCATGGTGTCTGATGATGACTACCTTTCCGGAGGCTTCTCTGATGCTGATGACGAGCGTGTCGATACGCGT
CATATGGATGGGGCTTTCTTCCTGGAGAGTATGATCAAGGGCGCGAGGCAGGGGCCGCATTCGGGGGGGAGGCGC
TTCATCAGCCGGTCCCGCGATGAGGCACCCAGAGACAAGACAATGACGCCGGCGACGCCCAGAGTGCCCAACAAG
ATGTTTTCTACAAAGGTGCCAGGCCCAGGCGACGGGGTATGA
Transcript >Ophun1|5700
ATGGCCCCGTCTCAACCACGGCCCGACAACGACGCAGCTGAGCCCGAGGCCGTCTGGGATCGCCCGGGCCGCCCC
CGTTACAGTCCGAGCATCTCCCGCGACTCGTCGGCCGATACCCTCGTCGCGCCCCGATCCGCGCCGCCTCGCCCC
GACCCGTCCAAGTCTCCGGCCTCGTACGGCCATCATCGCCAGACCTCCATCGTCCACGGCTTCCAGCACTCGCGA
CATGGCAGTCTCAACGCGCAGTCCGGCCCTCTCAGCCCGCAAATGATAGCTGCCGCTGGCTCGGAGCGGCCAGAG
ATGCAGTCGGTCGCTGCCCGATTGGAGGCCGACTCCTCGCGCCCAAACACGGCCCTGGCTGCCCCAATCGCAAAC
ACAAACGGCCTCGCCATGGAGAGATCCGCTTCTGCCGCTGACACGTCGCCTCCGGGTGCTGCTCATCGCAAGCAC
GAGAGGATGCAGAGCAAGTCTCGTCGCGACCCGCCCACCCATCAGCCTCATCCTTCGCGCCATCACCGGGACGAG
CAGAAGACGGTGGGCGATTATGCGCTGCACGTCCTCTTCACCTCGTTCATCGCCCAGGCCGAGGAGAAGCTCAAC
GAGTGCATCACCGTTCCCTTCGATCCCGAGCCCCAGATCGAGCGCATATGCGGCCCCGGTGTCGATGCCGCCTTC
GATCAGCTCATCGTCGCCCTCGGCCACATCGCCAGCCCCAAGCCAAAGGCCCTCATCGACTCCATGATGCTGTGG
CGAAAGAACAAGAGCGACGCCGCCAACGAAGCCCGCGGTCAGCTCCGTAATCACCACCCCGGAGGCCCGTTGCTG
CGTAGGAACACGGAGCCAACCCAGGTCGGCCTCACCGGACCGGATGGCGTGCCTCTCACCACCACATCCATATCT
TCCAAGCAGGAACACGTCGCCCAGCAGGAGCGCCGCTCCACAGTCTCCATCTACATCCTTTGCCGCGTCTTGTTA
GAAGTCATCAAGGAGAGCAACCTTTCTTCCATAACGCCAGAAATGGAGGACAAGCTCGAGAGCATCATCTTTGGC
CAGCTCAAGATTGCCGACTCGGAGCAGCTCATGCTCTCGCCCCTGAAGCTCGCCAACTGGAACCTATTCGCTCAG
CTGCTGGGCTACATGAGCAACATCAACTTCGCCGGCGTCACGAGACGATTCATCGATGACTTGGAAAGCTCGCTG
CAGGACCGCGTCGTCCGGAGCCCAACATCGTATGGCGGCCGCGACCCGGAGGGCAAGGTCGATCTCGTCCTCGGC
GGCATGAAGCATCTGCGCATCAAAGTCTCGCCAGAGGCGGCCTGGGAAGAGTCTTGCGACTTTCTCGCCTCCCTG
GGCCGCCTCTTCGATAGATCCCGCGGCCCCAGGGTCAAGACGGCGTTTTGCCAGGTTCTCGAGACTCTACTTCTT
CCCATTGCCGCCAAGGCGAGCAACAGCCATCTCTTACATCCCAAGTGGTCCGACGTCGTTGCCGCCATTGCGCCG
CGCTTGGGCCAAATGTTCCTCAAGCCGAGGCACTGGACCGTGGCCTTTCCCCTGACGGCCACTCTGCTGTGCGTC
TCGTCTCCCGATAACTTTGCCACTCAGTGGCTTCACCTCATCTTGTCGCTGCAGACAAAGGCCAAGGATCGCCTG
TCCCGGCCGCTGTGTCTGCAGGTCATCTCTCGCCTCATCTGGACCTATCTCTACCGCACCAACGACAACCTCCAG
AGCGCCACGCGGAAGCTCGACGACGTCATGAAGCTCGTCTTGCCGTCGTCAAAGCGGAGCGTCATCTCCTCCGAC
CCTGCCGTCACCCAGCCCCTGATACAAATAATCCGCATCATCGGGTTCAAGTACCCGGAGCACTGCTTCCGGACC
ATCATCTTTCCCCTCATCAATGCCGAGCTGTTTGGCGTCAACAAGGAGTTGAGGGTCGAGCAGCTGGATCCCGAC
AGGGTCGTCGTCGGCATCCGAGCCTTTCTGTGCATCGTGTCGGACCTGGAAAGGGGCGAGCAAGGCCGTCCCCCC
TTTCCGCGGTATCCAGAAGCCGCTTGGTCGGCGGACAGACTCCCCTCGCCGCCATCGCTGTCGTCTTCCTCTCGT
CATATACCTCTAGCATCGACCAGTGTGTCTGCTCCCGATCAGGAGGGCGTATCGCGGCCCGTTTTGACGCACGTG
CTGAGCGATGGGGTGCGCGACTACTATCTGCAGTTCTGCCAGATTCTGGGCAAGATCACGATAGCCTGTGACAAT
ACGTTTGGCGGCCAGGCGGCCTTGGACGAAAAGTTCAGCAGCCCCGGCCCCAAGACGCCCATCACGGAAACGTTC
AACTTTTCTCGCCGCGACGAGCATCAAAGCGCCGCCGACCAGAAGCAGGCCTTTTACGAGCTGCTTCACGTTGCC
GTCCAGGCTCTTCCGCGGTGCCTCTCGGTCGATATACCCTTCAACTCGCTCATCAACCTCCTGTGCACCGGCACG
GCGCATGTACAGACCAATATTGCCGAGTCGTCGTCCAACTCGCTCAAGGCCATCGCGAGGCATTGCCATGCCCAG
CAGGTGACCATGGGCTTCGCTCGCTTCATCTTCAACTTTGACGACCGCTACTCCACCATGTCTGACGGCGGCATG
CTCGGGCCCGGCCACATCGAAAGCACGCTGCGGCTGTACGTCGAACTGCTACAGATCTGGATCGAGGAGATACGG
CAAAAGTCTCGAGACGCCGCCGCCTCGCAGGCAGATGCCAGCGCTTCGGACAAGAGGGCCAAGAAGTTGGACTTG
TCGAGCGTGTGGGCAGAGGTGGATCAAGCAGAGGCTCGCGGCCTGTTCTTCCTCTGCTCTCAGTCACATCGCGTT
CGTCGTTTCGCCGTCACCGTCTTGCGGCTCATCACCGAGTTTGACAGGGCGTTGGCCAAGGACGAGGTCGAGAAC
AAGGAGTCTCTCCGGCTCATCAACATTCTAGAGAACGACTCGAGCCAAGTCATGGACTTTAACGACGAGCATCTT
TCCGTGGCTGAGCGAAGCCGGCTGCAACGCGGGCTCCAGACTACCAACAGCAAAGGTGTCGTGGTTGAGCTCTGC
ACCAGCGACGTCACCTACGACACCACGCTGTGGTTCAAGATATTCCCCAACCTGATCCGGATCGCCTTTGACAAG
TGCCCATTCGCCGTTGCCATGTGTCGAGACCTCATCTGCAACCGCATTCTTCAAATGTATCGACCCATCACTCTC
TTGTCAGAACCGTCCCGCGGCCTCTACTACGGCAGTGACCAGGCGAGCGGACGGATGCCGGCCCGGTCGCCGGCT
ACGCAGCCCGAGGTCCTCATCGAGCAGTGGAAGCTCTACCTCATCTTTGCCTGCTCGACCCTCGCGGACCCTGGC
ATCCAGGCGCCTAACCCGGCCAAGGAAGCTCAACACGCGCGGAAACAGTCCAAGCCTGTGGCGGCCGACGGCATC
GTCACCGCGAGGACGCTGTTCAAGTACCTCATCCCCTTGCTGTCGTCGACCTCGGCTTCGGTACGAGACGCTGTC
GTGGTCGCCATGGGATCCATCAATATCCACATCTACCGAACGTTGCTGGAGGAGCTACAGGGTCACGCGTCTCGG
TGCAACGACGATGGCCGTGCTCGGATCCACCAGCGGACCAACAGCGCGCCCAGGAGAAACCGAAAGATGGACCTG
CTCCGGACCGAGATTACGCACGTCTTTAAGCTCACGTCACACTTCCTCCGCGAACCCCAGGTGTATCAGTCCGAG
TTTTTCCTCTCCAACCTGACGTCGTACGCCAAAGATCTGAAGCTGTTCCTGATGGACGGCGAGGTCCAGATGGAT
TGGGAATTTCAGAAGCTGCGTCGCCATTACTGCGGATTGATGGAGGCTCTCTTCGAAGGCATCAACAAGTCCAAG
GACCCTTCCCGGTGGATGACGTTTGAGTCTCGAAAGTCTGCCTTTTCTCTCATGGAGGAGTGGTGCGGCTTCTCT
CCGAACCAGTCCCAGATCCTCGCCCGAGAGGACACGATGCGTCAGTCTCTTCTTGACCAGCAGGGACTGGGAGAG
CGCGGAGGTCTTACGGCTGCCATGGAGATTGAGAAGCGCAACCTCCGGACGGCGGCTCTCAGCGCCATGGCTGCC
CTCTGCGCAGGACCCATCAGCGTCATGACAGAAAGCGGCTCGACGCTTCAGTTTGACATGCGGCGGATGCTTAAC
TGGATAGAGACGATATTCAGCAACGGCAGCGACAGGATGAACGTGACGGGGCGACGGGCGTTGAAGAACCTCATC
GTGCACAACCAAGAGTATCCGTATCTGCTCGAGCACTGTATCGGGCGCTGCTACCTGGCCGAGCAACCCAAGGTG
CTGGGCAGCTACTTTTCCGTCGCTGTGGCGGTGTTACAGGAACAGAGCGGCTATCCTTGTCCGTTCTGGAAAGTC
CTCGGGCTCGGACTCTTCAGTCTGGGCAACGACCTGAGCGAGATGCGGTCCAAGGCGTCGACGATGCTCCGGACG
ATGGAGGCTCGACAACAACGCAACTCCAAGATCCAGGACTTTGACATTAGCATCTCAGACAAGACGCAGGCCGTC
TATAAGCTGGCGCAGTTTGAAATCTCCAAGCGGCTCGCCAAGCAGCACACGGAGCTCGCGTTCCACGTCGTGTCC
GAGTTTACGTGCTACTTCAAGGACCTGCAGCCGGCGGCGCAGCGAAACGTCATTGCCGTGGTGCTGCCCTGGATC
CAGACCATTGACCTCCGGCTGGATCCCAATGGCGGCCCGACGGCGCAGTCGTACAATCTGCTGGCCAACCTGCTC
GAGCTCACCATCAAGTCTGGCGCGGCGCTGCACAACGAGGTACAGGCGCTGTGGCAGGCGTTGGCGACGGGGCCG
TATCCAGGCAACGTGCGTCTCGTGCTCGACTTTATGATGCAGCTGTGTCTTGAGCGGCGCGAGCAGAACTTTGTC
GAGTATGCCAAACAGATTGTCGTCTTCCTATCAACAACGACGAGCACGCCGGGTATCAAGGTGGTCGAGTTTCTA
CTGATGCAGATCACGCCTCGAGCCATGGTTCCCAACGAGAAGAGGGATCCCATGCCTCCGCCACCAGACGTCAAT
AAGCTGCCCTACTGCGCTGACCTCGGCGAAGTACTCCCCGTCGGCACCAAGCAGGCCGGCTACTCGCTAGGCCAG
CTGTCGCTCATCCTGCTCGTCGACCTGATGGTCTCGCCCGTGCAGCTGACGGCGGACAACATCCCGCGCCTGCTA
CAGGTGGTGACGGTCCTGTGGGATCACTACACGCCCCTGGTCCAGGAGCAGGCACGCGAGATGCTGGTGCACCTG
ATTCACGAGCTCGTCATCTCTTGCGTCGACGACGACGCCAAGCAGCCCATCGAAGACCTGGTCGATCTCATCCGC
CGTCACGACCGGTCCGTCGTCTGGAGCTACGAGGACAGCAACGGCAAGGTGGAGAACGAGCAGAACAAGGTGCCG
CGCGGGATGGAGCTTCTCACCGCAGAGGTCATCAAGACGTTTGAAAGGCCCTTTCCCGGCATCCGTGAGAAATGG
GGCCGGCTGTCGTTGACGTGGGCCACCTCCTGTCCCGTCCGACACTTGGCCTGCCGATCCTTTCAGGTCTTCCGC
TGCGTGCTCGCCTCGCTGGATCAGTACATGCTCGCAGATATGCTGGTACGGCTGTCCAACACCATTGCGGATGAG
GATCCGGAGATCCAGTCCTTTTCCATGGAGATCCTCACCACTCTCAAGACGCTCATGGCCAAACTCGACTCAGAG
AGACTCCTCACCTTCCCGCAACTCTTCTGGACAACATGCGCATGCCTTGAATCCATCAACGAGCGCGAATTCCTC
GAAGCCGTCGAGATGCTCAACCAACTCATGGCCAAAATCGACATGCGCTCCTCCACCGTCCGAAGACTCATCGCC
GACGGGAAACCCCCTCAATGGGAGGGCCCCTTTGAAGGCATCCAGCCTTTACTATATAAAGGTCTCCGCTCCTCC
GTCTGCTGGCAGCCTACGCTCGACACGCTCGATCGTCTCGTCCGCCTACCGAGCGATGGTCTCGTCGGCGATGAT
ACTAGGCTTTTCTTCGTCTTGCTCGCTAACCTGCCGCGCTTCCTCCGCGACATGGACTCTTTCGGCGTGGGAACG
AGCGCGTCATCACCGACGACGACGACGACGACGACGACGACATCGGCAGCTACAGCGGCAGCAGCTCAACTCGCG
CACGAATCATGCCTCGCCACAGCAGCCATCCTCCTCGACGAAACAGACAAACAAGGCGGTCTCGGAGCCATCGGC
GTCGCCCTCGACGGCTACGTAAACGGCAAACTCCGCGACGGCGACGAGTTCCTAAGCCACATGCTCTCCGGCCTC
AAATCCAACTACCTCCCTCGCATGGAGTTCGCAATGGTAACCTTCCTCATGGGCCTGCTCACCAACTCGCTCAGC
TGGGTAAAGATGCAAACGATGCGCGTCCTCCGTCTCGTCATCCCCGTCGTCGAAATGCGCAACCCAGAGCTATCC
TGCCACGGCTCGGACCTCATCTCCCCGCTTCTACGACTGCTGCAGACGGATCTTTGCATGGAGGCTCTCGGCGTG
CTGGATAATATCATGACCATGTCGGGGAGTCAGATGGATAAGCATCATCTGCGGATGAGCATGACGCGCTCAACC
TCACGAGCCGTACGGAAGGAATACGAACGAACGCAGAGCCTATTCGGCATCCCCGAGTCTTCGGGCTGGTCCATC
CCCGTCCCAGCCCGCAAGACCGAAGTGACACGCGCCAACATGCACGCCGCCTTCCATACCTGCCAGGGCAAAGAA
GGCACATCGGTGGAAACGACGCCCACGCCAGAAGTCGAGTTCCACACCGAGGATTTCCCCTACGGATACTACGAT
GTCGGCCCGCCGCCGGACCGGACAGAGACGATGCTCTCGGACGAGGGCCGCGCTGACGCCGTGGCTATCGCGGGC
GGCGATCTGGTGACCAAGCTCGATAGCCTGGATGATTTCTTCGACGAGCCTTCCAGTCCGCACACAGACGACGAC
GGACGCTCTTCCCGGACCGTCACGGAGTTTACGCCCGATGCCTACGAGTCCGGCACAGAGCTCTACGACGAGCAG
ATCCTGCCCATCCTGCACGAAGCAACCACCAACAACACGTCGTTCCAGAATGGCTTTGCCGACCGGCCCATCTTC
ACGCCCAGAGACGTCCCGCCGAATACCATGAACCCGGGCGCTTTTACCGCGGGCATGCCTCCGAGGCCGGGCCTG
CATTCGCGCTCCGTCACGTCGCCCTCTACCTCGGGGCCTTTCCATCCGCTGTCGGCGGCGGGGAGCGGTGGTGGC
GATGTCATGGTGTCTGATGATGACTACCTTTCCGGAGGCTTCTCTGATGCTGATGACGAGCGTGTCGATACGCGT
CATATGGATGGGGCTTTCTTCCTGGAGAGTATGATCAAGGGCGCGAGGCAGGGGCCGCATTCGGGGGGGAGGCGC
TTCATCAGCCGGTCCCGCGATGAGGCACCCAGAGACAAGACAATGACGCCGGCGACGCCCAGAGTGCCCAACAAG
ATGTTTTCTACAAAGGTGCCAGGCCCAGGCGACGGGGTATGA
Gene >Ophun1|5700
ATGGGTGAGATGAAACGGCGCCGTCTCCCTCCCCGTCGCAGACCGACTGACAGCGCCCCCGCTTCCCCTTTGCCC
TCTCTGAAGCCCCGTCTCAACCACGGCCCGACAACGACGCAGCTGAGCCCGAGGCCGTCTGGGATCGCCCGGGCC
GCCCCCGTTACAGTCCGAGCATCTCCCGCGACTCGTCGGCCGATACCCTCGTCGCGCCCCGATCCGCGCCGCCTC
GCCCCGACCCGTCCAAGTCTCCGGCCTCGTACGGCCATCATCGCCAGACCTCCATCGTCCACGGCTTCCAGCACT
CGCGACATGGCAGTCTCAACGCGCAGTCCGGCCCTCTCAGCCCGCAAATGATAGCTGCCGCTGGCTCGGAGCGGC
CAGAGATGCAGTCGGTCGCTGCCCGATTGGAGGCCGACTCCTCGCGCCCAAACACGGCCCTGGCTGCCCCAATCG
CAAACACAAACGGCCTCGCCATGGAGAGATCCGCTTCTGCCGCTGACACGTCGCCTCCGGGTGCTGCTCATCGCA
AGCACGAGAGGATGCAGAGCAAGTCTCGTCGCGACCCGCCCACCCATCAGCCTCATCCTTCGCGCCATCACCGGG
ACGAGCAGAAGACGGTGGGCGATTATGCGCTGCACGTCCTCTTCACCTCGTTCATCGCCCAGGCCGAGGAGAAGC
TCAACGAGTGCATCACCGTTCCCTTCGATCCCGAGCCCCAGATCGAGCGCATATGCGGCCCCGGTGTCGATGCCG
CCTTCGATCAGCTCATCGTCGCCCTCGGCCACATCGCCAGCCCCAAGCCAAAGGCCCTCATCGACTCCATGATGC
TGTGGCGAAAGAACAAGAGCGACGCCGCCAACGAAGCCCGCGGTCAGCTCCGTAATCACCACCCCGGAGGCCCGT
TGCTGCGTAGGAACACGGAGCCAACCCAGGTCGGCCTCACCGGACCGGATGGCGTGCCTCTCACCACCACATCCA
TATCTTCCAAGCAGGAACACGTCGCCCAGCAGGAGCGCCGCTCCACAGTCTCCATCTACATCCTTTGCCGCGTCT
TGTTAGAAGTCATCAAGGAGAGCAACCTTTCTTCCATAACGCCAGAAATGGAGGACAAGCTCGAGAGCATCATCT
TTGGCCAGCTCAAGATTGCCGACTCGGAGCAGCTCATGCTCTCGCCCCTGAAGCTCGCCAACTGGAACCTATTCG
CTCAGCTGCTGGGCTACATGAGCAACATCAACTTCGCCGGCGTCACGAGACGATTCATCGATGACTTGGAAAGCT
CGCTGCAGGACCGCGTCGTCCGGAGCCCAACATCGTATGGCGGCCGCGACCCGGAGGGCAAGGTCGATCTCGTCC
TCGGCGGCATGAAGCATCTGCGCATCAAAGTCTCGCCAGAGGCGGCCTGGGAAGAGTCTTGCGACTTTCTCGCCT
CCCTGGGCCGCCTCTTCGATAGATCCCGCGGCCCCAGGGTCAAGACGGCGTTTTGCCAGGTTCTCGAGACTCTAC
TTCTTCCCATTGCCGCCAAGGCGAGCAACAGCCATCTCTTACATCCCAAGTGGTCCGACGTCGTTGCCGCCATTG
CGCCGCGCTTGGGCCAAATGTTCCTCAAGCCGAGGCACTGGACCGTGGCCTTTCCCCTGACGGCCACTCTGCTGT
GCGTCTCGTCTCCCGATAACTTTGCCACTCAGTGGCTTCACCTCATCTTGTCGCTGCAGACAAAGGCCAAGGATC
GCCTGTCCCGGCCGCTGTGTCTGCAGGTCATCTCTCGCCTCATCTGGACCTATCTCTACCGCACCAACGACAACC
TCCAGAGCGCCACGCGGAAGCTCGACGACGTCATGAAGCTCGTCTTGCCGTCGTCAAAGCGGAGCGTCATCTCCT
CCGACCCTGCCGTCACCCAGCCCCTGATACAAATAATCCGCATCATCGGGTTCAAGTACCCGGAGCACTGCTTCC
GGACCATCATCTTTCCCCTCATCAATGCCGAGCTGTTTGGCGTCAACAAGGAGTTGAGGGTCGAGCAGCTGGATC
CCGACAGGGTCGTCGTCGGCATCCGAGCCTTTCTGTGCATCGTGTCGGACCTGGAAAGGGGCGAGCAAGGCCGTC
CCCCCTTTCCGCGGTATCCAGAAGCCGCTTGGTCGGCGGACAGACTCCCCTCGCCGCCATCGCTGTCGTCTTCCT
CTCGTCATATACCTCTAGCATCGACCAGTGTGTCTGCTCCCGATCAGGAGGGCGTATCGCGGCCCGTTTTGACGC
ACGTGCTGAGCGATGGGGTGCGCGACTACTATCTGCAGTTCTGCCAGATTCTGGGCAAGATCACGATAGCCTGTG
ACAATACGTTTGGCGGCCAGGCGGCCTTGGACGAAAAGTTCAGCAGCCCCGGCCCCAAGACGCCCATCACGGAAA
CGTTCAACTTTTCTCGCCGCGACGAGCATCAAAGCGCCGCCGACCAGAAGCAGGCCTTTTACGAGCTGCTTCACG
TTGCCGTCCAGGCTCTTCCGCGGTGCCTCTCGGTCGATATACCCTTCAACTCGCTCATCAACCTCCTGTGCACCG
GCACGGCGCATGTACAGACCAATATTGCCGAGTCGTCGTCCAACTCGCTCAAGGCCATCGCGAGGCATTGCCATG
CCCAGCAGGTGACCATGGGCTTCGCTCGCTTCATCTTCAACTTTGACGACCGCTACTCCACCATGTCTGACGGCG
GCATGCTCGGGCCCGGCCACATCGAAAGCACGCTGCGGCTGTACGTCGAACTGCTACAGATCTGGATCGAGGAGA
TACGGCAAAAGTCTCGAGACGCCGCCGCCTCGCAGGCAGATGCCAGCGCTTCGGACAAGAGGGCCAAGAAGTTGG
ACTTGTCGAGCGTGTGGGCAGAGGTGGATCAAGCAGAGGCTCGCGGCCTGTTCTTCCTCTGCTCTCAGTCACATC
GCGTTCGTCGTTTCGCCGTCACCGTCTTGCGGCTCATCACCGAGTTTGACAGGGCGTTGGCCAAGGACGAGGTCG
AGAACAAGGAGTCTCTCCGGCTCATCAACATTCTAGAGAACGACTCGAGCCAAGTCATGGACTTTAACGACGAGC
ATCTTTCCGTGGCTGAGCGAAGCCGGCTGCAACGCGGGCTCCAGACTACCAACAGCAAAGGTGTCGTGGTTGAGC
TCTGCACCAGCGACGTCACCTACGACACCACGCTGTGGTTCAAGATATTCCCCAACCTGATCCGGATCGCCTTTG
ACAAGTGCCCATTCGCCGTTGCCATGTGTCGAGACCTCATCTGCAACCGCATTCTTCAAATGTATCGACCCATCA
CTCTCTTGTCAGAACCGTCCCGCGGCCTCTACTACGGCAGTGACCAGGCGAGCGGACGGATGCCGGCCCGGTCGC
CGGCTACGCAGCCCGAGGTCCTCATCGAGCAGTGGAAGCTCTACCTCATCTTTGCCTGCTCGACCCTCGCGGACC
CTGGCATCCAGGCGCCTAACCCGGCCAAGGAAGCTCAACACGCGCGGAAACAGTCCAAGCCTGTGGCGGCCGACG
GCATCGTCACCGCGAGGACGCTGTTCAAGTACCTCATCCCCTTGCTGTCGTCGACCTCGGCTTCGGTACGAGACG
CTGTCGTGGTCGCCATGGGATCCATCAATATCCACATCTACCGAACGTTGCTGGAGGAGCTACAGGGTCACGCGT
CTCGGTGCAACGACGATGGCCGTGCTCGGATCCACCAGCGGACCAACAGCGCGCCCAGGAGAAACCGAAAGATGG
ACCTGCTCCGGACCGAGATTACGCACGTCTTTAAGCTCACGTCACACTTCCTCCGCGAACCCCAGGTGTATCAGT
CCGAGTTTTTCCTCTCCAACCTGACGTCGTACGCCAAAGATCTGAAGCTGTTCCTGATGGACGGCGAGGTCCAGA
TGGATTGGGAATTTCAGAAGCTGCGTCGCCATTACTGCGGATTGATGGAGGCTCTCTTCGAAGGCATCAACAAGT
CCAAGGACCCTTCCCGGTGGATGACGTTTGAGTCTCGAAAGTCTGCCTTTTCTCTCATGGAGGAGTGGTGCGGCT
TCTCTCCGAACCAGTCCCAGATCCTCGCCCGAGAGGACACGATGCGTCAGTCTCTTCTTGACCAGCAGGGACTGG
GAGAGCGCGGAGGTCTTACGGCTGCCATGGAGATTGAGAAGCGCAACCTCCGGACGGCGGCTCTCAGCGCCATGG
CTGCCCTCTGCGCAGGACCCATCAGCGTCATGACAGAAAGCGGCTCGACGCTTCAGTTTGACATGCGGCGGATGC
TTAACTGGATAGAGACGATATTCAGCAACGGCAGCGACAGGATGAACGTGACGGGGCGACGGGCGTTGAAGAACC
TCATCGTGCACAACCAAGAGTATCCGTATCTGCTCGAGCACTGTATCGGGCGCTGCTACCTGGCCGAGCAACCCA
AGGTGCTGGGCAGCTACTTTTCCGTCGCTGTGGCGGTGTTACAGGAACAGAGCGGCTATCCTTGTCCGTTCTGGA
AAGTCCTCGGGCTCGGACTCTTCAGTCTGGGCAACGACCTGAGCGAGATGCGGTCCAAGGCGTCGACGATGCTCC
GGACGATGGAGGCTCGACAACAACGCAACTCCAAGATCCAGGACTTTGACATTAGCATCTCAGACAAGACGCAGG
CCGTCTATAAGCTGGCGCAGTTTGAAATCTCCAAGCGGCTCGCCAAGCAGCACACGGAGCTCGCGTTCCACGTCG
TGTCCGAGTTTACGTGCTACTTCAAGGACCTGCAGCCGGCGGCGCAGCGAAACGTCATTGCCGTGGTGCTGCCCT
GGATCCAGACCATTGACCTCCGGCTGGATCCCAATGGCGGCCCGACGGCGCAGTCGTACAATCTGCTGGCCAACC
TGCTCGAGCTCACCATCAAGTCTGGCGCGGCGCTGCACAACGAGGTACAGGCGCTGTGGCAGGCGTTGGCGACGG
GGCCGTATCCAGGCAACGTGCGTCTCGTGCTCGACTTTATGATGCAGCTGTGTCTTGAGCGGCGCGAGCAGAACT
TTGTCGAGTATGCCAAACAGATTGTCGTCTTCCTATCAACAACGACGAGCACGCCGGGTATCAAGGTGGTCGAGT
TTCTACTGATGCAGATCACGCCTCGAGCCATGGTTCCCAACGAGAAGAGGGATCCCATGCCTCCGCCACCAGACG
TCAATAAGCTGCCCTACTGCGCTGACCTCGGCGAAGTACTCCCCGTCGGCACCAAGCAGGCCGGCTACTCGCTAG
GCCAGCTGTCGCTCATCCTGCTCGTCGACCTGATGGTCTCGCCCGTGCAGCTGACGGCGGACAACATCCCGCGCC
TGCTACAGGTGGTGACGGTCCTGTGGGATCACTACACGCCCCTGGTCCAGGAGCAGGCACGCGAGATGCTGGTGC
ACCTGATTCACGAGCTCGTCATCTCTTGCGTCGACGACGACGCCAAGCAGCCCATCGAAGACCTGGTCGATCTCA
TCCGCCGTCACGACCGGTCCGTCGTCTGGAGCTACGAGGACAGCAACGGCAAGGTGGAGAACGAGCAGAACAAGG
TGCCGCGCGGGATGGAGCTTCTCACCGCAGAGGTCATCAAGACGTTTGAAAGGCCCTTTCCCGGCATCCGTGAGA
AATGGGGCCGGCTGTCGTTGACGTGGGCCACCTCCTGTCCCGTCCGACACTTGGCCTGCCGATCCTTTCAGGTCT
TCCGCTGCGTGCTCGCCTCGCTGGATCAGTACATGCTCGCAGATATGCTGGTACGGCTGTCCAACACCATTGCGG
ATGAGGATCCGGAGATCCAGTCCTTTTCCATGGAGATCCTCACCACTCTCAAGACGCTCATGGCCAAACTCGACT
CAGAGAGACTCCTCACCTTCCCGCAACTCTTCTGGACAACATGCGCATGCCTTGAATCCATCAACGAGCGCGAAT
TCCTCGAAGCCGTCGAGATGCTCAACCAACTCATGGCCAAAATCGACATGCGCTCCTCCACCGTCCGAAGACTCA
TCGCCGACGGGAAACCCCCTCAATGGGAGGGCCCCTTTGAAGGCATCCAGCCTTTACTATATAAAGGTCTCCGCT
CCTCCGTCTGCTGGCAGCCTACGCTCGACACGCTCGATCGTCTCGTCCGCCTACCGAGCGATGGTCTCGTCGGCG
ATGATACTAGGCTTTTCTTCGTCTTGCTCGCTAACCTGCCGCGCTTCCTCCGCGACATGGACTCTTTCGGCGTGG
GAACGAGCGCGTCATCACCGACGACGACGACGACGACGACGACGACATCGGCAGCTACAGCGGCAGCAGCTCAAC
TCGCGCACGAATCATGCCTCGCCACAGCAGCCATCCTCCTCGACGAAACAGACAAACAAGGCGGTCTCGGAGCCA
TCGGCGTCGCCCTCGACGGCTACGTAAACGGCAAACTCCGCGACGGCGACGAGTTCCTAAGCCACATGCTCTCCG
GCCTCAAATCCAACTACCTCCCTCGCATGGAGTTCGCAATGGTAACCTTCCTCATGGGCCTGCTCACCAACTCGC
TCAGCTGGGTAAAGATGCAAACGATGCGCGTCCTCCGTCTCGTCATCCCCGTCGTCGAAATGCGCAACCCAGAGC
TATCCTGCCACGGCTCGGACCTCATCTCCCCGCTTCTACGACTGCTGCAGACGGATCTTTGCATGGAGGCTCTCG
GCGTGCTGGATAATATCATGACCATGTCGGGGAGTCAGATGGATAAGCATCATCTGCGGATGAGCATGACGCGCT
CAACCTCACGAGCCGTACGGAAGGAATACGAACGAACGCAGAGCCTATTCGGCATCCCCGAGTCTTCGGGCTGGT
CCATCCCCGTCCCAGCCCGCAAGACCGAAGTGACACGCGCCAACATGCACGCCGCCTTCCATACCTGCCAGGGCA
AAGAAGGCACATCGGTGGAAACGACGCCCACGCCAGAAGTCGAGTTCCACACCGAGGATTTCCCCTACGGATACT
ACGATGTCGGCCCGCCGCCGGACCGGACAGAGACGATGCTCTCGGACGAGGGCCGCGCTGACGCCGTGGCTATCG
CGGGCGGCGATCTGGTGACCAAGCTCGATAGCCTGGATGATTTCTTCGACGAGCCTTCCAGTCCGCACACAGACG
ACGACGGACGCTCTTCCCGGACCGTCACGGAGTTTACGCCCGATGCCTACGAGTCCGGCACAGAGCTCTACGACG
AGCAGATCCTGCCCATCCTGCACGAAGCAACCACCAACAACACGTCGTTCCAGAATGGCTTTGCCGACCGGCCCA
TCTTCACGCCCAGAGACGTCCCGCCGAATACCATGAACCCGGGCGCTTTTACCGCGGGCATGCCTCCGAGGCCGG
GCCTGCATTCGCGCTCCGTCACGTCGCCCTCTACCTCGGGGCCTTTCCATCCGCTGTCGGCGGCGGGGAGCGGTG
GTGGCGATGTCATGGTGTCTGATGATGACTACCTTTCCGGAGGCTTCTCTGATGCTGATGACGAGCGTGTCGATA
CGCGTCATATGGATGGGGCTTTCTTCCTGGAGAGTATGATCAAGGGCGCGAGGCAGGGGCCGCATTCGGGGGGGA
GGCGCTTCATCAGCCGGTCCCGCGATGAGGCACCCAGAGACAAGACAATGACGCCGGCGACGCCCAGAGTGCCCA
ACAAGATGTTTTCTACAAAGGTGCCAGGCCCAGGCGACGGGGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail