Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5679
Gene name
LocationContig_578:4769..8036
Strand+
Gene length (bp)3267
Transcript length (bp)3156
Coding sequence length (bp)3156
Protein length (aa) 1052

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11923 NFACT-C NFACT protein C-terminal domain 9.9E-42 915 1022
PF05670 NFACT-R_1 NFACT protein RNA binding domain 5.9E-31 547 659
PF05833 NFACT_N NFACT N-terminal and middle domains 2.7E-27 7 543

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN8|RQC2_SCHPO Ribosome quality control complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr1 PE=1 SV=2 1 693 7.0E-155
sp|Q12532|RQC2_YEAST Ribosome quality control complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RQC2 PE=1 SV=1 1 1025 6.0E-150
sp|O60524|NEMF_HUMAN Nuclear export mediator factor NEMF OS=Homo sapiens GN=NEMF PE=1 SV=4 1 1021 3.0E-148
sp|Q8CCP0|NEMF_MOUSE Nuclear export mediator factor Nemf OS=Mus musculus GN=Nemf PE=1 SV=2 1 829 8.0E-134
sp|Q9VBX1|NEMF_DROME Nuclear export mediator factor NEMF homolog OS=Drosophila melanogaster GN=Clbn PE=1 SV=2 1 1021 9.0E-123
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN8|RQC2_SCHPO Ribosome quality control complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr1 PE=1 SV=2 1 693 7.0E-155
sp|Q12532|RQC2_YEAST Ribosome quality control complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RQC2 PE=1 SV=1 1 1025 6.0E-150
sp|O60524|NEMF_HUMAN Nuclear export mediator factor NEMF OS=Homo sapiens GN=NEMF PE=1 SV=4 1 1021 3.0E-148
sp|Q8CCP0|NEMF_MOUSE Nuclear export mediator factor Nemf OS=Mus musculus GN=Nemf PE=1 SV=2 1 829 8.0E-134
sp|Q9VBX1|NEMF_DROME Nuclear export mediator factor NEMF homolog OS=Drosophila melanogaster GN=Clbn PE=1 SV=2 1 1021 9.0E-123
sp|Q59020|Y1625_METJA Uncharacterized protein MJ1625 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1625 PE=4 SV=1 540 677 9.0E-21
sp|Q8CCP0|NEMF_MOUSE Nuclear export mediator factor Nemf OS=Mus musculus GN=Nemf PE=1 SV=2 810 1021 4.0E-09
sp|Q59020|Y1625_METJA Uncharacterized protein MJ1625 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1625 PE=4 SV=1 1 134 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5679
MKQRFSSLDVKVIAHELNQHLATLRVSNIYDLSSKILLFKFAKPDCKKQLIIDSGFRCHLTEFARTTAAAPSVFV
TQLRKFVKTRRVTSVAQIGTDRVLEFQFSDGQYRLFLEFFASGNIILTNADLDILTIARNVPEGAGQEPQRVGLK
YLLENRQNYQGIPALTAQRVRSALESAVQRAAAASDAVEKPKGKSAANLRKSLAVSITELPPIIVHHTLQSNDFD
LTAKPEDILQNDALLERLVRLLSEAREKVQEITSAPVCTGYIFAKRKDKQAADGDAPVKREDLLYDDFHPFIPAM
LGNDPAIKVLEFSGYNQTVDEFFSSLEGQKLESRLNQREETAKRKLEAARKDQAKRLEGLQEAQSLNFRRAAAIE
ANVERVQEAMDAINGLVAQGMDWIDIGKLVERERKKKNAVAEIIVLPLNLAENLMTLKLAEAKTEADEEPDPFET
DDEGSSEGEEAASAPSKAKQAEKYLTVDINLGISPWSNAREYYDQRRSAAAKEEKTQLQTAKAMKNAEQKISEDL
KKGLKQEKALLQPIRQQMWFEKFIWFLSSDGYLVLGGKDAGQNEMLYRKYLRKGDVYCHADLRGAATVIIKNDPK
TPEAPIPPATLSQAGSLAVCSSEAWDSKAGMGAWWVNADQVSKSAATGDFLSEGNFTVQGKKNHLAPAQLLLGFG
IMFRISEASKDRHVKHRLNDGDAGGADQKEQKKPNPLLEGEVVGAAEDVAEQEDDDSLSDLQSEEDEDRHESGRD
NPLQTRGPGGGDDDDAAADRGEMSEPDVANLAIEADAEQDQGADEAENEGQDRSELTMEAETVSTTTSTSRPSAK
APPKRGQKGKAKKMANKYKDQDDEDRAAAEALIGAAAGKQKAEAEAKARAEAKAQLEAAKERRRAQHQRQQRETA
AHEQARRNMMEQDSAEAMTDLDALVGTPLPGDEVLEAIAVCAPWIALGKFKYKAKMQPGATKKGKAVREVLDRWR
ADSGKKGAVDEAARDVEKMWPREVELIKGLKTEEVVNVVPVGKVKVMMAGGGAKGKAGGGAKGQGKGGRGGKGSK
R*
Coding >Ophun1|5679
ATGAAGCAACGGTTCTCGTCACTGGATGTCAAGGTCATCGCCCACGAGCTCAACCAGCACCTGGCAACGCTGCGA
GTCTCCAACATCTACGACCTGTCGTCCAAGATCCTGCTCTTCAAGTTCGCCAAGCCCGACTGCAAGAAGCAACTC
ATCATCGACTCTGGCTTTCGATGCCACCTGACCGAGTTTGCCCGTACCACGGCCGCCGCACCCTCCGTCTTCGTC
ACTCAGTTGCGCAAGTTTGTCAAGACGAGGCGCGTCACGTCCGTGGCCCAGATAGGGACGGATAGAGTTCTCGAG
TTTCAATTCAGCGACGGACAGTACCGACTGTTTCTCGAGTTCTTTGCTAGCGGAAATATCATCCTTACAAATGCC
GACCTGGACATTCTAACTATCGCGCGCAATGTTCCTGAAGGTGCCGGCCAAGAGCCGCAAAGGGTCGGTCTCAAA
TACTTGCTTGAAAACCGGCAAAACTACCAGGGCATTCCCGCCTTGACCGCGCAACGAGTCCGCTCGGCTTTGGAG
TCTGCCGTCCAAAGGGCTGCGGCTGCTTCCGATGCGGTGGAGAAACCAAAAGGAAAGTCGGCGGCCAACTTGAGG
AAGAGCCTCGCCGTATCAATCACCGAGTTGCCTCCCATTATCGTCCACCACACCCTCCAATCCAACGACTTCGAC
CTGACGGCCAAGCCAGAGGATATACTGCAAAACGATGCGCTACTGGAGAGGCTGGTTCGACTCCTATCGGAAGCA
CGGGAAAAAGTCCAGGAGATTACATCGGCCCCCGTCTGCACAGGGTACATCTTTGCGAAGCGCAAGGACAAGCAA
GCGGCCGATGGCGACGCTCCTGTCAAAAGAGAAGACTTGCTCTATGATGATTTCCATCCTTTTATTCCGGCTATG
CTAGGCAACGACCCTGCCATCAAGGTACTGGAGTTTTCTGGCTACAATCAGACGGTAGACGAGTTCTTCTCCTCA
TTGGAGGGCCAGAAACTCGAAAGCCGTCTAAACCAGCGAGAAGAGACGGCCAAGCGGAAGCTCGAGGCCGCCAGG
AAGGACCAGGCCAAGCGGTTAGAGGGCCTTCAGGAAGCGCAGTCGTTGAATTTCCGACGAGCCGCCGCCATCGAG
GCCAATGTCGAGCGCGTACAAGAAGCCATGGACGCTATCAACGGCCTGGTGGCCCAAGGCATGGACTGGATAGAC
ATTGGGAAATTGGTCGAGAGGGAGCGGAAGAAGAAGAATGCCGTGGCCGAGATAATCGTGCTGCCACTCAACCTT
GCAGAGAATCTCATGACGCTCAAGCTGGCCGAGGCCAAAACCGAGGCCGACGAAGAACCAGACCCGTTCGAGACG
GACGACGAAGGTTCCTCAGAGGGTGAGGAGGCTGCATCGGCTCCATCCAAGGCCAAGCAGGCCGAAAAGTACCTC
ACTGTCGATATCAACCTGGGCATCAGTCCCTGGAGCAACGCGAGAGAGTACTACGATCAAAGACGGTCGGCCGCG
GCCAAGGAGGAGAAGACGCAGCTTCAGACGGCCAAGGCGATGAAGAATGCCGAGCAAAAGATCAGCGAGGATCTC
AAAAAGGGGTTGAAGCAGGAAAAGGCGCTGCTACAGCCCATCAGACAGCAGATGTGGTTCGAGAAGTTCATCTGG
TTCCTCTCGTCCGACGGCTACCTCGTCCTCGGCGGCAAGGACGCAGGACAGAACGAGATGCTGTACCGCAAATAT
CTGCGGAAAGGCGACGTCTACTGCCATGCAGACTTACGCGGAGCGGCCACCGTCATCATCAAGAACGACCCGAAG
ACACCCGAGGCACCGATACCGCCAGCGACTTTATCTCAGGCCGGCTCGCTCGCTGTCTGTTCATCGGAAGCGTGG
GATTCCAAGGCCGGAATGGGTGCCTGGTGGGTGAACGCCGACCAAGTGTCCAAGTCGGCTGCAACAGGGGACTTT
CTGTCAGAGGGAAACTTTACGGTGCAGGGCAAGAAGAACCATCTGGCCCCGGCACAGCTTCTACTTGGCTTCGGC
ATCATGTTCAGGATCAGCGAGGCGAGCAAGGACCGGCACGTCAAACACCGATTAAACGATGGCGACGCAGGCGGA
GCGGATCAGAAGGAGCAGAAAAAGCCAAACCCCCTACTAGAAGGCGAGGTTGTTGGAGCAGCTGAGGATGTGGCG
GAACAAGAGGATGACGACTCCTTGTCGGATTTACAGTCTGAAGAGGACGAAGACCGACATGAATCTGGGCGTGAT
AACCCTCTGCAGACACGAGGCCCGGGAGGTGGCGATGATGACGATGCGGCTGCGGATCGAGGCGAAATGTCGGAG
CCTGACGTCGCAAACCTGGCCATTGAAGCCGACGCCGAACAAGACCAGGGCGCAGACGAGGCTGAGAATGAAGGC
CAGGATCGATCCGAGCTGACGATGGAAGCCGAGACGGTATCAACAACCACATCGACATCGCGGCCCAGCGCCAAG
GCACCCCCCAAGCGTGGCCAGAAGGGCAAGGCCAAGAAGATGGCCAACAAGTACAAGGATCAAGACGACGAGGAC
CGGGCCGCGGCCGAGGCGCTCATCGGGGCGGCAGCGGGCAAGCAAAAGGCCGAAGCTGAAGCCAAGGCACGGGCC
GAAGCCAAGGCGCAGCTCGAAGCAGCCAAGGAGCGACGACGGGCTCAGCACCAGCGGCAGCAGAGAGAGACGGCG
GCGCACGAGCAGGCACGACGCAACATGATGGAACAGGACTCGGCCGAAGCGATGACGGATCTCGACGCGCTGGTA
GGCACGCCGCTGCCAGGAGACGAGGTGCTGGAGGCGATTGCGGTATGCGCCCCCTGGATCGCCCTCGGAAAGTTC
AAGTACAAGGCCAAGATGCAGCCCGGGGCGACGAAGAAGGGCAAGGCCGTCAGGGAGGTGCTGGACCGGTGGCGG
GCCGATTCGGGCAAGAAAGGGGCCGTCGACGAGGCAGCGAGGGACGTGGAGAAGATGTGGCCTCGAGAGGTGGAG
CTCATCAAGGGGCTCAAGACGGAGGAGGTCGTCAACGTGGTGCCTGTGGGTAAGGTCAAGGTCATGATGGCGGGC
GGAGGCGCCAAGGGCAAGGCTGGCGGTGGTGCCAAGGGACAGGGTAAAGGAGGTCGAGGAGGGAAGGGTTCCAAG
AGGTGA
Transcript >Ophun1|5679
ATGAAGCAACGGTTCTCGTCACTGGATGTCAAGGTCATCGCCCACGAGCTCAACCAGCACCTGGCAACGCTGCGA
GTCTCCAACATCTACGACCTGTCGTCCAAGATCCTGCTCTTCAAGTTCGCCAAGCCCGACTGCAAGAAGCAACTC
ATCATCGACTCTGGCTTTCGATGCCACCTGACCGAGTTTGCCCGTACCACGGCCGCCGCACCCTCCGTCTTCGTC
ACTCAGTTGCGCAAGTTTGTCAAGACGAGGCGCGTCACGTCCGTGGCCCAGATAGGGACGGATAGAGTTCTCGAG
TTTCAATTCAGCGACGGACAGTACCGACTGTTTCTCGAGTTCTTTGCTAGCGGAAATATCATCCTTACAAATGCC
GACCTGGACATTCTAACTATCGCGCGCAATGTTCCTGAAGGTGCCGGCCAAGAGCCGCAAAGGGTCGGTCTCAAA
TACTTGCTTGAAAACCGGCAAAACTACCAGGGCATTCCCGCCTTGACCGCGCAACGAGTCCGCTCGGCTTTGGAG
TCTGCCGTCCAAAGGGCTGCGGCTGCTTCCGATGCGGTGGAGAAACCAAAAGGAAAGTCGGCGGCCAACTTGAGG
AAGAGCCTCGCCGTATCAATCACCGAGTTGCCTCCCATTATCGTCCACCACACCCTCCAATCCAACGACTTCGAC
CTGACGGCCAAGCCAGAGGATATACTGCAAAACGATGCGCTACTGGAGAGGCTGGTTCGACTCCTATCGGAAGCA
CGGGAAAAAGTCCAGGAGATTACATCGGCCCCCGTCTGCACAGGGTACATCTTTGCGAAGCGCAAGGACAAGCAA
GCGGCCGATGGCGACGCTCCTGTCAAAAGAGAAGACTTGCTCTATGATGATTTCCATCCTTTTATTCCGGCTATG
CTAGGCAACGACCCTGCCATCAAGGTACTGGAGTTTTCTGGCTACAATCAGACGGTAGACGAGTTCTTCTCCTCA
TTGGAGGGCCAGAAACTCGAAAGCCGTCTAAACCAGCGAGAAGAGACGGCCAAGCGGAAGCTCGAGGCCGCCAGG
AAGGACCAGGCCAAGCGGTTAGAGGGCCTTCAGGAAGCGCAGTCGTTGAATTTCCGACGAGCCGCCGCCATCGAG
GCCAATGTCGAGCGCGTACAAGAAGCCATGGACGCTATCAACGGCCTGGTGGCCCAAGGCATGGACTGGATAGAC
ATTGGGAAATTGGTCGAGAGGGAGCGGAAGAAGAAGAATGCCGTGGCCGAGATAATCGTGCTGCCACTCAACCTT
GCAGAGAATCTCATGACGCTCAAGCTGGCCGAGGCCAAAACCGAGGCCGACGAAGAACCAGACCCGTTCGAGACG
GACGACGAAGGTTCCTCAGAGGGTGAGGAGGCTGCATCGGCTCCATCCAAGGCCAAGCAGGCCGAAAAGTACCTC
ACTGTCGATATCAACCTGGGCATCAGTCCCTGGAGCAACGCGAGAGAGTACTACGATCAAAGACGGTCGGCCGCG
GCCAAGGAGGAGAAGACGCAGCTTCAGACGGCCAAGGCGATGAAGAATGCCGAGCAAAAGATCAGCGAGGATCTC
AAAAAGGGGTTGAAGCAGGAAAAGGCGCTGCTACAGCCCATCAGACAGCAGATGTGGTTCGAGAAGTTCATCTGG
TTCCTCTCGTCCGACGGCTACCTCGTCCTCGGCGGCAAGGACGCAGGACAGAACGAGATGCTGTACCGCAAATAT
CTGCGGAAAGGCGACGTCTACTGCCATGCAGACTTACGCGGAGCGGCCACCGTCATCATCAAGAACGACCCGAAG
ACACCCGAGGCACCGATACCGCCAGCGACTTTATCTCAGGCCGGCTCGCTCGCTGTCTGTTCATCGGAAGCGTGG
GATTCCAAGGCCGGAATGGGTGCCTGGTGGGTGAACGCCGACCAAGTGTCCAAGTCGGCTGCAACAGGGGACTTT
CTGTCAGAGGGAAACTTTACGGTGCAGGGCAAGAAGAACCATCTGGCCCCGGCACAGCTTCTACTTGGCTTCGGC
ATCATGTTCAGGATCAGCGAGGCGAGCAAGGACCGGCACGTCAAACACCGATTAAACGATGGCGACGCAGGCGGA
GCGGATCAGAAGGAGCAGAAAAAGCCAAACCCCCTACTAGAAGGCGAGGTTGTTGGAGCAGCTGAGGATGTGGCG
GAACAAGAGGATGACGACTCCTTGTCGGATTTACAGTCTGAAGAGGACGAAGACCGACATGAATCTGGGCGTGAT
AACCCTCTGCAGACACGAGGCCCGGGAGGTGGCGATGATGACGATGCGGCTGCGGATCGAGGCGAAATGTCGGAG
CCTGACGTCGCAAACCTGGCCATTGAAGCCGACGCCGAACAAGACCAGGGCGCAGACGAGGCTGAGAATGAAGGC
CAGGATCGATCCGAGCTGACGATGGAAGCCGAGACGGTATCAACAACCACATCGACATCGCGGCCCAGCGCCAAG
GCACCCCCCAAGCGTGGCCAGAAGGGCAAGGCCAAGAAGATGGCCAACAAGTACAAGGATCAAGACGACGAGGAC
CGGGCCGCGGCCGAGGCGCTCATCGGGGCGGCAGCGGGCAAGCAAAAGGCCGAAGCTGAAGCCAAGGCACGGGCC
GAAGCCAAGGCGCAGCTCGAAGCAGCCAAGGAGCGACGACGGGCTCAGCACCAGCGGCAGCAGAGAGAGACGGCG
GCGCACGAGCAGGCACGACGCAACATGATGGAACAGGACTCGGCCGAAGCGATGACGGATCTCGACGCGCTGGTA
GGCACGCCGCTGCCAGGAGACGAGGTGCTGGAGGCGATTGCGGTATGCGCCCCCTGGATCGCCCTCGGAAAGTTC
AAGTACAAGGCCAAGATGCAGCCCGGGGCGACGAAGAAGGGCAAGGCCGTCAGGGAGGTGCTGGACCGGTGGCGG
GCCGATTCGGGCAAGAAAGGGGCCGTCGACGAGGCAGCGAGGGACGTGGAGAAGATGTGGCCTCGAGAGGTGGAG
CTCATCAAGGGGCTCAAGACGGAGGAGGTCGTCAACGTGGTGCCTGTGGGTAAGGTCAAGGTCATGATGGCGGGC
GGAGGCGCCAAGGGCAAGGCTGGCGGTGGTGCCAAGGGACAGGGTAAAGGAGGTCGAGGAGGGAAGGGTTCCAAG
AGGTGA
Gene >Ophun1|5679
ATGAAGCAACGGTTCTCGTCACTGGATGTCAAGGTACTCGGCGTCACGACCGTCCTCATACCGCCACTGGCTGAC
GGCCCTCGTTTCAGGTCATCGCCCACGAGCTCAACCAGCACCTGGCAACGCTGCGAGTCTCCAACATCTACGACC
TGTCGTCCAAGATCCTGCTCTTCAAGTTCGCCAAGCCCGACTGCAAGAAGCAACTCATCATCGACTCTGGCTTTC
GATGCCACCTGACCGAGTTTGCCCGTACCACGGCCGCCGCACCCTCCGTCTTCGTCACTCAGTTGCGCAAGTTTG
TCAAGACGAGGCGCGTCACGTCCGTGGCCCAGATAGGGACGGATAGAGTTCTCGAGTTTCAATTCAGCGACGGAC
AGTACCGACTGTTTCTCGAGTTCTTTGCTGTGAGCGGTGTTCTCTGGCTGGCGGCTGTCTGTTCCAGGCTGATGC
GCATGGCAGAGCGGAAATATCATCCTTACAAATGCCGACCTGGACATTCTAACTATCGCGCGCAATGTTCCTGAA
GGTGCCGGCCAAGAGCCGCAAAGGGTCGGTCTCAAATACTTGCTTGAAAACCGGCAAAACTACCAGGGCATTCCC
GCCTTGACCGCGCAACGAGTCCGCTCGGCTTTGGAGTCTGCCGTCCAAAGGGCTGCGGCTGCTTCCGATGCGGTG
GAGAAACCAAAAGGAAAGTCGGCGGCCAACTTGAGGAAGAGCCTCGCCGTATCAATCACCGAGTTGCCTCCCATT
ATCGTCCACCACACCCTCCAATCCAACGACTTCGACCTGACGGCCAAGCCAGAGGATATACTGCAAAACGATGCG
CTACTGGAGAGGCTGGTTCGACTCCTATCGGAAGCACGGGAAAAAGTCCAGGAGATTACATCGGCCCCCGTCTGC
ACAGGGTACATCTTTGCGAAGCGCAAGGACAAGCAAGCGGCCGATGGCGACGCTCCTGTCAAAAGAGAAGACTTG
CTCTATGATGATTTCCATCCTTTTATTCCGGCTATGCTAGGCAACGACCCTGCCATCAAGGTACTGGAGTTTTCT
GGCTACAATCAGACGGTAGACGAGTTCTTCTCCTCATTGGAGGGCCAGAAACTCGAAAGCCGTCTAAACCAGCGA
GAAGAGACGGCCAAGCGGAAGCTCGAGGCCGCCAGGAAGGACCAGGCCAAGCGGTTAGAGGGCCTTCAGGAAGCG
CAGTCGTTGAATTTCCGACGAGCCGCCGCCATCGAGGCCAATGTCGAGCGCGTACAAGAAGCCATGGACGCTATC
AACGGCCTGGTGGCCCAAGGCATGGACTGGATAGACATTGGGAAATTGGTCGAGAGGGAGCGGAAGAAGAAGAAT
GCCGTGGCCGAGATAATCGTGCTGCCACTCAACCTTGCAGAGAATCTCATGACGCTCAAGCTGGCCGAGGCCAAA
ACCGAGGCCGACGAAGAACCAGACCCGTTCGAGACGGACGACGAAGGTTCCTCAGAGGGTGAGGAGGCTGCATCG
GCTCCATCCAAGGCCAAGCAGGCCGAAAAGTACCTCACTGTCGATATCAACCTGGGCATCAGTCCCTGGAGCAAC
GCGAGAGAGTACTACGATCAAAGACGGTCGGCCGCGGCCAAGGAGGAGAAGACGCAGCTTCAGACGGCCAAGGCG
ATGAAGAATGCCGAGCAAAAGATCAGCGAGGATCTCAAAAAGGGGTTGAAGCAGGAAAAGGCGCTGCTACAGCCC
ATCAGACAGCAGATGTGGTTCGAGAAGTTCATCTGGTTCCTCTCGTCCGACGGCTACCTCGTCCTCGGCGGCAAG
GACGCAGGACAGAACGAGATGCTGTACCGCAAATATCTGCGGAAAGGCGACGTCTACTGCCATGCAGACTTACGC
GGAGCGGCCACCGTCATCATCAAGAACGACCCGAAGACACCCGAGGCACCGATACCGCCAGCGACTTTATCTCAG
GCCGGCTCGCTCGCTGTCTGTTCATCGGAAGCGTGGGATTCCAAGGCCGGAATGGGTGCCTGGTGGGTGAACGCC
GACCAAGTGTCCAAGTCGGCTGCAACAGGGGACTTTCTGTCAGAGGGAAACTTTACGGTGCAGGGCAAGAAGAAC
CATCTGGCCCCGGCACAGCTTCTACTTGGCTTCGGCATCATGTTCAGGATCAGCGAGGCGAGCAAGGACCGGCAC
GTCAAACACCGATTAAACGATGGCGACGCAGGCGGAGCGGATCAGAAGGAGCAGAAAAAGCCAAACCCCCTACTA
GAAGGCGAGGTTGTTGGAGCAGCTGAGGATGTGGCGGAACAAGAGGATGACGACTCCTTGTCGGATTTACAGTCT
GAAGAGGACGAAGACCGACATGAATCTGGGCGTGATAACCCTCTGCAGACACGAGGCCCGGGAGGTGGCGATGAT
GACGATGCGGCTGCGGATCGAGGCGAAATGTCGGAGCCTGACGTCGCAAACCTGGCCATTGAAGCCGACGCCGAA
CAAGACCAGGGCGCAGACGAGGCTGAGAATGAAGGCCAGGATCGATCCGAGCTGACGATGGAAGCCGAGACGGTA
TCAACAACCACATCGACATCGCGGCCCAGCGCCAAGGCACCCCCCAAGCGTGGCCAGAAGGGCAAGGCCAAGAAG
ATGGCCAACAAGTACAAGGATCAAGACGACGAGGACCGGGCCGCGGCCGAGGCGCTCATCGGGGCGGCAGCGGGC
AAGCAAAAGGCCGAAGCTGAAGCCAAGGCACGGGCCGAAGCCAAGGCGCAGCTCGAAGCAGCCAAGGAGCGACGA
CGGGCTCAGCACCAGCGGCAGCAGAGAGAGACGGCGGCGCACGAGCAGGCACGACGCAACATGATGGAACAGGAC
TCGGCCGAAGCGATGACGGATCTCGACGCGCTGGTAGGCACGCCGCTGCCAGGAGACGAGGTGCTGGAGGCGATT
GCGGTATGCGCCCCCTGGATCGCCCTCGGAAAGTTCAAGTACAAGGCCAAGATGCAGCCCGGGGCGACGAAGAAG
GGCAAGGCCGTCAGGGAGGTGCTGGACCGGTGGCGGGCCGATTCGGGCAAGAAAGGGGCCGTCGACGAGGCAGCG
AGGGACGTGGAGAAGATGTGGCCTCGAGAGGTGGAGCTCATCAAGGGGCTCAAGACGGAGGAGGTCGTCAACGTG
GTGCCTGTGGGTAAGGTCAAGGTCATGATGGCGGGCGGAGGCGCCAAGGGCAAGGCTGGCGGTGGTGCCAAGGGA
CAGGGTAAAGGAGGTCGAGGAGGGAAGGGTTCCAAGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail