Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5690
Gene name
LocationContig_58:11821..18576
Strand-
Gene length (bp)6755
Transcript length (bp)4590
Coding sequence length (bp)4590
Protein length (aa) 1530

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain 6.1E-53 682 877
PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain 4.8E-31 881 1005
PF00787 PX PX domain 8.0E-16 118 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AZC9|SNX41_EMENI Sorting nexin-41 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=snx41 PE=3 SV=1 1 610 0.0E+00
sp|Q7SB54|SNX41_NEUCR Sorting nexin-41 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vsp-6 PE=3 SV=3 1 610 0.0E+00
sp|Q7SB53|MCE1_NEUCR mRNA-capping enzyme subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnp-2 PE=3 SV=1 637 1019 1.0E-157
sp|Q6C9X0|SNX41_YARLI Sorting nexin-41 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SNX41 PE=3 SV=1 22 610 2.0E-113
sp|P40997|MCE1_SCHPO mRNA-capping enzyme subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ceg1 PE=1 SV=1 640 1028 3.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AZC9|SNX41_EMENI Sorting nexin-41 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=snx41 PE=3 SV=1 1 610 0.0E+00
sp|Q7SB54|SNX41_NEUCR Sorting nexin-41 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vsp-6 PE=3 SV=3 1 610 0.0E+00
sp|Q7SB53|MCE1_NEUCR mRNA-capping enzyme subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnp-2 PE=3 SV=1 637 1019 1.0E-157
sp|Q6C9X0|SNX41_YARLI Sorting nexin-41 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SNX41 PE=3 SV=1 22 610 2.0E-113
sp|P40997|MCE1_SCHPO mRNA-capping enzyme subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ceg1 PE=1 SV=1 640 1028 3.0E-96
sp|Q6C783|MCE1_YARLI mRNA-capping enzyme subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CEG1 PE=3 SV=1 651 1028 3.0E-83
sp|P78587|MCE1_CANAX mRNA-capping enzyme subunit alpha OS=Candida albicans GN=CGT1 PE=1 SV=1 651 1020 2.0E-80
sp|Q6BT58|MCE1_DEBHA mRNA-capping enzyme subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CEG1 PE=3 SV=2 663 1019 3.0E-77
sp|P0CR64|SNX41_CRYNJ Sorting nexin-41 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SNX41 PE=3 SV=1 62 609 1.0E-74
sp|P0CR65|SNX41_CRYNB Sorting nexin-41 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SNX41 PE=3 SV=1 62 609 1.0E-74
sp|Q6FQ31|MCE1_CANGA mRNA-capping enzyme subunit alpha OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CEG1 PE=3 SV=1 651 1023 4.0E-67
sp|Q755D0|MCE1_ASHGO mRNA-capping enzyme subunit alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CEG1 PE=3 SV=1 651 1035 2.0E-66
sp|Q01159|MCE1_YEAST mRNA-capping enzyme subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEG1 PE=1 SV=2 651 1021 1.0E-65
sp|Q6CWR0|MCE1_KLULA mRNA-capping enzyme subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CEG1 PE=3 SV=1 651 1020 2.0E-65
sp|O60107|SNX41_SCHPO Sorting nexin-41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snx41 PE=1 SV=1 97 604 1.0E-56
sp|Q759T1|SNX41_ASHGO Sorting nexin-41 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SNX41 PE=3 SV=1 97 609 5.0E-47
sp|A7TIP6|ATG20_VANPO Autophagy-related protein 20 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG20 PE=3 SV=1 82 608 1.0E-41
sp|Q6CNX6|ATG20_KLULA Autophagy-related protein 20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG20 PE=3 SV=1 99 433 1.0E-41
sp|A6ZXL6|ATG20_YEAS7 Autophagy-related protein 20 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG20 PE=3 SV=1 97 436 4.0E-41
sp|Q07528|ATG20_YEAST Autophagy-related protein 20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG20 PE=1 SV=1 97 436 7.0E-41
sp|Q04053|SNX41_YEAST Sorting nexin-41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNX41 PE=1 SV=1 97 443 1.0E-39
sp|Q6CWX3|SNX41_KLULA Sorting nexin-41 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SNX41 PE=3 SV=1 3 464 6.0E-39
sp|Q75B65|ATG20_ASHGO Autophagy-related protein 20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG20 PE=3 SV=1 97 434 7.0E-39
sp|Q6BHN9|SNX41_DEBHA Sorting nexin-41 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SNX41 PE=3 SV=2 80 610 1.0E-32
sp|O60942|MCE1_HUMAN mRNA-capping enzyme OS=Homo sapiens GN=RNGTT PE=1 SV=1 645 1006 1.0E-31
sp|O55236|MCE1_MOUSE mRNA-capping enzyme OS=Mus musculus GN=Rngtt PE=1 SV=1 645 1006 2.0E-30
sp|Q6BZE1|ATG20_DEBHA Autophagy-related protein 20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG20 PE=3 SV=2 4 609 6.0E-30
sp|Q6NY98|MCE1_DANRE mRNA-capping enzyme OS=Danio rerio GN=rngtt PE=2 SV=1 645 1029 1.0E-29
sp|Q5AD73|SNX41_CANAL Sorting nexin-41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SNX41 PE=3 SV=1 80 404 2.0E-27
sp|Q17607|MCE1_CAEEL mRNA-capping enzyme OS=Caenorhabditis elegans GN=cel-1 PE=1 SV=2 663 1002 2.0E-25
sp|Q6FR93|ATG20_CANGA Autophagy-related protein 20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG20 PE=3 SV=1 97 446 3.0E-24
sp|Q9USM8|ATG20_SCHPO Autophagy-related protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg20 PE=3 SV=1 99 412 6.0E-22
sp|Q84424|MCE_PBCV1 mRNA-capping enzyme OS=Paramecium bursaria Chlorella virus 1 GN=A103R PE=1 SV=1 678 1005 4.0E-12
sp|Q9UNH6|SNX7_HUMAN Sorting nexin-7 OS=Homo sapiens GN=SNX7 PE=1 SV=1 83 186 1.0E-08
sp|Q4R5U9|SNX7_MACFA Sorting nexin-7 OS=Macaca fascicularis GN=SNX7 PE=2 SV=1 83 186 1.0E-08
sp|Q9CY18|SNX7_MOUSE Sorting nexin-7 OS=Mus musculus GN=Snx7 PE=1 SV=1 83 186 3.0E-08
sp|Q9P779|YNYB_SCHPO Sorting nexin C1711.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1711.11 PE=3 SV=1 104 215 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0004484 mRNA guanylyltransferase activity Yes
GO:0006370 7-methylguanosine mRNA capping Yes
GO:0005524 ATP binding Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016740 transferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009452 7-methylguanosine RNA capping No
GO:0036260 RNA capping No
GO:0006397 mRNA processing No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0030554 adenyl nucleotide binding No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0005543 phospholipid binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0017076 purine nucleotide binding No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0016070 RNA metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0008192 RNA guanylyltransferase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0016071 mRNA metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0070568 guanylyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 1059 1081 22
2 1506 1528 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5690
MWNDEDNNPYGTSFDRRDSQTSSSANPMSPTSHDFRAFETLDTPTGSDDDQTTFRNSAVHEDPQERPEVEDAAPR
RKPGGYNSRIEQILYENPDMPITITDAGKSLESGGRYIVYTIRTGDLEVRRRYSEFASLRDALTRLHPTLIIPPI
PEKHTMADYAAKPTSAKQDQQIIDLRKRMLAVFLNRCRRMEAVLNDNVWWRFLDPNASWNEVLHSHPVASIPKSV
LKAPPLDTANPTPAHAYLPVPASSAKLKATAGTNHDITASAIQAGIHGVRRLPPENSDRAEQDLDPHFIAYEAST
KELEQLLMGSMEKVNRRTLSHLSSLATDLCELGSRYNAFALSEQAPSLGTAIERVGQAADLSYIATEELSGSLGA
TFAEPMRENAQFTGVVKSVLRYRVLKRIQQDLTTEELHKKRALLDQLERSESEARRIEQYLSSSQQLSSPPKRSA
SLKESASQNRRDGAQEDTESIDSDFPATQGEFPSPPPSASQGLPERSVSVSHRKIPSGNSITNKIFGPIRHAVQG
VVDVDPERTRRDTIGKTRDSIVQLEQAQIVSEKDVKEASASVLQDMKRFQKDKEDDLKRYMLAYAKAHIEWAKKS
KQQWEEARAEDGSLRSQSTLILYARRRSTDPILRHDMDQPPEGPIGSIAEPGLKAEGPLLYSMRKEVAELLGRHQ
TSFPGAQPVSFARQHLDELTRQDYYVCEKSDGIRYLLYSTQDETGGEAHYLIDRKNDYWFIHNRNLHFPLADDLS
AFHTATLVDGELVWDSLSSGKKEPRFLVFDCLVMDGNKLMDRTLDKRLAYFNERLYTPYNKLFKEFPDERQFQPF
FVDMKPFQLAYGIEMMFKQVLPSLKHGNDGLIFTCRNTPYKHGTDPHILKWKPPEENTIDFRLKLIFPTVEPDER
ERKEGITEPFVDYDSVPKAEVLIYKGDSGPDRYEAFSDLFLSEDEWETLKGLGDPLNERIVECNLDEQGRWRLVR
FRDDKSEANHKSTVQSVLESISDRVSEKDLYRAAGPIRDSWKARQARADSEKKPTMKISGQCGDADGSIEPVSNL
KRKVFGPKAAAITAMTLMVAAVLTAFLLLVTQCEHGNNPQGSELAHAQHIVSQAAHQLVIRGQAGDTDAVFGVAG
SPIVAKVVGPSGSGLVTSIMATGTSGSLGGAVTAQEPDITKTITIETAKEIDVTQTVTVQTSQEQSSQTVETVTT
PLGVSVPISTQTALSTIYSMWTSEETDFITKTTTATTIVTRHLPMTTEDEDACVDSTATMTVSVYVTVSPAPEET
VTGDASTVTDVSTELSLTNGLPDITLSGKPSTQTALQTDVSLTTGLPDATVSGGGETQTAVQTVVSLTPGLPDAT
VTGNPSTVSNVVSSTVSRSVVSIFTTVVITDFWGTFSPSSQTSTATPTISSNEATLTITVTVSDLENNGQGATAS
ASDVSSVLADFTTESSPFAYTKTETVTMTKDVVTSATSLSTTLRMPPIGNATTGGMPAWTSAADVPVVVSEGAKK
PEPKAWGIGKGYGNIGCTVMLIAIIMLVL*
Coding >Ophun1|5690
ATGTGGAACGACGAGGACAATAATCCTTACGGCACCAGCTTTGATCGTCGCGACTCGCAGACCTCGTCTTCTGCG
AATCCCATGTCGCCCACCTCCCATGACTTTCGCGCATTTGAAACACTTGATACGCCGACGGGTAGCGACGATGAT
CAGACCACCTTTCGCAATAGTGCCGTTCATGAGGACCCTCAAGAGAGGCCCGAGGTCGAAGACGCTGCCCCCAGG
CGGAAACCTGGCGGATACAACAGCCGTATAGAGCAGATCCTTTACGAAAACCCAGACATGCCCATCACCATCACC
GATGCTGGCAAGAGTCTGGAAAGCGGAGGAAGATACATTGTTTACACCATCCGGACTGGTGATCTCGAAGTGCGT
CGCCGCTACTCCGAGTTCGCATCGCTGAGAGATGCACTCACGCGCTTGCACCCTACACTCATCATCCCTCCCATC
CCCGAGAAGCACACCATGGCCGACTACGCGGCCAAGCCGACAAGCGCCAAGCAGGATCAGCAGATAATCGACTTG
CGGAAGCGCATGCTTGCCGTGTTTCTGAACCGCTGCCGACGGATGGAAGCTGTTCTGAACGATAACGTCTGGTGG
CGCTTTCTTGACCCCAACGCAAGCTGGAATGAAGTTTTGCACTCTCACCCTGTGGCATCGATTCCAAAGTCGGTA
CTCAAGGCGCCCCCTCTGGACACGGCCAATCCCACACCTGCGCACGCCTATTTGCCCGTCCCGGCGAGCTCGGCC
AAATTGAAGGCGACGGCAGGCACTAACCATGACATTACCGCTTCCGCCATCCAGGCTGGTATTCATGGTGTGCGA
CGCTTGCCACCGGAGAACAGTGACCGGGCCGAGCAGGATCTTGATCCGCATTTCATCGCATACGAGGCTTCGACA
AAGGAGTTGGAGCAGCTTCTCATGGGATCCATGGAAAAGGTCAATCGTCGGACCCTCAGTCACCTATCTTCCCTC
GCCACAGACTTGTGCGAACTAGGCTCGCGATACAACGCCTTTGCCCTATCTGAACAGGCACCTTCTCTCGGCACC
GCCATTGAGCGGGTGGGCCAGGCAGCCGACTTGTCGTACATTGCTACCGAAGAGTTGTCAGGGTCGTTGGGGGCC
ACATTCGCTGAGCCGATGCGGGAGAATGCGCAATTCACAGGCGTGGTCAAAAGCGTGCTGCGATACAGGGTCCTC
AAGCGGATACAGCAAGATCTGACGACGGAAGAGCTCCACAAGAAGAGGGCCCTGTTGGACCAGTTGGAACGCAGC
GAGTCGGAAGCCAGGCGCATCGAGCAGTATCTGTCTAGCAGTCAGCAGCTGTCTTCGCCGCCGAAGCGATCGGCG
AGTCTTAAGGAGTCCGCCTCGCAGAATCGGCGAGATGGCGCGCAGGAGGATACGGAATCGATCGACTCGGATTTC
CCCGCCACTCAGGGCGAGTTTCCTTCGCCACCGCCGTCTGCGAGCCAGGGACTGCCCGAGAGAAGCGTCAGTGTT
TCTCACAGGAAGATTCCAAGCGGCAACTCGATTACCAATAAGATCTTTGGCCCCATTCGCCATGCGGTGCAGGGA
GTCGTCGATGTTGATCCCGAGCGAACACGCCGAGACACTATCGGCAAGACGAGAGACTCTATCGTTCAACTGGAG
CAGGCCCAAATCGTGTCGGAGAAGGACGTCAAGGAGGCCAGTGCCAGCGTTCTGCAAGACATGAAGAGGTTCCAG
AAGGACAAGGAAGACGATCTGAAGCGCTACATGCTCGCATACGCCAAGGCTCATATTGAATGGGCCAAGAAAAGC
AAGCAGCAGTGGGAGGAGGCACGGGCTGAGGACGGCTCTCTACGCTCGCAGAGCACCCTGATCCTTTATGCCAGA
CGCCGTTCGACTGATCCAATCCTCCGGCACGACATGGACCAGCCTCCCGAGGGGCCGATCGGCTCCATCGCCGAG
CCAGGGCTCAAGGCCGAAGGGCCGCTGCTGTATTCGATGCGCAAAGAGGTGGCCGAGCTGTTGGGGCGTCACCAG
ACCAGCTTCCCTGGGGCGCAGCCCGTCAGCTTCGCGAGGCAGCATCTCGACGAGCTCACGAGACAAGATTATTAC
GTGTGCGAGAAGTCGGACGGCATTCGATACCTCCTCTACTCGACCCAGGACGAGACCGGCGGAGAGGCGCATTAC
CTGATCGACCGCAAGAACGATTATTGGTTCATCCACAATCGGAATCTTCATTTCCCTCTGGCAGACGATCTCAGC
GCTTTCCACACGGCGACGCTCGTCGACGGCGAGCTCGTGTGGGACAGTCTGTCGAGCGGCAAAAAGGAGCCGCGA
TTTCTCGTGTTTGATTGCCTGGTTATGGATGGGAACAAGCTCATGGATCGGACGCTGGATAAACGCCTGGCCTAC
TTCAACGAGCGGCTTTACACGCCCTACAACAAGTTGTTCAAAGAGTTTCCTGATGAACGTCAGTTTCAGCCGTTC
TTCGTCGACATGAAGCCTTTCCAGCTGGCGTACGGTATTGAGATGATGTTCAAGCAGGTTCTCCCAAGCCTCAAA
CATGGTAACGATGGTCTCATATTTACGTGTCGCAACACGCCCTATAAGCATGGCACGGATCCGCATATTTTAAAG
TGGAAACCTCCCGAGGAAAACACCATCGACTTCCGACTGAAGCTCATCTTTCCAACTGTCGAGCCAGACGAGCGG
GAGAGAAAAGAGGGGATCACGGAGCCCTTTGTCGACTACGACAGCGTGCCCAAGGCCGAGGTTCTAATATACAAG
GGAGACAGCGGTCCGGATCGGTACGAGGCCTTTAGCGACCTCTTTCTCTCCGAGGATGAGTGGGAGACGTTGAAG
GGTCTGGGTGATCCTCTCAACGAGCGCATTGTCGAGTGCAATCTCGATGAACAGGGTCGATGGAGGCTGGTGCGC
TTCCGGGACGATAAGAGCGAGGCAAACCACAAGAGCACGGTCCAGAGCGTTCTGGAGAGCATCAGCGACCGTGTC
TCGGAGAAGGACCTCTACAGAGCAGCGGGCCCCATCAGGGATAGCTGGAAAGCCCGTCAAGCCCGTGCTGATTCG
GAGAAGAAGCCCACGATGAAGATCAGTGGCCAGTGTGGCGACGCCGACGGCTCCATCGAGCCCGTCTCGAATCTC
AAGCGAAAGGTTTTCGGACCCAAGGCTGCTGCTATCACTGCCATGACTCTCATGGTCGCCGCCGTTCTTACCGCT
TTCCTTCTTCTGGTCACTCAGTGTGAACATGGCAACAACCCTCAGGGATCGGAACTCGCCCATGCTCAGCATATC
GTCTCTCAGGCCGCTCACCAGCTCGTCATCCGTGGCCAGGCCGGTGACACTGACGCCGTCTTTGGCGTTGCAGGT
AGCCCCATCGTCGCCAAAGTCGTCGGCCCCTCTGGAAGCGGTCTCGTCACTTCCATCATGGCCACTGGAACCTCT
GGTAGCCTTGGCGGTGCTGTGACTGCTCAGGAGCCCGACATCACCAAGACTATCACCATCGAGACTGCCAAGGAG
ATCGACGTCACCCAGACTGTCACGGTCCAGACTTCTCAGGAACAGTCTTCTCAGACCGTCGAGACTGTCACGACA
CCTCTGGGAGTCAGCGTCCCGATCTCGACCCAAACCGCCCTGTCGACCATCTACAGCATGTGGACTTCTGAGGAA
ACCGACTTCATCACCAAGACGACGACGGCCACTACCATCGTGACGCGTCACCTTCCCATGACGACTGAGGACGAA
GATGCTTGCGTCGATAGCACCGCCACCATGACCGTGTCCGTCTACGTCACCGTCTCTCCCGCTCCTGAAGAGACA
GTCACGGGCGACGCCTCAACCGTCACCGACGTCAGCACTGAGCTCTCCCTCACAAATGGCCTTCCGGATATCACT
CTCTCCGGCAAACCGTCTACCCAGACGGCGCTGCAGACCGACGTCTCTCTTACGACTGGCCTCCCCGATGCCACC
GTCTCCGGAGGCGGCGAGACCCAGACGGCCGTTCAGACTGTCGTCTCCCTGACTCCCGGTCTCCCGGATGCCACT
GTAACGGGAAATCCCTCGACCGTCTCCAACGTCGTGTCCAGCACCGTCTCGCGGTCCGTCGTCTCCATCTTCACC
ACCGTCGTCATCACCGACTTCTGGGGCACCTTCAGCCCGTCGTCTCAGACCTCCACCGCGACGCCGACGATTTCG
TCCAACGAAGCCACCCTGACCATCACCGTCACCGTGTCTGACCTGGAGAACAACGGGCAGGGAGCCACCGCCAGC
GCCTCTGATGTCTCCTCCGTCCTGGCAGACTTCACCACCGAGTCATCTCCTTTCGCCTACACCAAGACGGAGACG
GTGACCATGACCAAGGACGTCGTCACCAGCGCCACCTCGCTCTCCACCACGCTGCGCATGCCTCCCATCGGCAAC
GCCACCACGGGCGGCATGCCCGCCTGGACGTCGGCGGCTGACGTGCCCGTCGTCGTGTCCGAGGGCGCCAAGAAG
CCCGAGCCCAAGGCTTGGGGCATCGGCAAGGGCTACGGCAACATTGGTTGCACCGTCATGCTCATTGCCATCATC
ATGCTGGTGCTCTGA
Transcript >Ophun1|5690
ATGTGGAACGACGAGGACAATAATCCTTACGGCACCAGCTTTGATCGTCGCGACTCGCAGACCTCGTCTTCTGCG
AATCCCATGTCGCCCACCTCCCATGACTTTCGCGCATTTGAAACACTTGATACGCCGACGGGTAGCGACGATGAT
CAGACCACCTTTCGCAATAGTGCCGTTCATGAGGACCCTCAAGAGAGGCCCGAGGTCGAAGACGCTGCCCCCAGG
CGGAAACCTGGCGGATACAACAGCCGTATAGAGCAGATCCTTTACGAAAACCCAGACATGCCCATCACCATCACC
GATGCTGGCAAGAGTCTGGAAAGCGGAGGAAGATACATTGTTTACACCATCCGGACTGGTGATCTCGAAGTGCGT
CGCCGCTACTCCGAGTTCGCATCGCTGAGAGATGCACTCACGCGCTTGCACCCTACACTCATCATCCCTCCCATC
CCCGAGAAGCACACCATGGCCGACTACGCGGCCAAGCCGACAAGCGCCAAGCAGGATCAGCAGATAATCGACTTG
CGGAAGCGCATGCTTGCCGTGTTTCTGAACCGCTGCCGACGGATGGAAGCTGTTCTGAACGATAACGTCTGGTGG
CGCTTTCTTGACCCCAACGCAAGCTGGAATGAAGTTTTGCACTCTCACCCTGTGGCATCGATTCCAAAGTCGGTA
CTCAAGGCGCCCCCTCTGGACACGGCCAATCCCACACCTGCGCACGCCTATTTGCCCGTCCCGGCGAGCTCGGCC
AAATTGAAGGCGACGGCAGGCACTAACCATGACATTACCGCTTCCGCCATCCAGGCTGGTATTCATGGTGTGCGA
CGCTTGCCACCGGAGAACAGTGACCGGGCCGAGCAGGATCTTGATCCGCATTTCATCGCATACGAGGCTTCGACA
AAGGAGTTGGAGCAGCTTCTCATGGGATCCATGGAAAAGGTCAATCGTCGGACCCTCAGTCACCTATCTTCCCTC
GCCACAGACTTGTGCGAACTAGGCTCGCGATACAACGCCTTTGCCCTATCTGAACAGGCACCTTCTCTCGGCACC
GCCATTGAGCGGGTGGGCCAGGCAGCCGACTTGTCGTACATTGCTACCGAAGAGTTGTCAGGGTCGTTGGGGGCC
ACATTCGCTGAGCCGATGCGGGAGAATGCGCAATTCACAGGCGTGGTCAAAAGCGTGCTGCGATACAGGGTCCTC
AAGCGGATACAGCAAGATCTGACGACGGAAGAGCTCCACAAGAAGAGGGCCCTGTTGGACCAGTTGGAACGCAGC
GAGTCGGAAGCCAGGCGCATCGAGCAGTATCTGTCTAGCAGTCAGCAGCTGTCTTCGCCGCCGAAGCGATCGGCG
AGTCTTAAGGAGTCCGCCTCGCAGAATCGGCGAGATGGCGCGCAGGAGGATACGGAATCGATCGACTCGGATTTC
CCCGCCACTCAGGGCGAGTTTCCTTCGCCACCGCCGTCTGCGAGCCAGGGACTGCCCGAGAGAAGCGTCAGTGTT
TCTCACAGGAAGATTCCAAGCGGCAACTCGATTACCAATAAGATCTTTGGCCCCATTCGCCATGCGGTGCAGGGA
GTCGTCGATGTTGATCCCGAGCGAACACGCCGAGACACTATCGGCAAGACGAGAGACTCTATCGTTCAACTGGAG
CAGGCCCAAATCGTGTCGGAGAAGGACGTCAAGGAGGCCAGTGCCAGCGTTCTGCAAGACATGAAGAGGTTCCAG
AAGGACAAGGAAGACGATCTGAAGCGCTACATGCTCGCATACGCCAAGGCTCATATTGAATGGGCCAAGAAAAGC
AAGCAGCAGTGGGAGGAGGCACGGGCTGAGGACGGCTCTCTACGCTCGCAGAGCACCCTGATCCTTTATGCCAGA
CGCCGTTCGACTGATCCAATCCTCCGGCACGACATGGACCAGCCTCCCGAGGGGCCGATCGGCTCCATCGCCGAG
CCAGGGCTCAAGGCCGAAGGGCCGCTGCTGTATTCGATGCGCAAAGAGGTGGCCGAGCTGTTGGGGCGTCACCAG
ACCAGCTTCCCTGGGGCGCAGCCCGTCAGCTTCGCGAGGCAGCATCTCGACGAGCTCACGAGACAAGATTATTAC
GTGTGCGAGAAGTCGGACGGCATTCGATACCTCCTCTACTCGACCCAGGACGAGACCGGCGGAGAGGCGCATTAC
CTGATCGACCGCAAGAACGATTATTGGTTCATCCACAATCGGAATCTTCATTTCCCTCTGGCAGACGATCTCAGC
GCTTTCCACACGGCGACGCTCGTCGACGGCGAGCTCGTGTGGGACAGTCTGTCGAGCGGCAAAAAGGAGCCGCGA
TTTCTCGTGTTTGATTGCCTGGTTATGGATGGGAACAAGCTCATGGATCGGACGCTGGATAAACGCCTGGCCTAC
TTCAACGAGCGGCTTTACACGCCCTACAACAAGTTGTTCAAAGAGTTTCCTGATGAACGTCAGTTTCAGCCGTTC
TTCGTCGACATGAAGCCTTTCCAGCTGGCGTACGGTATTGAGATGATGTTCAAGCAGGTTCTCCCAAGCCTCAAA
CATGGTAACGATGGTCTCATATTTACGTGTCGCAACACGCCCTATAAGCATGGCACGGATCCGCATATTTTAAAG
TGGAAACCTCCCGAGGAAAACACCATCGACTTCCGACTGAAGCTCATCTTTCCAACTGTCGAGCCAGACGAGCGG
GAGAGAAAAGAGGGGATCACGGAGCCCTTTGTCGACTACGACAGCGTGCCCAAGGCCGAGGTTCTAATATACAAG
GGAGACAGCGGTCCGGATCGGTACGAGGCCTTTAGCGACCTCTTTCTCTCCGAGGATGAGTGGGAGACGTTGAAG
GGTCTGGGTGATCCTCTCAACGAGCGCATTGTCGAGTGCAATCTCGATGAACAGGGTCGATGGAGGCTGGTGCGC
TTCCGGGACGATAAGAGCGAGGCAAACCACAAGAGCACGGTCCAGAGCGTTCTGGAGAGCATCAGCGACCGTGTC
TCGGAGAAGGACCTCTACAGAGCAGCGGGCCCCATCAGGGATAGCTGGAAAGCCCGTCAAGCCCGTGCTGATTCG
GAGAAGAAGCCCACGATGAAGATCAGTGGCCAGTGTGGCGACGCCGACGGCTCCATCGAGCCCGTCTCGAATCTC
AAGCGAAAGGTTTTCGGACCCAAGGCTGCTGCTATCACTGCCATGACTCTCATGGTCGCCGCCGTTCTTACCGCT
TTCCTTCTTCTGGTCACTCAGTGTGAACATGGCAACAACCCTCAGGGATCGGAACTCGCCCATGCTCAGCATATC
GTCTCTCAGGCCGCTCACCAGCTCGTCATCCGTGGCCAGGCCGGTGACACTGACGCCGTCTTTGGCGTTGCAGGT
AGCCCCATCGTCGCCAAAGTCGTCGGCCCCTCTGGAAGCGGTCTCGTCACTTCCATCATGGCCACTGGAACCTCT
GGTAGCCTTGGCGGTGCTGTGACTGCTCAGGAGCCCGACATCACCAAGACTATCACCATCGAGACTGCCAAGGAG
ATCGACGTCACCCAGACTGTCACGGTCCAGACTTCTCAGGAACAGTCTTCTCAGACCGTCGAGACTGTCACGACA
CCTCTGGGAGTCAGCGTCCCGATCTCGACCCAAACCGCCCTGTCGACCATCTACAGCATGTGGACTTCTGAGGAA
ACCGACTTCATCACCAAGACGACGACGGCCACTACCATCGTGACGCGTCACCTTCCCATGACGACTGAGGACGAA
GATGCTTGCGTCGATAGCACCGCCACCATGACCGTGTCCGTCTACGTCACCGTCTCTCCCGCTCCTGAAGAGACA
GTCACGGGCGACGCCTCAACCGTCACCGACGTCAGCACTGAGCTCTCCCTCACAAATGGCCTTCCGGATATCACT
CTCTCCGGCAAACCGTCTACCCAGACGGCGCTGCAGACCGACGTCTCTCTTACGACTGGCCTCCCCGATGCCACC
GTCTCCGGAGGCGGCGAGACCCAGACGGCCGTTCAGACTGTCGTCTCCCTGACTCCCGGTCTCCCGGATGCCACT
GTAACGGGAAATCCCTCGACCGTCTCCAACGTCGTGTCCAGCACCGTCTCGCGGTCCGTCGTCTCCATCTTCACC
ACCGTCGTCATCACCGACTTCTGGGGCACCTTCAGCCCGTCGTCTCAGACCTCCACCGCGACGCCGACGATTTCG
TCCAACGAAGCCACCCTGACCATCACCGTCACCGTGTCTGACCTGGAGAACAACGGGCAGGGAGCCACCGCCAGC
GCCTCTGATGTCTCCTCCGTCCTGGCAGACTTCACCACCGAGTCATCTCCTTTCGCCTACACCAAGACGGAGACG
GTGACCATGACCAAGGACGTCGTCACCAGCGCCACCTCGCTCTCCACCACGCTGCGCATGCCTCCCATCGGCAAC
GCCACCACGGGCGGCATGCCCGCCTGGACGTCGGCGGCTGACGTGCCCGTCGTCGTGTCCGAGGGCGCCAAGAAG
CCCGAGCCCAAGGCTTGGGGCATCGGCAAGGGCTACGGCAACATTGGTTGCACCGTCATGCTCATTGCCATCATC
ATGCTGGTGCTCTGA
Gene >Ophun1|5690
ATGTGGAACGACGAGGACAATAATCCTTACGGCACCAGCTTTGATCGTCGCGACTCGCAGACCTCGTCTTCTGCG
AATCCCATGTCGCCCACCTCCCATGACTGTAGGATCGCCACTCGCTTTTTGGAAAACACAGCTGACACCGAGTGA
AGTTCGCGCATTTGAAACACTTGATACGCCGACGGGTAGCGACGATGATCAGACCACCTTTCGCAATAGTGCCGT
TCATGAGGACCCTCAAGAGAGGCCCGAGGTCGAAGACGCTGCCCCCAGGCGGAAACCTGGCGGATACAACAGCCG
TATAGAGCAGATCCTTTACGAAAACCCAGACATGCCCATCACCATCACCGATGCTGGCAAGAGTCTGGAAAGCGG
AGGAAGATACATTGTTTACACCATCCGGACTGGTGTAAGGCTTCCGTGACATGCCCCGCGCATCTGTGCTCACTG
TCTCTTTCAGGATCTCGAAGTGCGTCGCCGCTACTCCGAGTTCGCATCGCTGAGAGATGCACTCACGCGCTTGCA
CCCTACACTCATCATCCCTCCCATCCCCGAGAAGCACACCATGGCCGACTACGCGGCCAAGCCGACAAGCGCCAA
GCAGGATCAGCAGATAATCGACTTGCGGAAGCGCATGCTTGCCGTGTTTCTGAACCGCTGCCGACGGATGGAAGC
TGTTCTGAACGATAACGTCTGGTGGCGCTTTCTTGACCCCAACGCAAGCTGGGTTTGTGCAGCCTCCGCGAGAAG
CAACTCGTCTCAATACTGAAACTCAAACCAGAATGAAGTTTTGCACTCTCACCCTGTGGCATCGATTCCAAAGTC
GGTACTCAAGGCGCCCCCTCTGGACACGGCCAATCCCACACCTGCGCACGCCTATTTGCCCGTCCCGGCGAGCTC
GGCCAAATTGAAGGCGACGGCAGGCACTAACCATGACATTACCGCTTCCGCCATCCAGGCTGGTATTCATGGTGT
GCGACGCTTGCCACCGGAGAACAGTGACCGGGCCGAGCAGGATCTTGATCCGCATTTCATCGCATACGAGGCTTC
GACAAAGGAGTTGGAGCAGCTTCTCATGGGATCCATGGAAAAGGTCAATCGTCGGACCCTCAGTCACCTATCTTC
CCTCGCCACAGACTTGTGCGAACTAGGCTCGCGATACAACGCCTTTGCCCTATCTGAACAGGCACCTTCTCTCGG
CACCGCCATTGAGCGGGTGGGCCAGGCAGCCGACTTGTCGTACATTGCTACCGAAGAGTTGTCAGGGTCGTTGGG
GGCCACATTCGCTGAGCCGATGCGGGAGAATGCGCAATTCACAGGCGTGGTCAAAAGCGTGCTGCGATACAGGGT
CCTCAAGCGGATACAGCAAGATCTGACGACGGAAGAGCTCCACAAGAAGAGGGCCCTGTTGGACCAGTTGGAACG
CAGCGAGTCGGAAGCCAGGCGCATCGAGCAGTATCTGTCTAGCAGTCAGCAGCTGTCTTCGCCGCCGAAGCGATC
GGCGAGTCTTAAGGAGTCCGCCTCGCAGAATCGGCGAGATGGCGCGCAGGAGGATACGGAATCGATCGACTCGGA
TTTCCCCGCCACTCAGGGCGAGTTTCCTTCGCCACCGCCGTCTGCGAGCCAGGGACTGCCCGAGAGAAGCGTCAG
TGTTTCTCACAGGAAGATTCCAAGCGGCAACTCGATTACCAATAAGATCTTTGGCCCCATTCGCCATGCGGTGCA
GGGAGTCGTCGATGTTGATCCCGAGCGAACACGCCGAGACACTATCGGCAAGACGAGAGACTCTATCGTTCAACT
GGAGCAGGCCCAAATCGTGTCGGAGAAGGACGTCAAGGAGGCCAGTGCCAGCGTTCTGCAAGACATGAAGAGGTT
CCAGAAGGACAAGGAAGACGATCTGAAGCGCTACATGGTGAGCAGTCACGCCAGTGCCGTAACACGAAGCGGGAC
AGTACTGATGGTTTTAACAGCTCGCATACGCCAAGGCTCATATTGAATGGGCCAAGAAAAGCAAGCAGCAGTGGG
AGGAGGCACGGGCTGAGGTGGACAAGATAGACGAAACCTAGGCACGGCTTGCGGCCGCAATGCAGGCGCACAGGA
CGGCTCTCTACGCTCGCAGGTACGGGGTGTTTGCTACGCGCAGATAGTTCGTAGCAGAGCATGTATAGAATTGAG
TCGTCTCTTGACGCTGAATGCGAGATATCGAGTGTCGTGTTGAAGAGGACGTACCTACGGAGGCAGAGCGGGAAG
AATGCAGGAGAAGTTTTTGATATTGTCCAAGAGTGTCTGACGTAGGTAGTCGTCTATTCGAAGTACGATGACTCG
TTGATGAGACCCAAATAGGCCATGAATGACGATCCACAGGCGGAGAGAGCCGTCGTCATCGTTGGGAAGGCAATT
GGTCGTCCTGGTGGAAATCCTTATCGATAAGATAAGCGTGCGAAGCACATGGACGCCCGGCCCCAGACCACCAAC
CAACAGATGTTCACGAGGCCCGGCAGGGTTGGACTTTATTGTTGACTCATGTGCCTATAAACATGACTCTACGTG
CTGCTTTCTAGTTTCCAGAGCACCCTGATCCTTTGTGAGTCTTGCCTTGAGCGAGAAGCCGTTCCGGCGCTGACT
CTTTCGCCAGATGCCAGACGCCGTTCGACTGATCCAATCCTCCGGCACGACATGGACCAGCCTCCCGAGGGGCCG
ATCGGCTCCATCGCCGAGCCAGGGCTCAAGGCCGAAGGGCCGCTGCTGTATTCGATGCGCAAAGAGGTGGCCGAG
CTGTTGGGGCGTCACCAGACCAGCTTCCCTGGGGCGCAGCCCGTCAGCTTCGCGAGGCAGCATCTCGACGAGCTC
ACGAGACAAGAGTACGATGCAGCGTCCTCCAGATCCACGTTGGATGATACTGATAGAGTGCCAGTTATTACGTGT
GCGAGAAGTCGGACGGCATTCGATACCTCCTCTACTCGACCCAGGACGAGACCGGCGGAGAGGCGCATTACCTGA
TCGACCGCAAGAACGATTATTGGTTCATCCACAATCGGAATCTTCATTTCCCTCTGGCAGACGATCTCAGCGCTT
TCCACACGGCGACGCTCGTCGACGGCGAGCTCGTGTGGGACAGTCTGTCGAGCGGCAAAAAGGAGCCGCGATTTC
TCGTGTTTGATTGCCTGGTTATGGATGGGAACAAGCTCATGGATCGGACGCTGGATAAACGCCTGGCCTACTTCA
ACGAGCGGCTTTACACGCCCTACAACAAGTTGTTCAAAGAGTTTCCTGATGAACGTCAGTTTCAGCCGTTCTTCG
TCGACATGAAGCCTTTCCAGCTGGCGTACGGTATTGAGATGATGTTCAAGCAGGTTCTCCCAAGCCTCAAACATG
GTAACGATGGTCTCATATTTACGTGTCGCAACACGCCCTATAAGCATGGCACGGATCCGCATATTTTAAAGTGGA
AACCTCCCGAGGAAAACACCATCGACTTCCGACTGAAGCTCATCTTTCCAACTGTCGAGCCAGACGAGCGGGAGA
GAAAAGAGGGGATCACGGAGCCCTTTGTCGACTACGACAGCGTGCCCAAGGCCGAGGTTCTAATATACAAGGGAG
ACAGCGGTCCGGATCGGTACGAGGCCTTTAGCGACCTCTTTCTCTCCGAGGATGAGTGGGAGACGTTGAAGGGTC
TGGGTGATCCTCTCAACGAGCGCATTGTCGAGTGCAATCTCGATGAACAGGGTCGATGGAGGCTGGTGCGCTTCC
GGGACGATAAGAGCGAGGCAAACCACAAGAGCACGGTCCAGAGCGTTCTGGAGAGCATCAGCGACCGTGTCTCGG
AGAAGGACCTCTACAGAGCAGCGGGCCCCATCAGGGATAGCTGGAAAGCCCGTCAAGCCCGTGCTGATTCGGAGA
GTAGGCGTGGGAGGTAGTCGGTGTAGGGTCACACCCAGATAGGTATGAAATCGAAGCCTAGCCGACACCGCAAGC
AGCCTTGAAAAGTGAACGCTCGCACACACGGCTGGCTGGGTCTCGGCAGCGGCACATATTGGGACGTAGCACGAA
CTGGACATGACTGGGGCTCGCCGCGTCGCACACGTTCCATACCCAGAATCCCCTTCATTTCCGGCCGCGGAGTTG
AACGGCTAGGCTGCACTCCGCCGCCGTCGTTGGACAGCAATGGGAGGATGGTAGTATGCATCTGAAGAATTTACT
TGTGTGCGTCTGAGGGGGAATATGGGGGAGGTCGCCTTATATTTTGCGTCGTTTGGCGGTCTGGCTGTGAGCTGG
GTGGTGGATAGGGGCTGATATCGTCGTCTCAACGCCTCACAACTGTCGTCTCTTGCTATACCGCCCTTTGCAAAC
CAGTGACGGGATGGAATACTCGTGTCACGTTTCTTCTTCTATCTCTGTCTAGGTATCAAGTAGGTAGTGGACTTG
GACTCTCAGGCTGCCATCTGCCAGCATCCCCACGAGCAAGCTCCTTCATCCGCCCTTGGCCTCGGTTCTTCCCAA
AGCCATCTATTCCTATATAGAGACGCAATAATCAGTAGAAAAAGACATGTATGCCGCTGTATCCCCCCCTTCGTC
GTCCAAGATGTGCACAGCAAAAGGCTGCCCACTGACGCGAGCTGCCAGCTGCCCACCTCGCGTCCAACGCGTCTC
CCTAATAGCCGTGATTCACAGCTGCCTGCAGCACGCGTTTTTCTTTCTGCCTGATTTTTCAGAGAGCAAAAAAAA
AAATTTCACACCCCGGCCACACACAATATCTTGTTGCCCCTCCCCCCTGCAAATCTCCCCCTCTTCTCTTCACCG
CAACCACAACTCACCGTCTACGTTCCTTCTCGCGGCCTTCGAAACATCTCATCCCGTCTTTACCGACTCAAGCAA
GCCTTCACTTCATCAGTTCCGTTGTACGTTGTTTTCCCCTTTGCTGCTGCGTGCCGGTTTCTCGTGTGGCACATC
GCACCAGCAGGGCAAACACCATCGTCGTCCTCTTTCTCATCATAATTTCTTTCGCAGAACTTGATTCGAGTTTTC
ATCCTTTCATCACATCACCCACTCTCTCTTCAGACGTCGTATGCTAGCCCCCCCTTTCACTGCCCTAGACGAGTT
TCCAGCTTGCTAACCTTGATCCTCAGAGAAGCCCACGATGAAGATCAGTGGCCAGTGTGGCGACGCCGACGGCTC
CATCGAGCCCGTCTCGAATCTCAAGCGAAAGGTTTTCGGACCCAAGGCTGCTGCTATCACTGCCATGACTCTCAT
GGTCGCCGCCGTTCTTACCGCTTTCCTTCTTCTGGTCACTCAGTGTGGTTCGTCTTCCTGGGACTGCTTCTTTCG
AGTCTCCCATCCTCTCATGCTGACCTCGACCTACTCAGAACATGGCAACAACCCTCAGGGATCGGAACTCGCCCA
TGCTCAGCATATCGTCTCTCAGGCCGCTCACCAGCTCGTCATCCGTGGCCAGGCCGGTGACACTGACGCCGTCTT
TGGCGTTGCAGGTAGCCCCATCGTCGCCAAAGTCGTCGGCCCCTCTGGAAGCGGTCTCGTCACTTCCATCATGGC
CACTGGAACCTCTGGTAGCCTTGGCGGTGCTGTGACTGCTCAGGAGCCCGACATCACCAAGACTATCACCATCGA
GACTGCCAAGGAGATCGACGTCACCCAGACTGTCACGGTCCAGACTTCTCAGGAACAGTCTTCTCAGACCGTCGA
GACTGTCACGACACCTCTGGGAGTCAGCGTCCCGATCTCGTAAGCCCATCCCTCTCACCAAACACTTACCTTGCT
TGCTAACAAAGGTCAGGACCCAAACCGCCCTGTCGACCATCTACAGCATGTGGACTTCTGAGGAAACCGACTTCA
TCACCAAGACGACGACGGCCACTACCATCGTGACGCGTCACCTTCCCATGACGACTGAGGACGAAGATGCTTGCG
TCGATAGCACCGCCACCATGACCGTGTCCGTCTACGTCACCGTCTCTCCCGCTCCTGAAGAGACAGTCACGGGCG
ACGCCTCAACCGTCACCGACGTCAGCACTGAGCTCTCCCTCACAAATGGCCTTCCGGATATCACTCTCTCCGGCA
AACCGTCTACCCAGACGGCGCTGCAGACCGACGTCTCTCTTACGACTGGCCTCCCCGATGCCACCGTCTCCGGAG
GCGGCGAGACCCAGACGGCCGTTCAGACTGTCGTCTCCCTGACTCCCGGTCTCCCGGATGCCACTGTAACGGGAA
ATCCCTCGACCGTCTCCAACGTCGTGTCCAGCACCGTCTCGCGGTCCGTCGTCTCCATCTTCACCACCGTCGTCA
TCACCGACTTCTGGGGCACCTTCAGCCCGTCGTCTCAGACCTCCACCGCGACGCCGACGATTTCGTCCAACGAAG
CCACCCTGACCATCACCGTCACCGTGTCTGACCTGGAGAACAACGGGCAGGGAGCCACCGCCAGCGCCTCTGATG
TCTCCTCCGTCCTGGCAGACTTCACCACCGAGTCATCTCCTTTCGCCTACACCAAGACGGAGACGGTGACCATGA
CCAAGGACGTCGTCACCAGCGCCACCTCGCTCTCCACCACGCTGCGCATGCCTCCCATCGGCAACGCCACCACGG
GCGGCATGCCCGCCTGGACGTCGGCGGCTGACGTGCCCGTCGTCGTGTCCGAGGGCGCCAAGAAGCCCGAGCCCA
AGGCTTGGGGCATCGGCAAGGGCTACGGCAACATTGGTTGCACCGTCATGCTCATTGCCATCATCATGCTGGTGC
TCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail