Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5699
Gene name
LocationContig_580:2950..3517
Strand+
Gene length (bp)567
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02966 DIM1 Mitosis protein DIM1 6.1E-70 6 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P83877|TXN4A_MOUSE Thioredoxin-like protein 4A OS=Mus musculus GN=Txnl4a PE=1 SV=1 3 143 5.0E-82
sp|P83876|TXN4A_HUMAN Thioredoxin-like protein 4A OS=Homo sapiens GN=TXNL4A PE=1 SV=1 3 143 5.0E-82
sp|P87215|DIMI_SCHPO Mitosis protein dim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dim1 PE=1 SV=1 3 143 3.0E-78
sp|Q9FE62|YLS8_ARATH Thioredoxin-like protein YLS8 OS=Arabidopsis thaliana GN=YLS8 PE=2 SV=1 3 143 5.0E-76
sp|Q75BD8|DIB1_ASHGO Spliceosomal protein DIB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DIB1 PE=3 SV=1 1 140 3.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P83877|TXN4A_MOUSE Thioredoxin-like protein 4A OS=Mus musculus GN=Txnl4a PE=1 SV=1 3 143 5.0E-82
sp|P83876|TXN4A_HUMAN Thioredoxin-like protein 4A OS=Homo sapiens GN=TXNL4A PE=1 SV=1 3 143 5.0E-82
sp|P87215|DIMI_SCHPO Mitosis protein dim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dim1 PE=1 SV=1 3 143 3.0E-78
sp|Q9FE62|YLS8_ARATH Thioredoxin-like protein YLS8 OS=Arabidopsis thaliana GN=YLS8 PE=2 SV=1 3 143 5.0E-76
sp|Q75BD8|DIB1_ASHGO Spliceosomal protein DIB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DIB1 PE=3 SV=1 1 140 3.0E-70
sp|Q06819|DIB1_YEAST Spliceosomal protein DIB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIB1 PE=1 SV=1 1 140 2.0E-67
sp|Q6FMI2|DIB1_CANGA Spliceosomal protein DIB1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIB1 PE=3 SV=1 8 140 6.0E-62
sp|Q553S5|TXN4A_DICDI Thioredoxin-like protein 4A homolog OS=Dictyostelium discoideum GN=txnl4a PE=3 SV=4 17 143 4.0E-58
sp|Q8BUH1|TXN4B_MOUSE Thioredoxin-like protein 4B OS=Mus musculus GN=Txnl4b PE=2 SV=2 3 143 1.0E-30
sp|Q9NX01|TXN4B_HUMAN Thioredoxin-like protein 4B OS=Homo sapiens GN=TXNL4B PE=1 SV=1 3 143 1.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0046540 U4/U6 x U5 tri-snRNP complex Yes
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0006397 mRNA processing No
GO:0030532 small nuclear ribonucleoprotein complex No
GO:0140513 nuclear protein-containing complex No
GO:0097525 spliceosomal snRNP complex No
GO:0120114 Sm-like protein family complex No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0008380 RNA splicing No
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016071 mRNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0097526 spliceosomal tri-snRNP complex No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5699
MGSVVVPHLISGWHVDQAILSEEDRLVVIRFGRDWDPDCMCQDEVLYKIAEKVKGFAVIYVCDIDGVPDFNQMYE
LYDPCTIMFFFRNKHIMCDFGTGNNNKLNWVLEDKQELIDIIETIYRGAKKGRGLVVSPKDYSTRHRY*
Coding >Ophun1|5699
ATGGGTTCCGTCGTCGTCCCCCACCTCATCTCGGGATGGCACGTCGACCAGGCCATCCTCAGTGAGGAAGATCGA
CTCGTCGTCATCCGCTTCGGCCGTGACTGGGATCCGGACTGCATGTGCCAAGACGAAGTGTTGTACAAGATTGCG
GAGAAAGTTAAGGGCTTTGCCGTGATCTACGTTTGCGACATAGATGGCGTTCCTGACTTCAACCAGATGTATGAG
CTTTATGACCCATGCACCATTATGTTTTTCTTCCGGAACAAACATATTATGTGTGATTTTGGGACGGGGAATAAC
AACAAGCTAAACTGGGTGTTGGAGGATAAACAGGAACTTATCGATATTATCGAGACCATCTACCGAGGTGCCAAG
AAGGGTCGTGGCCTCGTCGTTAGTCCCAAGGACTACTCGACGCGCCACCGATACTAA
Transcript >Ophun1|5699
ATGGGTTCCGTCGTCGTCCCCCACCTCATCTCGGGATGGCACGTCGACCAGGCCATCCTCAGTGAGGAAGATCGA
CTCGTCGTCATCCGCTTCGGCCGTGACTGGGATCCGGACTGCATGTGCCAAGACGAAGTGTTGTACAAGATTGCG
GAGAAAGTTAAGGGCTTTGCCGTGATCTACGTTTGCGACATAGATGGCGTTCCTGACTTCAACCAGATGTATGAG
CTTTATGACCCATGCACCATTATGTTTTTCTTCCGGAACAAACATATTATGTGTGATTTTGGGACGGGGAATAAC
AACAAGCTAAACTGGGTGTTGGAGGATAAACAGGAACTTATCGATATTATCGAGACCATCTACCGAGGTGCCAAG
AAGGGTCGTGGCCTCGTCGTTAGTCCCAAGGACTACTCGACGCGCCACCGATACTAA
Gene >Ophun1|5699
ATGGGTTCCGTCGTCGTCCCCCACCTCATCTCGGGATGGCACGTCGACCAGGCCATCCTCAGTGAGGAAGATCGA
CTCGTCGTCATCCGCTTCGGCCGTGACTGGGATCCGGACTGCATGTGCCAAGACGAAGTGTTGTACAAGATTGCG
GAGAAAGTTAAGGGCTTTGCCGTGATCTACGTTTGCGACATAGATGGCGTTCCTGACTTCAACCAGATGTATGGT
GAGTTTACTGCTGCTCCTCTCCCACATCATGCTCCGCCAGCTGACCTCTTCTCTTTCAACGCAGAGCTTTATGAC
CCATGCACCATTATGTTTTTCTTCCGGAACAAACATATTATGTGTGATTTTGGGACGGGGAATAACAACAAGCTA
AACTGGGTGTTGGAGGATAAACAGGAACTTATCGATATTATCGAGACCATCTACCGAGGTGCCAAGAAGGGTCGT
GGCCTCGTCGTTAGTCCCAAGGGTACGTCAAACGCAACTGCTCATCTCCTCTCCTCTGTCTTGCACCGCTAACGC
TCTGTTCGCTCTGCAGACTACTCGACGCGCCACCGATACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail