Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5675
Gene name
LocationContig_576:5186..10517
Strand+
Gene length (bp)5331
Transcript length (bp)5256
Coding sequence length (bp)5256
Protein length (aa) 1752

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04997 RNA_pol_Rpb1_1 RNA polymerase Rpb1, domain 1 4.5E-109 14 355
PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5 7.0E-99 821 1418
PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2 4.4E-76 357 522
PF04992 RNA_pol_Rpb1_6 RNA polymerase Rpb1, domain 6 2.9E-59 887 1071
PF04990 RNA_pol_Rpb1_7 RNA polymerase Rpb1, domain 7 2.8E-47 1155 1290
PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3 1.5E-44 525 683
PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4 1.9E-36 710 814
PF05001 RNA_pol_Rpb1_R RNA polymerase Rpb1 C-terminal repeat 5.2E-02 1571 1590
PF05001 RNA_pol_Rpb1_R RNA polymerase Rpb1 C-terminal repeat 5.9E+00 1620 1632
PF05001 RNA_pol_Rpb1_R RNA polymerase Rpb1 C-terminal repeat 1.7E-01 1630 1643
PF05001 RNA_pol_Rpb1_R RNA polymerase Rpb1 C-terminal repeat 7.9E+00 1644 1660
PF05001 RNA_pol_Rpb1_R RNA polymerase Rpb1 C-terminal repeat 3.9E-01 1664 1677
PF05001 RNA_pol_Rpb1_R RNA polymerase Rpb1 C-terminal repeat 1.2E+00 1671 1683
PF05001 RNA_pol_Rpb1_R RNA polymerase Rpb1 C-terminal repeat 8.2E-03 1702 1716
PF05001 RNA_pol_Rpb1_R RNA polymerase Rpb1 C-terminal repeat 1.9E-01 1725 1738
PF05001 RNA_pol_Rpb1_R RNA polymerase Rpb1 C-terminal repeat 2.1E+00 1732 1744

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 1 1574 0.0E+00
sp|Q75A34|RPB1_ASHGO DNA-directed RNA polymerase II subunit RPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB1 PE=3 SV=2 6 1589 0.0E+00
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO21 PE=1 SV=2 8 1598 0.0E+00
sp|P18616|NRPB1_ARATH DNA-directed RNA polymerase II subunit 1 OS=Arabidopsis thaliana GN=NRPB1 PE=1 SV=3 6 1749 0.0E+00
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 7 1740 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 1 1574 0.0E+00
sp|Q75A34|RPB1_ASHGO DNA-directed RNA polymerase II subunit RPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB1 PE=3 SV=2 6 1589 0.0E+00
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO21 PE=1 SV=2 8 1598 0.0E+00
sp|P18616|NRPB1_ARATH DNA-directed RNA polymerase II subunit 1 OS=Arabidopsis thaliana GN=NRPB1 PE=1 SV=3 6 1749 0.0E+00
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 7 1740 0.0E+00
sp|P35084|RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum GN=polr2a PE=2 SV=2 5 1542 0.0E+00
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 11 1624 0.0E+00
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 11 1650 0.0E+00
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 9 1624 0.0E+00
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 9 1624 0.0E+00
sp|Q8SSC4|RPB1_ENCCU DNA-directed RNA polymerase II subunit RPB1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB1 PE=3 SV=1 14 1476 0.0E+00
sp|P17546|RPB1A_TRYBB DNA-directed RNA polymerase II subunit RPB1-A OS=Trypanosoma brucei brucei GN=TRP4.8 PE=1 SV=1 9 1747 0.0E+00
sp|P17545|RPB1B_TRYBB DNA-directed RNA polymerase II subunit RPB1-B OS=Trypanosoma brucei brucei GN=TRP5.9 PE=1 SV=1 9 1747 0.0E+00
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 722 1584 0.0E+00
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 6 577 0.0E+00
sp|Q7T6X5|RPO1_MIMIV DNA-directed RNA polymerase subunit 1 OS=Acanthamoeba polyphaga mimivirus GN=RPO1 PE=1 SV=2 13 1473 0.0E+00
sp|Q6BI69|RPC1_DEBHA DNA-directed RNA polymerase III subunit RPC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPC1 PE=3 SV=2 14 1473 0.0E+00
sp|P04051|RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO31 PE=1 SV=1 14 1466 0.0E+00
sp|O94666|RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc1 PE=2 SV=1 14 1466 0.0E+00
sp|P31813|RPOA1_THECE DNA-directed RNA polymerase subunit A' OS=Thermococcus celer GN=rpoA1 PE=3 SV=1 14 890 0.0E+00
sp|P11512|RPOA1_SULAC DNA-directed RNA polymerase subunit A' OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoA1 PE=3 SV=2 14 890 0.0E+00
sp|O27125|RPOA1_METTH DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoA1 PE=3 SV=1 13 888 0.0E+00
sp|Q980R2|RPOA1_SULSO DNA-directed RNA polymerase subunit A' OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoA1 PE=1 SV=1 14 890 0.0E+00
sp|P0CX02|RPOA1_HALSA DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoA1 PE=3 SV=1 14 886 0.0E+00
sp|B0R8D4|RPOA1_HALS3 DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoA1 PE=1 SV=1 14 886 0.0E+00
sp|P41556|RPOA1_METVS DNA-directed RNA polymerase subunit A' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoA1 PE=3 SV=1 14 888 0.0E+00
sp|P09846|RPOA1_METTW DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoA1 PE=3 SV=2 13 888 0.0E+00
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 14 888 0.0E+00
sp|Q03585|RPOA1_THEAC DNA-directed RNA polymerase subunit A' OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoA1 PE=3 SV=1 14 888 0.0E+00
sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 14 893 0.0E+00
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 14 893 0.0E+00
sp|Q5ZL98|RPC1_CHICK DNA-directed RNA polymerase III subunit RPC1 OS=Gallus gallus GN=POLR3A PE=2 SV=1 14 893 0.0E+00
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 2 618 2.0E-173
sp|F4JXF9|NRPC1_ARATH DNA-directed RNA polymerase III subunit 1 OS=Arabidopsis thaliana GN=NRPC1 PE=2 SV=1 6 893 1.0E-167
sp|P28364|RPB1_EUPOC DNA-directed RNA polymerase II subunit RPB1 (Fragment) OS=Euplotes octocarinatus GN=RPB1 PE=3 SV=1 6 499 2.0E-148
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 243 893 2.0E-143
sp|Q65215|RPB1_ASFM2 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-107 PE=3 SV=2 16 1472 8.0E-142
sp|P42486|RPB1_ASFB7 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-99 PE=3 SV=1 16 1472 1.0E-141
sp|P0C989|RPB1_ASFK5 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-111 PE=3 SV=1 16 1472 2.0E-141
sp|P0C988|RPB1_ASFWA Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-109 PE=3 SV=1 16 1472 4.0E-141
sp|P0C987|RPB1_ASFP4 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-111 PE=3 SV=1 16 1472 4.0E-141
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 311 1175 1.0E-128
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 311 1180 5.0E-128
sp|Q196X0|RPB1_IIV3 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-090L PE=3 SV=1 16 888 2.0E-121
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 246 888 3.0E-115
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 14 490 2.0E-111
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 311 888 3.0E-104
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 423 888 4.0E-103
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 244 890 8.0E-103
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 307 888 2.0E-100
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 241 889 6.0E-99
sp|Q6GZW7|RPB1_FRG3G Putative DNA-directed RNA polymerase 008R OS=Frog virus 3 (isolate Goorha) GN=FV3-008R PE=3 SV=1 16 888 3.0E-98
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 246 889 4.0E-95
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 614 986 1.0E-91
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 242 888 2.0E-85
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 492 896 1.0E-84
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 1229 1749 2.0E-83
sp|O55766|RPB1_IIV6 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-176R PE=3 SV=1 439 888 2.0E-81
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 431 893 1.0E-78
sp|P15349|RPOA1_HALMO DNA-directed RNA polymerase subunit A' (Fragment) OS=Halococcus morrhuae GN=rpoA1 PE=3 SV=1 619 885 7.0E-67
sp|B1YGU3|RPOC_EXIS2 DNA-directed RNA polymerase subunit beta' OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpoC PE=3 SV=1 17 867 3.0E-61
sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoC PE=3 SV=1 17 867 4.0E-61
sp|A4J104|RPOC_DESRM DNA-directed RNA polymerase subunit beta' OS=Desulfotomaculum reducens (strain MI-1) GN=rpoC PE=3 SV=1 13 867 4.0E-60
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 16 422 2.0E-59
sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoC PE=3 SV=1 13 865 4.0E-59
sp|Q2S906|RPOC_HAHCH DNA-directed RNA polymerase subunit beta' OS=Hahella chejuensis (strain KCTC 2396) GN=rpoC PE=3 SV=1 17 862 9.0E-59
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 17 897 4.0E-58
sp|B0TC49|RPOC_HELMI DNA-directed RNA polymerase subunit beta' OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoC PE=3 SV=1 17 865 6.0E-58
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 19 874 1.0E-57
sp|A4VHM4|RPOC_PSEU5 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas stutzeri (strain A1501) GN=rpoC PE=3 SV=1 4 862 1.0E-57
sp|B2A4D2|RPOC_NATTJ DNA-directed RNA polymerase subunit beta' OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpoC PE=3 SV=1 19 865 2.0E-57
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 13 865 2.0E-57
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 13 867 2.0E-57
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 13 865 3.0E-57
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 19 874 3.0E-57
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 19 874 3.0E-57
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 13 865 4.0E-57
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 17 897 4.0E-57
sp|P58192|RPOA2_SULSO DNA-directed RNA polymerase subunit A'' OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoA2 PE=1 SV=1 980 1469 5.0E-57
sp|Q67JT4|RPOC_SYMTH DNA-directed RNA polymerase subunit beta' OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoC PE=3 SV=1 17 867 6.0E-57
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 19 874 6.0E-57
sp|Q3ILP8|RPOC_PSEHT DNA-directed RNA polymerase subunit beta' OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpoC PE=3 SV=1 4 867 7.0E-57
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 19 874 7.0E-57
sp|C3N7Q1|RPOA2_SULIY DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpoA2 PE=3 SV=1 980 1469 7.0E-57
sp|C3NFS2|RPOA2_SULIN DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpoA2 PE=3 SV=1 980 1469 7.0E-57
sp|C3MYA0|RPOA2_SULIM DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpoA2 PE=3 SV=1 980 1469 7.0E-57
sp|C3MRK4|RPOA2_SULIL DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpoA2 PE=3 SV=1 980 1469 7.0E-57
sp|C4KIV9|RPOA2_SULIK DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpoA2 PE=3 SV=1 980 1469 7.0E-57
sp|C3MZM9|RPOA2_SULIA DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.16.27) GN=rpoA2 PE=3 SV=1 980 1469 7.0E-57
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 19 874 8.0E-57
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 19 874 8.0E-57
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 19 874 8.0E-57
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 19 874 8.0E-57
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 19 874 8.0E-57
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 19 874 8.0E-57
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 19 874 8.0E-57
sp|A4XI31|RPOC_CALS8 DNA-directed RNA polymerase subunit beta' OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoC PE=3 SV=2 19 865 1.0E-56
sp|Q9V113|RPOA2_PYRAB DNA-directed RNA polymerase subunit A'' OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpoA2 PE=3 SV=1 1048 1461 1.0E-56
sp|O93777|RPOA2_PYRHO DNA-directed RNA polymerase subunit A'' OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpoA2 PE=3 SV=1 1048 1461 2.0E-56
sp|A5D5I3|RPOC_PELTS DNA-directed RNA polymerase subunit beta' OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpoC PE=3 SV=1 13 865 2.0E-56
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 19 874 2.0E-56
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 19 874 2.0E-56
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 19 874 2.0E-56
sp|A8F977|RPOC_BACP2 DNA-directed RNA polymerase subunit beta' OS=Bacillus pumilus (strain SAFR-032) GN=rpoC PE=3 SV=1 17 865 3.0E-56
sp|Q6FF89|RPOC_ACIAD DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpoC PE=3 SV=2 17 862 3.0E-56
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 13 867 4.0E-56
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 19 874 4.0E-56
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 19 874 4.0E-56
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 19 874 4.0E-56
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 19 874 5.0E-56
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 19 874 5.0E-56
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 19 874 5.0E-56
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 19 874 6.0E-56
sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoC PE=3 SV=1 17 867 6.0E-56
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 13 867 7.0E-56
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 19 874 7.0E-56
sp|A5I7L3|RPOC_CLOBH DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoC PE=3 SV=1 13 867 8.0E-56
sp|A7FZ76|RPOC_CLOB1 DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoC PE=3 SV=1 13 867 8.0E-56
sp|P57145|RPOC_BUCAI DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpoC PE=3 SV=1 4 867 8.0E-56
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 13 874 8.0E-56
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 13 874 8.0E-56
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 13 874 8.0E-56
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 19 867 1.0E-55
sp|A4XZ96|RPOC_PSEMY DNA-directed RNA polymerase subunit beta' OS=Pseudomonas mendocina (strain ymp) GN=rpoC PE=3 SV=1 4 862 1.0E-55
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 13 865 1.0E-55
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 19 874 1.0E-55
sp|Q058E6|RPOC_BUCCC DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpoC PE=3 SV=1 14 881 2.0E-55
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 13 865 2.0E-55
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 19 874 2.0E-55
sp|A6LPQ5|RPOC_CLOB8 DNA-directed RNA polymerase subunit beta' OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoC PE=3 SV=1 13 865 2.0E-55
sp|A7GK13|RPOC_BACCN DNA-directed RNA polymerase subunit beta' OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpoC PE=3 SV=1 17 882 2.0E-55
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 13 867 3.0E-55
sp|P14247|RPOA2_METVS DNA-directed RNA polymerase subunit A'' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoA2 PE=3 SV=2 1036 1467 3.0E-55
sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1 14 867 3.0E-55
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 19 867 4.0E-55
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 19 867 4.0E-55
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 19 867 4.0E-55
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 19 874 4.0E-55
sp|Q1IFX2|RPOC_PSEE4 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas entomophila (strain L48) GN=rpoC PE=3 SV=1 4 862 4.0E-55
sp|Q8EWX0|RPOC_MYCPE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma penetrans (strain HF-2) GN=rpoC PE=3 SV=1 16 862 5.0E-55
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 19 874 5.0E-55
sp|A6UZI2|RPOC_PSEA7 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain PA7) GN=rpoC PE=3 SV=1 4 862 5.0E-55
sp|Q9HWC9|RPOC_PSEAE DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpoC PE=3 SV=1 4 862 6.0E-55
sp|Q02T86|RPOC_PSEAB DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpoC PE=3 SV=1 4 862 6.0E-55
sp|Q0AUH3|RPOC_SYNWW DNA-directed RNA polymerase subunit beta' OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoC PE=3 SV=1 17 867 7.0E-55
sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoC PE=3 SV=1 17 867 7.0E-55
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 992 1255 8.0E-55
sp|Q889X7|RPOC_PSESM DNA-directed RNA polymerase subunit beta' OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpoC PE=3 SV=1 4 862 8.0E-55
sp|P77819|RPOC_BACAN DNA-directed RNA polymerase subunit beta' OS=Bacillus anthracis GN=rpoC PE=3 SV=3 17 882 8.0E-55
sp|Q4ZMN8|RPOC_PSEU2 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpoC PE=3 SV=1 4 862 9.0E-55
sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoC PE=3 SV=1 17 878 9.0E-55
sp|B0KK61|RPOC_PSEPG DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain GB-1) GN=rpoC PE=3 SV=1 4 862 9.0E-55
sp|Q48D30|RPOC_PSE14 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpoC PE=3 SV=1 4 862 9.0E-55
sp|Q88QP1|RPOC_PSEPK DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain KT2440) GN=rpoC PE=3 SV=1 4 862 1.0E-54
sp|A5VXP1|RPOC_PSEP1 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpoC PE=3 SV=1 4 862 1.0E-54
sp|B1JDX0|RPOC_PSEPW DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain W619) GN=rpoC PE=3 SV=1 4 862 1.0E-54
sp|Q250N9|RPOC_DESHY DNA-directed RNA polymerase subunit beta' OS=Desulfitobacterium hafniense (strain Y51) GN=rpoC PE=3 SV=1 17 865 1.0E-54
sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) GN=rpoC PE=1 SV=4 17 865 1.0E-54
sp|B0VDH9|RPOC_ACIBY DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain AYE) GN=rpoC PE=3 SV=1 11 862 1.0E-54
sp|A3M1G4|RPOC_ACIBT DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpoC PE=3 SV=2 11 862 1.0E-54
sp|B2I1Z2|RPOC_ACIBC DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ACICU) GN=rpoC PE=3 SV=1 11 862 1.0E-54
sp|Q47UW0|RPOC_COLP3 DNA-directed RNA polymerase subunit beta' OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpoC PE=3 SV=1 4 879 1.0E-54
sp|A9KW96|RPOC_SHEB9 DNA-directed RNA polymerase subunit beta' OS=Shewanella baltica (strain OS195) GN=rpoC PE=3 SV=1 4 862 1.0E-54
sp|A6WHS2|RPOC_SHEB8 DNA-directed RNA polymerase subunit beta' OS=Shewanella baltica (strain OS185) GN=rpoC PE=3 SV=1 4 862 1.0E-54
sp|B8EBL1|RPOC_SHEB2 DNA-directed RNA polymerase subunit beta' OS=Shewanella baltica (strain OS223) GN=rpoC PE=3 SV=1 4 862 1.0E-54
sp|Q65W40|RPOC_MANSM DNA-directed RNA polymerase subunit beta' OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpoC PE=3 SV=2 19 862 2.0E-54
sp|Q0BKC6|RPOC_FRATO DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpoC PE=3 SV=1 8 862 2.0E-54
sp|Q2A1M8|RPOC_FRATH DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpoC PE=3 SV=1 8 862 2.0E-54
sp|B0VLZ5|RPOC_ACIBS DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain SDF) GN=rpoC PE=3 SV=1 11 862 2.0E-54
sp|A9KJL3|RPOC_CLOPH DNA-directed RNA polymerase subunit beta' OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpoC PE=3 SV=1 15 865 2.0E-54
sp|A6UV49|RPOA2_META3 DNA-directed RNA polymerase subunit A'' OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpoA2 PE=3 SV=1 1036 1468 2.0E-54
sp|A4IWA0|RPOC_FRATW DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpoC PE=3 SV=1 8 862 2.0E-54
sp|Q5NID1|RPOC_FRATT DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpoC PE=3 SV=1 8 862 2.0E-54
sp|Q14JT4|RPOC_FRAT1 DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpoC PE=3 SV=1 8 862 2.0E-54
sp|A7Z0N0|RPOC_BACMF DNA-directed RNA polymerase subunit beta' OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoC PE=3 SV=1 17 865 2.0E-54
sp|Q74L94|RPOC_LACJO DNA-directed RNA polymerase subunit beta' OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoC PE=3 SV=1 17 865 2.0E-54
sp|B2SFD7|RPOC_FRATM DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpoC PE=3 SV=1 8 862 2.0E-54
sp|A0Q866|RPOC_FRATN DNA-directed RNA polymerase subunit beta' OS=Francisella tularensis subsp. novicida (strain U112) GN=rpoC PE=3 SV=1 8 862 2.0E-54
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 19 867 3.0E-54
sp|B3EL62|RPOC_CHLPB DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeobacteroides (strain BS1) GN=rpoC PE=3 SV=1 4 871 3.0E-54
sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoC PE=3 SV=1 17 867 3.0E-54
sp|C3K2Y2|RPOC_PSEFS DNA-directed RNA polymerase subunit beta' OS=Pseudomonas fluorescens (strain SBW25) GN=rpoC PE=3 SV=1 4 862 3.0E-54
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 19 867 4.0E-54
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 19 867 4.0E-54
sp|Q4K527|RPOC_PSEF5 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpoC PE=3 SV=1 4 862 4.0E-54
sp|A8G1F4|RPOC_SHESH DNA-directed RNA polymerase subunit beta' OS=Shewanella sediminis (strain HAW-EB3) GN=rpoC PE=3 SV=1 4 862 5.0E-54
sp|B8CNC6|RPOC_SHEPW DNA-directed RNA polymerase subunit beta' OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpoC PE=3 SV=1 4 862 5.0E-54
sp|Q3K5Y2|RPOC_PSEPF DNA-directed RNA polymerase subunit beta' OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpoC PE=3 SV=1 4 862 5.0E-54
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 17 867 5.0E-54
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 17 867 6.0E-54
sp|Q8U0M5|RPOA2_PYRFU DNA-directed RNA polymerase subunit A'' OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpoA2 PE=1 SV=1 1043 1461 6.0E-54
sp|A1JII1|RPOC_YERE8 DNA-directed RNA polymerase subunit beta' OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpoC PE=3 SV=1 4 867 6.0E-54
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 13 865 6.0E-54
sp|A4YCR0|RPOA2_METS5 DNA-directed RNA polymerase subunit A'' OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpoA2 PE=3 SV=1 1058 1469 7.0E-54
sp|Q0I0B1|RPOC_SHESR DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain MR-7) GN=rpoC PE=3 SV=1 4 862 7.0E-54
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 13 865 7.0E-54
sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoC PE=3 SV=3 17 867 7.0E-54
sp|Q0HNU3|RPOC_SHESM DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain MR-4) GN=rpoC PE=3 SV=1 4 862 8.0E-54
sp|A0KRL8|RPOC_SHESA DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain ANA-3) GN=rpoC PE=3 SV=1 4 862 8.0E-54
sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoC PE=3 SV=1 17 867 8.0E-54
sp|O27126|RPOA2_METTH DNA-directed RNA polymerase subunit A'' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoA2 PE=3 SV=1 1045 1470 1.0E-53
sp|Q046D1|RPOC_LACGA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoC PE=3 SV=1 17 865 1.0E-53
sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoC PE=3 SV=1 17 867 1.0E-53
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 242 874 1.0E-53
sp|Q6LXI7|RPOA2_METMP DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain S2 / LL) GN=rpoA2 PE=3 SV=1 1036 1468 1.0E-53
sp|Q8EK73|RPOC_SHEON DNA-directed RNA polymerase subunit beta' OS=Shewanella oneidensis (strain MR-1) GN=rpoC PE=3 SV=1 4 862 1.0E-53
sp|Q89B21|RPOC_BUCBP DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpoC PE=3 SV=1 19 867 1.0E-53
sp|Q1WVA4|RPOC_LACS1 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus salivarius (strain UCC118) GN=rpoC PE=3 SV=1 17 865 2.0E-53
sp|A4FWF5|RPOA2_METM5 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpoA2 PE=3 SV=1 1036 1468 2.0E-53
sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoC PE=3 SV=1 17 867 2.0E-53
sp|P77882|RPOC_LISGR DNA-directed RNA polymerase subunit beta' (Fragment) OS=Listeria grayi GN=rpoC PE=3 SV=2 17 867 2.0E-53
sp|B1JJK0|RPOC_YERPY DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpoC PE=3 SV=1 4 867 2.0E-53
sp|Q66FQ1|RPOC_YERPS DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpoC PE=3 SV=1 4 867 2.0E-53
sp|A4TS28|RPOC_YERPP DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis (strain Pestoides F) GN=rpoC PE=3 SV=2 4 867 2.0E-53
sp|Q1CN77|RPOC_YERPN DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpoC PE=3 SV=2 4 867 2.0E-53
sp|A9R0H9|RPOC_YERPG DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpoC PE=3 SV=1 4 867 2.0E-53
sp|Q8D1H3|RPOC_YERPE DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis GN=rpoC PE=3 SV=2 4 867 2.0E-53
sp|B2K114|RPOC_YERPB DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpoC PE=3 SV=1 4 867 2.0E-53
sp|Q1C1U2|RPOC_YERPA DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpoC PE=3 SV=2 4 867 2.0E-53
sp|A7FNI2|RPOC_YERP3 DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpoC PE=3 SV=1 4 867 2.0E-53
sp|A6VGV0|RPOA2_METM7 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpoA2 PE=3 SV=1 1036 1470 2.0E-53
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 17 867 2.0E-53
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 19 874 2.0E-53
sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoC PE=3 SV=2 17 867 3.0E-53
sp|A9A9U9|RPOA2_METM6 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpoA2 PE=3 SV=1 1036 1468 3.0E-53
sp|Q15YB0|RPOC_PSEA6 DNA-directed RNA polymerase subunit beta' OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpoC PE=3 SV=1 4 862 3.0E-53
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 19 867 3.0E-53
sp|Q8KG14|RPOC_CHLTE DNA-directed RNA polymerase subunit beta' OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpoC PE=3 SV=1 4 871 3.0E-53
sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoC PE=3 SV=1 17 867 4.0E-53
sp|B5YFV7|RPOC_THEYD DNA-directed RNA polymerase subunit beta' OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpoC PE=3 SV=1 19 862 4.0E-53
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 17 865 4.0E-53
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 17 865 4.0E-53
sp|Q0BYA8|RPOC_HYPNA DNA-directed RNA polymerase subunit beta' OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpoC PE=3 SV=1 1 885 4.0E-53
sp|B0TX11|RPOC_FRAP2 DNA-directed RNA polymerase subunit beta' OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpoC PE=3 SV=1 8 862 5.0E-53
sp|Q5QWA4|RPOC_IDILO DNA-directed RNA polymerase subunit beta' OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpoC PE=3 SV=1 19 879 5.0E-53
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 17 865 5.0E-53
sp|A5EX69|RPOC_DICNV DNA-directed RNA polymerase subunit beta' OS=Dichelobacter nodosus (strain VCS1703A) GN=rpoC PE=3 SV=1 1 862 5.0E-53
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 17 867 5.0E-53
sp|Q7VRP8|RPOC_BLOFL DNA-directed RNA polymerase subunit beta' OS=Blochmannia floridanus GN=rpoC PE=3 SV=1 242 867 6.0E-53
sp|A0AF64|RPOC_LISW6 DNA-directed RNA polymerase subunit beta' OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoC PE=3 SV=1 17 867 6.0E-53
sp|B2UYA4|RPOC_CLOBA DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpoC PE=3 SV=1 13 865 7.0E-53
sp|A1T064|RPOC_PSYIN DNA-directed RNA polymerase subunit beta' OS=Psychromonas ingrahamii (strain 37) GN=rpoC PE=3 SV=1 242 862 8.0E-53
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 17 865 9.0E-53
sp|A1VYJ5|RPOC_CAMJJ DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpoC PE=3 SV=1 17 862 9.0E-53
sp|A8FKR4|RPOC_CAMJ8 DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpoC PE=3 SV=1 17 862 9.0E-53
sp|Q2GCD8|RPOC_NOVAD DNA-directed RNA polymerase subunit beta' OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpoC PE=3 SV=1 6 861 1.0E-52
sp|Q2LQ86|RPOC_SYNAS DNA-directed RNA polymerase subunit beta' OS=Syntrophus aciditrophicus (strain SB) GN=rpoC PE=3 SV=1 5 861 1.0E-52
sp|B2TIG9|RPOC_CLOBB DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpoC PE=3 SV=1 13 865 1.0E-52
sp|Q0ABI1|RPOC_ALKEH DNA-directed RNA polymerase subunit beta' OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpoC PE=3 SV=1 6 862 1.0E-52
sp|Q87A33|RPOC_XYLFT DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpoC PE=3 SV=1 19 864 1.0E-52
sp|B2IA67|RPOC_XYLF2 DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain M23) GN=rpoC PE=3 SV=1 19 864 1.0E-52
sp|Q7N9A3|RPOC_PHOLL DNA-directed RNA polymerase subunit beta' OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpoC PE=3 SV=1 4 867 1.0E-52
sp|B3E164|RPOC_METI4 DNA-directed RNA polymerase subunit beta' OS=Methylacidiphilum infernorum (isolate V4) GN=rpoC PE=3 SV=1 17 885 1.0E-52
sp|P36252|RPOC_THEMA DNA-directed RNA polymerase subunit beta' OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpoC PE=3 SV=1 232 1104 1.0E-52
sp|A6VKC4|RPOC_ACTSZ DNA-directed RNA polymerase subunit beta' OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpoC PE=3 SV=1 14 862 2.0E-52
sp|Q5HVY8|RPOC_CAMJR DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni (strain RM1221) GN=rpoC PE=3 SV=1 17 862 2.0E-52
sp|A5U9X9|RPOC_HAEIE DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittEE) GN=rpoC PE=3 SV=1 19 862 2.0E-52
sp|Q976A6|RPOA2_SULTO DNA-directed RNA polymerase subunit A'' OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoA2 PE=3 SV=2 1068 1461 2.0E-52
sp|Q2NWR5|RPOC_SODGM DNA-directed RNA polymerase subunit beta' OS=Sodalis glossinidius (strain morsitans) GN=rpoC PE=3 SV=1 4 867 2.0E-52
sp|Q9PA87|RPOC_XYLFA DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain 9a5c) GN=rpoC PE=3 SV=2 19 864 3.0E-52
sp|Q4QN34|RPOC_HAEI8 DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain 86-028NP) GN=rpoC PE=3 SV=1 19 862 3.0E-52
sp|P09847|RPOA2_METTW DNA-directed RNA polymerase subunit A'' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoA2 PE=1 SV=2 1045 1467 3.0E-52
sp|A5UH19|RPOC_HAEIG DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittGG) GN=rpoC PE=3 SV=1 19 862 4.0E-52
sp|Q9PI30|RPOC_CAMJE DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpoC PE=3 SV=1 17 862 4.0E-52
sp|P43739|RPOC_HAEIN DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpoC PE=3 SV=1 19 862 4.0E-52
sp|B0U5X6|RPOC_XYLFM DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain M12) GN=rpoC PE=3 SV=1 19 864 4.0E-52
sp|B3QQS1|RPOC_CHLP8 DNA-directed RNA polymerase subunit beta' OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpoC PE=3 SV=1 4 871 4.0E-52
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 17 865 4.0E-52
sp|A1S212|RPOC_SHEAM DNA-directed RNA polymerase subunit beta' OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpoC PE=3 SV=1 242 862 4.0E-52
sp|A1TYJ1|RPOC_MARHV DNA-directed RNA polymerase subunit beta' OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpoC PE=3 SV=1 4 862 5.0E-52
sp|A9BR99|RPOC_DELAS DNA-directed RNA polymerase subunit beta' OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpoC PE=3 SV=1 12 881 5.0E-52
sp|Q7MA56|RPOBC_WOLSU Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpoBC PE=3 SV=1 19 856 5.0E-52
sp|A1BD24|RPOC_CHLPD DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpoC PE=3 SV=1 4 862 6.0E-52
sp|B6IRP7|RPOC_RHOCS DNA-directed RNA polymerase subunit beta' OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpoC PE=3 SV=1 14 861 6.0E-52
sp|A8GYX0|RPOC_SHEPA DNA-directed RNA polymerase subunit beta' OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpoC PE=3 SV=1 242 862 7.0E-52
sp|C4LBV1|RPOC_TOLAT DNA-directed RNA polymerase subunit beta' OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpoC PE=3 SV=1 242 862 7.0E-52
sp|A4SHV0|RPOC_AERS4 DNA-directed RNA polymerase subunit beta' OS=Aeromonas salmonicida (strain A449) GN=rpoC PE=3 SV=1 242 870 8.0E-52
sp|B2UQY1|RPOC_AKKM8 DNA-directed RNA polymerase subunit beta' OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpoC PE=3 SV=1 224 862 8.0E-52
sp|A0KQA4|RPOC_AERHH DNA-directed RNA polymerase subunit beta' OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpoC PE=3 SV=1 242 867 9.0E-52
sp|Q1IHH5|RPOC_KORVE DNA-directed RNA polymerase subunit beta' OS=Koribacter versatilis (strain Ellin345) GN=rpoC PE=3 SV=2 19 870 1.0E-51
sp|B0TM18|RPOC_SHEHH DNA-directed RNA polymerase subunit beta' OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpoC PE=3 SV=1 242 862 1.0E-51
sp|Q089R0|RPOC_SHEFN DNA-directed RNA polymerase subunit beta' OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpoC PE=3 SV=1 242 862 1.0E-51
sp|A1KRG7|RPOC_NEIMF DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpoC PE=3 SV=1 1 881 1.0E-51
sp|Q01VB2|RPOC_SOLUE DNA-directed RNA polymerase subunit beta' OS=Solibacter usitatus (strain Ellin6076) GN=rpoC PE=3 SV=1 19 862 1.0E-51
sp|Q12SW5|RPOC_SHEDO DNA-directed RNA polymerase subunit beta' OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpoC PE=3 SV=1 242 862 1.0E-51
sp|Q4FQH4|RPOC_PSYA2 DNA-directed RNA polymerase subunit beta' OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpoC PE=3 SV=1 17 867 2.0E-51
sp|P41185|RPOC_BUCAP DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpoC PE=3 SV=2 242 862 3.0E-51
sp|Q3YUZ6|RPOC_SHISS DNA-directed RNA polymerase subunit beta' OS=Shigella sonnei (strain Ss046) GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|P0A8T9|RPOC_SHIFL DNA-directed RNA polymerase subunit beta' OS=Shigella flexneri GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|Q31U09|RPOC_SHIBS DNA-directed RNA polymerase subunit beta' OS=Shigella boydii serotype 4 (strain Sb227) GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|P0A8T7|RPOC_ECOLI DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain K12) GN=rpoC PE=1 SV=1 242 867 4.0E-51
sp|B1IUQ9|RPOC_ECOLC DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|A8A787|RPOC_ECOHS DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O9:H4 (strain HS) GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|B1XBZ0|RPOC_ECODH DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain K12 / DH10B) GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|P0A8T8|RPOC_ECO57 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O157:H7 GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|A7ZUK2|RPOC_ECO24 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpoC PE=1 SV=1 242 867 4.0E-51
sp|Q0SY12|RPOC_SHIF8 DNA-directed RNA polymerase subunit beta' OS=Shigella flexneri serotype 5b (strain 8401) GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|A3Q976|RPOC_SHELP DNA-directed RNA polymerase subunit beta' OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpoC PE=3 SV=1 242 862 4.0E-51
sp|B2TWH4|RPOC_SHIB3 DNA-directed RNA polymerase subunit beta' OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|Q0TA77|RPOC_ECOL5 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpoC PE=3 SV=1 242 867 4.0E-51
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 242 874 4.0E-51
sp|A8EVZ3|RPOC_ARCB4 DNA-directed RNA polymerase subunit beta' OS=Arcobacter butzleri (strain RM4018) GN=rpoC PE=3 SV=1 20 856 4.0E-51
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 242 874 4.0E-51
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 242 874 4.0E-51
sp|Q9KW13|RPOC_SHEVI DNA-directed RNA polymerase subunit beta' OS=Shewanella violacea GN=rpoC PE=3 SV=1 242 862 4.0E-51
sp|B4SG10|RPOC_PELPB DNA-directed RNA polymerase subunit beta' OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpoC PE=3 SV=1 4 871 4.0E-51
sp|Q1R5V4|RPOC_ECOUT DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain UTI89 / UPEC) GN=rpoC PE=3 SV=1 242 867 5.0E-51
sp|A1AIG0|RPOC_ECOK1 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O1:K1 / APEC GN=rpoC PE=3 SV=1 242 867 5.0E-51
sp|A1REA8|RPOC_SHESW DNA-directed RNA polymerase subunit beta' OS=Shewanella sp. (strain W3-18-1) GN=rpoC PE=3 SV=1 242 862 5.0E-51
sp|A4YBY9|RPOC_SHEPC DNA-directed RNA polymerase subunit beta' OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpoC PE=3 SV=1 242 862 5.0E-51
sp|B1LNU0|RPOC_ECOSM DNA-directed RNA polymerase subunit beta' OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpoC PE=3 SV=1 242 867 5.0E-51
sp|Q31IY8|RPOC_THICR DNA-directed RNA polymerase subunit beta' OS=Thiomicrospira crunogena (strain XCL-2) GN=rpoC PE=3 SV=1 19 862 5.0E-51
sp|Q32AG0|RPOC_SHIDS DNA-directed RNA polymerase subunit beta' OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpoC PE=3 SV=1 242 867 6.0E-51
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 242 874 6.0E-51
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 242 874 6.0E-51
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 242 874 6.0E-51
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 242 874 6.0E-51
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 242 874 6.0E-51
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 242 874 6.0E-51
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 242 874 6.0E-51
sp|Q3B1H8|RPOC_CHLL7 DNA-directed RNA polymerase subunit beta' OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpoC PE=3 SV=1 4 871 6.0E-51
sp|P19176|RPOC_PSEPU DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida GN=rpoC PE=3 SV=3 4 862 6.0E-51
sp|Q8FB83|RPOC_ECOL6 DNA-directed RNA polymerase subunit beta' OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpoC PE=3 SV=1 242 867 6.0E-51
sp|Q9LQ02|NRPD1_ARATH DNA-directed RNA polymerase IV subunit 1 OS=Arabidopsis thaliana GN=NRPD1 PE=1 SV=1 351 886 6.0E-51
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 242 874 6.0E-51
sp|Q8D232|RPOC_WIGBR DNA-directed RNA polymerase subunit beta' OS=Wigglesworthia glossinidia brevipalpis GN=rpoC PE=3 SV=1 242 867 7.0E-51
sp|A6T3L2|RPOC_JANMA DNA-directed RNA polymerase subunit beta' OS=Janthinobacterium sp. (strain Marseille) GN=rpoC PE=3 SV=1 19 862 7.0E-51
sp|B0URZ7|RPOC_HISS2 DNA-directed RNA polymerase subunit beta' OS=Histophilus somni (strain 2336) GN=rpoC PE=3 SV=1 19 862 8.0E-51
sp|A1WCM8|RPOC_ACISJ DNA-directed RNA polymerase subunit beta' OS=Acidovorax sp. (strain JS42) GN=rpoC PE=3 SV=1 12 881 8.0E-51
sp|Q6LLW3|RPOC_PHOPR DNA-directed RNA polymerase subunit beta' OS=Photobacterium profundum GN=rpoC PE=3 SV=2 243 867 8.0E-51
sp|A1TVS9|RPOC_ACIAC DNA-directed RNA polymerase subunit beta' OS=Acidovorax citrulli (strain AAC00-1) GN=rpoC PE=3 SV=1 12 862 8.0E-51
sp|A4W5A8|RPOC_ENT38 DNA-directed RNA polymerase subunit beta' OS=Enterobacter sp. (strain 638) GN=rpoC PE=3 SV=1 242 867 8.0E-51
sp|B9MH46|RPOC_ACIET DNA-directed RNA polymerase subunit beta' OS=Acidovorax ebreus (strain TPSY) GN=rpoC PE=3 SV=1 12 881 8.0E-51
sp|Q0I5B8|RPOC_HAES1 DNA-directed RNA polymerase subunit beta' OS=Haemophilus somnus (strain 129Pt) GN=rpoC PE=3 SV=1 19 862 8.0E-51
sp|B3PK31|RPOC_CELJU DNA-directed RNA polymerase subunit beta' OS=Cellvibrio japonicus (strain Ueda107) GN=rpoC PE=3 SV=2 4 862 8.0E-51
sp|B1KMY9|RPOC_SHEWM DNA-directed RNA polymerase subunit beta' OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpoC PE=3 SV=1 242 862 9.0E-51
sp|A9M3X3|RPOC_NEIM0 DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpoC PE=3 SV=1 1 881 9.0E-51
sp|Q9K1J1|RPOC_NEIMB DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpoC PE=3 SV=1 1 881 9.0E-51
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 13 865 1.0E-50
sp|Q9CK92|RPOC_PASMU DNA-directed RNA polymerase subunit beta' OS=Pasteurella multocida (strain Pm70) GN=rpoC PE=3 SV=1 19 862 1.0E-50
sp|A4SGK5|RPOC_CHLPM DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpoC PE=3 SV=1 4 874 1.0E-50
sp|A1B017|RPOC_PARDP DNA-directed RNA polymerase subunit beta' OS=Paracoccus denitrificans (strain Pd 1222) GN=rpoC PE=3 SV=1 10 865 1.0E-50
sp|Q7VKL8|RPOC_HAEDU DNA-directed RNA polymerase subunit beta' OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpoC PE=3 SV=1 19 867 1.0E-50
sp|B2GDX6|RPOC_LACF3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpoC PE=3 SV=1 17 865 1.0E-50
sp|Q6F0L8|RPOC_MESFL DNA-directed RNA polymerase subunit beta' OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpoC PE=3 SV=1 242 862 1.0E-50
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 13 865 1.0E-50
sp|Q8PUR2|RPOA2_METMA DNA-directed RNA polymerase subunit A'' OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpoA2 PE=3 SV=1 1052 1476 1.0E-50
sp|Q6MJ10|RPOC_BDEBA DNA-directed RNA polymerase subunit beta' OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpoC PE=3 SV=1 5 862 1.0E-50
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 242 867 1.0E-50
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 242 867 1.0E-50
sp|Q0ANP4|RPOC_MARMM DNA-directed RNA polymerase subunit beta' OS=Maricaulis maris (strain MCS10) GN=rpoC PE=3 SV=1 3 861 2.0E-50
sp|P11514|RPOA2_SULAC DNA-directed RNA polymerase subunit A'' OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoA2 PE=3 SV=2 1058 1471 2.0E-50
sp|Q1D7U2|RPOC_MYXXD DNA-directed RNA polymerase subunit beta' OS=Myxococcus xanthus (strain DK 1622) GN=rpoC PE=3 SV=1 5 861 2.0E-50
sp|P77839|RPOC_BROTH DNA-directed RNA polymerase subunit beta' (Fragment) OS=Brochothrix thermosphacta GN=rpoC PE=3 SV=2 17 865 2.0E-50
sp|Q0VSM1|RPOC_ALCBS DNA-directed RNA polymerase subunit beta' OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpoC PE=3 SV=1 243 866 2.0E-50
sp|A5VBZ7|RPOC_SPHWW DNA-directed RNA polymerase subunit beta' OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpoC PE=3 SV=1 6 861 2.0E-50
sp|A9KD37|RPOC_COXBN DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpoC PE=3 SV=1 242 862 2.0E-50
sp|A8AKT8|RPOC_CITK8 DNA-directed RNA polymerase subunit beta' OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpoC PE=3 SV=1 242 867 3.0E-50
sp|B9M6V1|RPOC_GEODF DNA-directed RNA polymerase subunit beta' OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpoC PE=3 SV=1 5 881 3.0E-50
sp|Q8TRB8|RPOA2_METAC DNA-directed RNA polymerase subunit A'' OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpoA2 PE=3 SV=1 1068 1475 3.0E-50
sp|Q83ET0|RPOC_COXBU DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpoC PE=3 SV=1 242 862 3.0E-50
sp|A9NAL6|RPOC_COXBR DNA-directed RNA polymerase subunit beta' OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpoC PE=3 SV=1 242 862 3.0E-50
sp|Q1CS68|RPOBC_HELPH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain HPAG1) GN=rpoBC PE=3 SV=1 242 867 3.0E-50
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 13 865 3.0E-50
sp|A4G9U4|RPOC_HERAR DNA-directed RNA polymerase subunit beta' OS=Herminiimonas arsenicoxydans GN=rpoC PE=3 SV=1 19 862 3.0E-50
sp|A9N0J5|RPOC_SALPB DNA-directed RNA polymerase subunit beta' OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpoC PE=3 SV=1 242 867 4.0E-50
sp|A6TGP1|RPOC_KLEP7 DNA-directed RNA polymerase subunit beta' OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpoC PE=3 SV=1 242 867 4.0E-50
sp|B2UUV9|RPOBC_HELPS Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain Shi470) GN=rpoBC PE=3 SV=1 242 867 4.0E-50
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 17 865 4.0E-50
sp|P0A2R4|RPOC_SALTY DNA-directed RNA polymerase subunit beta' OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpoC PE=3 SV=1 242 867 4.0E-50
sp|P0A2R5|RPOC_SALTI DNA-directed RNA polymerase subunit beta' OS=Salmonella typhi GN=rpoC PE=3 SV=1 242 867 4.0E-50
sp|Q57H68|RPOC_SALCH DNA-directed RNA polymerase subunit beta' OS=Salmonella choleraesuis (strain SC-B67) GN=rpoC PE=3 SV=1 242 867 4.0E-50
sp|Q492C0|RPOC_BLOPB DNA-directed RNA polymerase subunit beta' OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpoC PE=3 SV=1 242 867 4.0E-50
sp|A8G8E8|RPOC_SERP5 DNA-directed RNA polymerase subunit beta' OS=Serratia proteamaculans (strain 568) GN=rpoC PE=3 SV=1 242 867 4.0E-50
sp|B2VG97|RPOC_ERWT9 DNA-directed RNA polymerase subunit beta' OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpoC PE=3 SV=1 242 867 5.0E-50
sp|A9MHE9|RPOC_SALAR DNA-directed RNA polymerase subunit beta' OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpoC PE=3 SV=1 242 867 5.0E-50
sp|B0BSF6|RPOC_ACTPJ DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpoC PE=3 SV=1 19 867 5.0E-50
sp|B3GYV5|RPOC_ACTP7 DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpoC PE=3 SV=1 19 867 5.0E-50
sp|Q5PK92|RPOC_SALPA DNA-directed RNA polymerase subunit beta' OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpoC PE=3 SV=1 242 867 5.0E-50
sp|Q9JX03|RPOC_NEIMA DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpoC PE=3 SV=1 1 881 6.0E-50
sp|Q7VJ82|RPOBC_HELHP Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpoBC PE=3 SV=1 14 864 6.0E-50
sp|A0L5W7|RPOC_MAGMM DNA-directed RNA polymerase subunit beta' OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpoC PE=3 SV=1 6 865 7.0E-50
sp|Q9ZK23|RPOBC_HELPJ Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpoBC PE=3 SV=1 242 867 8.0E-50
sp|O25806|RPOBC_HELPY Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpoBC PE=1 SV=1 242 867 8.0E-50
sp|B0RU88|RPOC_XANCB DNA-directed RNA polymerase subunit beta' OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpoC PE=3 SV=1 19 862 8.0E-50
sp|Q17VN6|RPOBC_HELAH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter acinonychis (strain Sheeba) GN=rpoBC PE=3 SV=1 242 867 9.0E-50
sp|A3N326|RPOC_ACTP2 DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpoC PE=3 SV=1 19 867 9.0E-50
sp|Q5X865|RPOC_LEGPA DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Paris) GN=rpoC PE=3 SV=1 19 867 1.0E-49
sp|A1WK56|RPOC_VEREI DNA-directed RNA polymerase subunit beta' OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpoC PE=3 SV=1 12 862 1.0E-49
sp|Q3Z8V3|RPOC_DEHM1 DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpoC PE=3 SV=1 242 862 1.0E-49
sp|Q8KTH8|RPOC_XANOR DNA-directed RNA polymerase subunit beta' OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpoC PE=1 SV=2 19 862 1.0E-49
sp|B2SQQ2|RPOC_XANOP DNA-directed RNA polymerase subunit beta' OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpoC PE=3 SV=1 19 862 1.0E-49
sp|Q2NZX9|RPOC_XANOM DNA-directed RNA polymerase subunit beta' OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpoC PE=3 SV=1 19 862 1.0E-49
sp|Q8PC55|RPOC_XANCP DNA-directed RNA polymerase subunit beta' OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpoC PE=3 SV=1 19 862 1.0E-49
sp|Q4URD3|RPOC_XANC8 DNA-directed RNA polymerase subunit beta' OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpoC PE=3 SV=1 19 862 1.0E-49
sp|P0C0D9|RPOC_STRPY DNA-directed RNA polymerase subunit beta' (Fragment) OS=Streptococcus pyogenes GN=rpoC PE=3 SV=1 83 874 1.0E-49
sp|Q3ATP4|RPOC_CHLCH DNA-directed RNA polymerase subunit beta' OS=Chlorobium chlorochromatii (strain CaD3) GN=rpoC PE=3 SV=1 4 871 1.0E-49
sp|A5IHS0|RPOC_LEGPC DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Corby) GN=rpoC PE=3 SV=2 19 862 1.0E-49
sp|Q82T76|RPOC_NITEU DNA-directed RNA polymerase subunit beta' OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpoC PE=3 SV=1 17 881 1.0E-49
sp|O28390|RPOA2_ARCFU DNA-directed RNA polymerase subunit A'' OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpoA2 PE=3 SV=1 1042 1467 1.0E-49
sp|Q3BWZ0|RPOC_XANC5 DNA-directed RNA polymerase subunit beta' OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpoC PE=3 SV=1 19 862 2.0E-49
sp|Q8PNS9|RPOC_XANAC DNA-directed RNA polymerase subunit beta' OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpoC PE=3 SV=1 19 862 2.0E-49
sp|Q5ZYP9|RPOC_LEGPH DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpoC PE=3 SV=2 19 862 2.0E-49
sp|Q5WZL8|RPOC_LEGPL DNA-directed RNA polymerase subunit beta' OS=Legionella pneumophila (strain Lens) GN=rpoC PE=3 SV=1 19 862 2.0E-49
sp|Q7NQE7|RPOC_CHRVO DNA-directed RNA polymerase subunit beta' OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpoC PE=3 SV=1 19 890 2.0E-49
sp|Q3J8Q8|RPOC_NITOC DNA-directed RNA polymerase subunit beta' OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpoC PE=3 SV=1 242 885 2.0E-49
sp|Q5F5R6|RPOC_NEIG1 DNA-directed RNA polymerase subunit beta' OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpoC PE=3 SV=1 1 881 3.0E-49
sp|Q1LSX6|RPOC_BAUCH DNA-directed RNA polymerase subunit beta' OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpoC PE=3 SV=1 242 862 3.0E-49
sp|B4RQW3|RPOC_NEIG2 DNA-directed RNA polymerase subunit beta' OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rpoC PE=3 SV=1 1 881 3.0E-49
sp|B4E5B3|RPOC_BURCJ DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpoC PE=3 SV=1 19 867 3.0E-49
sp|A5GAY2|RPOC_GEOUR DNA-directed RNA polymerase subunit beta' OS=Geobacter uraniireducens (strain Rf4) GN=rpoC PE=3 SV=1 5 861 3.0E-49
sp|A1VTF7|RPOC_POLNA DNA-directed RNA polymerase subunit beta' OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpoC PE=3 SV=1 12 881 3.0E-49
sp|B1Y7H2|RPOC_LEPCP DNA-directed RNA polymerase subunit beta' OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpoC PE=3 SV=1 12 867 3.0E-49
sp|A5ELN6|RPOC_BRASB DNA-directed RNA polymerase subunit beta' OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpoC PE=3 SV=1 1 861 4.0E-49
sp|A4YSI2|RPOC_BRASO DNA-directed RNA polymerase subunit beta' OS=Bradyrhizobium sp. (strain ORS278) GN=rpoC PE=3 SV=1 1 861 4.0E-49
sp|Q0BJ53|RPOC_BURCM DNA-directed RNA polymerase subunit beta' OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpoC PE=3 SV=1 19 867 5.0E-49
sp|B1YRC3|RPOC_BURA4 DNA-directed RNA polymerase subunit beta' OS=Burkholderia ambifaria (strain MC40-6) GN=rpoC PE=3 SV=1 19 867 5.0E-49
sp|Q6DAM9|RPOC_PECAS DNA-directed RNA polymerase subunit beta' OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpoC PE=3 SV=1 242 867 5.0E-49
sp|A9ADI6|RPOC_BURM1 DNA-directed RNA polymerase subunit beta' OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpoC PE=3 SV=1 19 867 5.0E-49
sp|Q3YST4|RPOC_EHRCJ DNA-directed RNA polymerase subunit beta' OS=Ehrlichia canis (strain Jake) GN=rpoC PE=3 SV=1 1 875 5.0E-49
sp|Q5E239|RPOC_VIBF1 DNA-directed RNA polymerase subunit beta' OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpoC PE=3 SV=2 243 867 5.0E-49
sp|B3QBZ9|RPOC_RHOPT DNA-directed RNA polymerase subunit beta' OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpoC PE=3 SV=1 1 861 5.0E-49
sp|Q5D869|NRPE1_ARATH DNA-directed RNA polymerase V subunit 1 OS=Arabidopsis thaliana GN=NRPE1 PE=1 SV=1 213 885 6.0E-49
sp|Q6N4S0|RPOC_RHOPA DNA-directed RNA polymerase subunit beta' OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpoC PE=3 SV=1 1 861 7.0E-49
sp|B6JES1|RPOC_OLICO DNA-directed RNA polymerase subunit beta' OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpoC PE=3 SV=1 1 861 7.0E-49
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 15 862 7.0E-49
sp|B0SUP8|RPOC_CAUSK DNA-directed RNA polymerase subunit beta' OS=Caulobacter sp. (strain K31) GN=rpoC PE=3 SV=1 242 861 8.0E-49
sp|A6W5T1|RPOC_KINRD DNA-directed RNA polymerase subunit beta' OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rpoC PE=3 SV=1 136 871 8.0E-49
sp|B2JIH3|RPOC_BURP8 DNA-directed RNA polymerase subunit beta' OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpoC PE=3 SV=1 19 867 8.0E-49
sp|Q1R0I1|RPOC_CHRSD DNA-directed RNA polymerase subunit beta' OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpoC PE=3 SV=1 243 862 9.0E-49
sp|A5FZX0|RPOC_ACICJ DNA-directed RNA polymerase subunit beta' OS=Acidiphilium cryptum (strain JF-5) GN=rpoC PE=3 SV=1 15 861 1.0E-48
sp|A4JAN3|RPOC_BURVG DNA-directed RNA polymerase subunit beta' OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpoC PE=3 SV=1 19 867 1.0E-48
sp|Q9AAU1|RPOC_CAUCR DNA-directed RNA polymerase subunit beta' OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpoC PE=3 SV=1 242 861 1.0E-48
sp|Q2YB04|RPOC_NITMU DNA-directed RNA polymerase subunit beta' OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpoC PE=3 SV=1 17 862 1.0E-48
sp|B8G4U8|RPOC_CHLAD DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoC PE=3 SV=1 242 862 1.0E-48
sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoC PE=3 SV=1 17 865 1.0E-48
sp|Q9KV29|RPOC_VIBCH DNA-directed RNA polymerase subunit beta' OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpoC PE=3 SV=1 242 862 1.0E-48
sp|A5F3P6|RPOC_VIBC3 DNA-directed RNA polymerase subunit beta' OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpoC PE=3 SV=1 242 862 1.0E-48
sp|B2T758|RPOC_BURPP DNA-directed RNA polymerase subunit beta' OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpoC PE=3 SV=1 6 867 2.0E-48
sp|A5CW24|RPOC_VESOH DNA-directed RNA polymerase subunit beta' OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpoC PE=3 SV=1 19 862 2.0E-48
sp|B9KFG8|RPOC_CAMLR DNA-directed RNA polymerase subunit beta' OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpoC PE=3 SV=1 242 867 2.0E-48
sp|Q39KH4|RPOC_BURL3 DNA-directed RNA polymerase subunit beta' OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpoC PE=3 SV=1 19 867 2.0E-48
sp|Q89J75|RPOC_BRADU DNA-directed RNA polymerase subunit beta' OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpoC PE=3 SV=1 1 861 2.0E-48
sp|B5EFP4|RPOC_GEOBB DNA-directed RNA polymerase subunit beta' OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpoC PE=3 SV=1 26 861 2.0E-48
sp|A5FRK6|RPOC_DEHMB DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpoC PE=3 SV=2 242 862 2.0E-48
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 17 874 2.0E-48
sp|Q3ZX00|RPOC_DEHMC DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpoC PE=3 SV=1 242 862 3.0E-48
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 82 865 3.0E-48
sp|Q9X6Y2|RPOC_AQUPY DNA-directed RNA polymerase subunit beta' OS=Aquifex pyrophilus GN=rpoC PE=3 SV=1 194 863 3.0E-48
sp|B1GZ76|RPOC_UNCTG DNA-directed RNA polymerase subunit beta' OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpoC PE=3 SV=1 236 870 3.0E-48
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 13 865 3.0E-48
sp|A0K3L8|RPOC_BURCH DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain HI2424) GN=rpoC PE=3 SV=1 19 867 3.0E-48
sp|B1JU15|RPOC_BURCC DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain MC0-3) GN=rpoC PE=3 SV=1 19 867 3.0E-48
sp|Q1BRU1|RPOC_BURCA DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain AU 1054) GN=rpoC PE=3 SV=1 19 867 3.0E-48
sp|Q5FTX8|RPOC_GLUOX DNA-directed RNA polymerase subunit beta' OS=Gluconobacter oxydans (strain 621H) GN=rpoC PE=3 SV=1 15 861 3.0E-48
sp|Q1Q8Q0|RPOC_PSYCK DNA-directed RNA polymerase subunit beta' OS=Psychrobacter cryohalolentis (strain K5) GN=rpoC PE=3 SV=1 242 867 3.0E-48
sp|Q0AF54|RPOC_NITEC DNA-directed RNA polymerase subunit beta' OS=Nitrosomonas eutropha (strain C91) GN=rpoC PE=3 SV=1 17 862 4.0E-48
sp|B9KBJ4|RPOC_THENN DNA-directed RNA polymerase subunit beta' OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpoC PE=3 SV=1 232 1104 4.0E-48
sp|A7MXF0|RPOC_VIBCB DNA-directed RNA polymerase subunit beta' OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpoC PE=3 SV=1 243 862 4.0E-48
sp|Q2GFP4|RPOC_EHRCR DNA-directed RNA polymerase subunit beta' OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpoC PE=3 SV=1 1 875 5.0E-48
sp|Q13TG3|RPOC_BURXL DNA-directed RNA polymerase subunit beta' OS=Burkholderia xenovorans (strain LB400) GN=rpoC PE=3 SV=1 6 867 5.0E-48
sp|C6E4R3|RPOC_GEOSM DNA-directed RNA polymerase subunit beta' OS=Geobacter sp. (strain M21) GN=rpoC PE=3 SV=1 26 861 5.0E-48
sp|O67763|RPOC_AQUAE DNA-directed RNA polymerase subunit beta' OS=Aquifex aeolicus (strain VF5) GN=rpoC PE=3 SV=1 194 871 5.0E-48
sp|Q87KQ5|RPOC_VIBPA DNA-directed RNA polymerase subunit beta' OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpoC PE=3 SV=1 243 862 5.0E-48
sp|Q2IXR9|RPOC_RHOP2 DNA-directed RNA polymerase subunit beta' OS=Rhodopseudomonas palustris (strain HaA2) GN=rpoC PE=3 SV=1 1 888 6.0E-48
sp|Q39Y12|RPOC_GEOMG DNA-directed RNA polymerase subunit beta' OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpoC PE=3 SV=1 5 861 7.0E-48
sp|Q5JE34|RPOA2_THEKO DNA-directed RNA polymerase subunit A'' OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpoA2 PE=1 SV=1 1048 1461 8.0E-48
sp|A1AX74|RPOC_RUTMC DNA-directed RNA polymerase subunit beta' OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpoC PE=3 SV=1 19 867 8.0E-48
sp|Q03PV0|RPOC_LACBA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoC PE=3 SV=1 17 865 9.0E-48
sp|Q123G4|RPOC_POLSJ DNA-directed RNA polymerase subunit beta' OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpoC PE=3 SV=1 12 881 9.0E-48
sp|A9B6J1|RPOC_HERA2 DNA-directed RNA polymerase subunit beta' OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoC PE=3 SV=1 242 862 9.0E-48
sp|Q6MDM0|RPOC_PARUW DNA-directed RNA polymerase subunit beta' OS=Protochlamydia amoebophila (strain UWE25) GN=rpoC PE=3 SV=1 242 933 1.0E-47
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 17 865 1.0E-47
sp|Q5GRY9|RPOBC_WOLTR Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpoBC PE=3 SV=1 14 874 1.0E-47
sp|B8DWJ5|RPOC_BIFA0 DNA-directed RNA polymerase subunit beta' OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpoC PE=3 SV=1 13 935 1.0E-47
sp|Q820D6|RPOC_TROWT DNA-directed RNA polymerase subunit beta' OS=Tropheryma whipplei (strain Twist) GN=rpoC PE=3 SV=1 241 865 1.0E-47
sp|A8GV25|RPOC_RICB8 DNA-directed RNA polymerase subunit beta' OS=Rickettsia bellii (strain OSU 85-389) GN=rpoC PE=3 SV=2 242 861 1.0E-47
sp|Q2S1Q6|RPOC_SALRD DNA-directed RNA polymerase subunit beta' OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpoC PE=3 SV=1 19 871 1.0E-47
sp|Q21M92|RPOC_SACD2 DNA-directed RNA polymerase subunit beta' OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpoC PE=3 SV=1 4 862 1.0E-47
sp|B3E7S9|RPOC_GEOLS DNA-directed RNA polymerase subunit beta' OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpoC PE=3 SV=1 5 881 2.0E-47
sp|A1KB33|RPOC_AZOSB DNA-directed RNA polymerase subunit beta' OS=Azoarcus sp. (strain BH72) GN=rpoC PE=3 SV=1 19 862 2.0E-47
sp|Q1RHD1|RPOC_RICBR DNA-directed RNA polymerase subunit beta' OS=Rickettsia bellii (strain RML369-C) GN=rpoC PE=3 SV=1 242 861 2.0E-47
sp|B7ICR2|RPOC_THEAB DNA-directed RNA polymerase subunit beta' OS=Thermosipho africanus (strain TCF52B) GN=rpoC PE=3 SV=1 219 856 2.0E-47
sp|Q5NPK4|RPOC_ZYMMO DNA-directed RNA polymerase subunit beta' OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpoC PE=3 SV=2 6 871 2.0E-47
sp|Q73IW9|RPOBC_WOLPM Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Wolbachia pipientis wMel GN=rpoBC PE=3 SV=1 18 874 2.0E-47
sp|Q134R9|RPOC_RHOPS DNA-directed RNA polymerase subunit beta' OS=Rhodopseudomonas palustris (strain BisB5) GN=rpoC PE=3 SV=1 1 888 2.0E-47
sp|Q1MPW9|RPOC_LAWIP DNA-directed RNA polymerase subunit beta' OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpoC PE=3 SV=1 242 862 2.0E-47
sp|B4S498|RPOC_PROA2 DNA-directed RNA polymerase subunit beta' OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpoC PE=3 SV=1 242 871 2.0E-47
sp|B3WAM7|RPOC_LACCB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain BL23) GN=rpoC PE=3 SV=1 17 865 3.0E-47
sp|B0BBU5|RPOC_CHLTB DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpoC PE=3 SV=1 235 862 3.0E-47
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 17 865 3.0E-47
sp|A1SEK2|RPOC_NOCSJ DNA-directed RNA polymerase subunit beta' OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoC PE=3 SV=1 136 871 3.0E-47
sp|Q8A470|RPOC_BACTN DNA-directed RNA polymerase subunit beta' OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpoC PE=3 SV=1 242 862 3.0E-47
sp|Q034X1|RPOC_LACC3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain ATCC 334) GN=rpoC PE=3 SV=1 17 865 3.0E-47
sp|A6KYK2|RPOC_BACV8 DNA-directed RNA polymerase subunit beta' OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpoC PE=3 SV=1 242 862 3.0E-47
sp|Q9PK79|RPOC_CHLMU DNA-directed RNA polymerase subunit beta' OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpoC PE=3 SV=1 235 862 3.0E-47
sp|Q7MGS0|RPOC_VIBVY DNA-directed RNA polymerase subunit beta' OS=Vibrio vulnificus (strain YJ016) GN=rpoC PE=3 SV=1 243 862 3.0E-47
sp|Q8DD19|RPOC_VIBVU DNA-directed RNA polymerase subunit beta' OS=Vibrio vulnificus (strain CMCP6) GN=rpoC PE=3 SV=1 243 862 3.0E-47
sp|B0B7N0|RPOC_CHLT2 DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpoC PE=3 SV=1 235 862 3.0E-47
sp|A7IKQ1|RPOC_XANP2 DNA-directed RNA polymerase subunit beta' OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpoC PE=3 SV=1 10 861 3.0E-47
sp|A9IJ22|RPOC_BORPD DNA-directed RNA polymerase subunit beta' OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpoC PE=3 SV=1 19 867 4.0E-47
sp|Q5LMQ6|RPOC_RUEPO DNA-directed RNA polymerase subunit beta' OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpoC PE=3 SV=1 242 865 4.0E-47
sp|Q64NJ8|RPOC_BACFR DNA-directed RNA polymerase subunit beta' OS=Bacteroides fragilis (strain YCH46) GN=rpoC PE=3 SV=1 242 862 4.0E-47
sp|A3MRU6|RPOC_BURM7 DNA-directed RNA polymerase subunit beta' OS=Burkholderia mallei (strain NCTC 10247) GN=rpoC PE=3 SV=1 19 867 4.0E-47
sp|A1V8B1|RPOC_BURMS DNA-directed RNA polymerase subunit beta' OS=Burkholderia mallei (strain SAVP1) GN=rpoC PE=3 SV=1 19 867 4.0E-47
sp|Q62GJ7|RPOC_BURMA DNA-directed RNA polymerase subunit beta' OS=Burkholderia mallei (strain ATCC 23344) GN=rpoC PE=3 SV=1 19 867 4.0E-47
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 972 1466 9.0E-47
sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 972 1466 2.0E-46
sp|F4JXF9|NRPC1_ARATH DNA-directed RNA polymerase III subunit 1 OS=Arabidopsis thaliana GN=NRPC1 PE=2 SV=1 1067 1466 2.0E-46
sp|Q5ZL98|RPC1_CHICK DNA-directed RNA polymerase III subunit RPC1 OS=Gallus gallus GN=POLR3A PE=2 SV=1 1051 1466 2.0E-45
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 1036 1466 1.0E-44
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 1052 1469 2.0E-41
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 1061 1468 1.0E-38
sp|Q196X0|RPB1_IIV3 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-090L PE=3 SV=1 1064 1507 2.0E-32
sp|O55766|RPB1_IIV6 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-176R PE=3 SV=1 11 410 4.0E-30
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 1584 1743 1.0E-28
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1612 1744 4.0E-27
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 1612 1744 5.0E-27
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 1609 1742 2.0E-25
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 1571 1738 5.0E-25
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 1571 1737 1.0E-24
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1584 1711 2.0E-24
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 1584 1711 2.0E-24
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 1583 1736 2.0E-24
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 242 426 3.0E-22
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1048 1175 2.0E-21
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 1324 1471 9.0E-21
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 1571 1712 1.0E-20
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 1064 1136 7.0E-20
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 1070 1168 4.0E-19
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 1350 1466 2.0E-18
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 1324 1466 7.0E-18
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 1067 1161 2.0E-17
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 1064 1131 5.0E-17
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 1020 1161 5.0E-16
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 1068 1171 9.0E-16
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 1344 1466 5.0E-15
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1557 1660 1.0E-14
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 1557 1660 1.0E-14
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 1555 1675 2.0E-14
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 1339 1466 4.0E-14
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 1328 1465 2.0E-13
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 1342 1466 3.0E-13
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 1325 1465 1.0E-12
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 16 112 1.0E-12
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1328 1465 5.0E-12
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 18 125 1.0E-11
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 11 124 2.0E-11
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 16 112 2.0E-11
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 14 150 2.0E-11
sp|A5FRK6|RPOC_DEHMB DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpoC PE=3 SV=2 1079 1457 4.0E-11
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 1043 1123 5.0E-11
sp|Q3ZX00|RPOC_DEHMC DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpoC PE=3 SV=1 1079 1457 7.0E-11
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 14 123 1.0E-10
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 1543 1660 2.0E-10
sp|Q6GZW7|RPB1_FRG3G Putative DNA-directed RNA polymerase 008R OS=Frog virus 3 (isolate Goorha) GN=FV3-008R PE=3 SV=1 1284 1443 5.0E-10
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 12 112 7.0E-10
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 16 112 9.0E-10
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 1543 1661 2.0E-09
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 12 112 2.0E-09
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 1073 1156 6.0E-09
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 1073 1156 6.0E-09
sp|A5I7L3|RPOC_CLOBH DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoC PE=3 SV=1 1073 1156 6.0E-09
sp|A7FZ76|RPOC_CLOB1 DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoC PE=3 SV=1 1073 1156 6.0E-09
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 1073 1169 6.0E-09
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 1073 1156 6.0E-09
sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoC PE=3 SV=1 1065 1120 7.0E-09
sp|Q0AUH3|RPOC_SYNWW DNA-directed RNA polymerase subunit beta' OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoC PE=3 SV=1 1073 1124 7.0E-09
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 12 112 1.0E-08
sp|Q67JT4|RPOC_SYMTH DNA-directed RNA polymerase subunit beta' OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoC PE=3 SV=1 1072 1251 1.0E-08
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 1073 1124 1.0E-08
sp|A6LPQ5|RPOC_CLOB8 DNA-directed RNA polymerase subunit beta' OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoC PE=3 SV=1 1073 1152 1.0E-08
sp|A7GK13|RPOC_BACCN DNA-directed RNA polymerase subunit beta' OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpoC PE=3 SV=1 1073 1120 1.0E-08
sp|P77819|RPOC_BACAN DNA-directed RNA polymerase subunit beta' OS=Bacillus anthracis GN=rpoC PE=3 SV=3 1073 1120 1.0E-08
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 1073 1156 1.0E-08
sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoC PE=3 SV=3 1073 1120 1.0E-08
sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoC PE=3 SV=1 1073 1120 1.0E-08
sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoC PE=3 SV=1 1073 1120 1.0E-08
sp|P77882|RPOC_LISGR DNA-directed RNA polymerase subunit beta' (Fragment) OS=Listeria grayi GN=rpoC PE=3 SV=2 1073 1120 1.0E-08
sp|A0AF64|RPOC_LISW6 DNA-directed RNA polymerase subunit beta' OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoC PE=3 SV=1 1073 1120 1.0E-08
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 1073 1149 2.0E-08
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 1073 1144 2.0E-08
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 1073 1144 2.0E-08
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 1073 1144 2.0E-08
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 1073 1144 2.0E-08
sp|A9KJL3|RPOC_CLOPH DNA-directed RNA polymerase subunit beta' OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpoC PE=3 SV=1 1073 1124 2.0E-08
sp|Q6F0L8|RPOC_MESFL DNA-directed RNA polymerase subunit beta' OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpoC PE=3 SV=1 1055 1122 2.0E-08
sp|P77839|RPOC_BROTH DNA-directed RNA polymerase subunit beta' (Fragment) OS=Brochothrix thermosphacta GN=rpoC PE=3 SV=2 1071 1120 2.0E-08
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 1073 1124 2.0E-08
sp|B1YGU3|RPOC_EXIS2 DNA-directed RNA polymerase subunit beta' OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 1073 1120 3.0E-08
sp|B0TC49|RPOC_HELMI DNA-directed RNA polymerase subunit beta' OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoC PE=3 SV=1 1073 1124 3.0E-08
sp|B2A4D2|RPOC_NATTJ DNA-directed RNA polymerase subunit beta' OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpoC PE=3 SV=1 1076 1124 3.0E-08
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 1032 1124 3.0E-08
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 1072 1124 3.0E-08
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 989 1124 3.0E-08
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|A4XI31|RPOC_CALS8 DNA-directed RNA polymerase subunit beta' OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoC PE=3 SV=2 1073 1124 3.0E-08
sp|A8F977|RPOC_BACP2 DNA-directed RNA polymerase subunit beta' OS=Bacillus pumilus (strain SAFR-032) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoC PE=3 SV=1 1071 1120 3.0E-08
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 1073 1156 3.0E-08
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 1073 1156 3.0E-08
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 1073 1156 3.0E-08
sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoC PE=3 SV=1 1071 1120 3.0E-08
sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q250N9|RPOC_DESHY DNA-directed RNA polymerase subunit beta' OS=Desulfitobacterium hafniense (strain Y51) GN=rpoC PE=3 SV=1 1073 1124 3.0E-08
sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) GN=rpoC PE=1 SV=4 1071 1120 3.0E-08
sp|A7Z0N0|RPOC_BACMF DNA-directed RNA polymerase subunit beta' OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoC PE=3 SV=1 1073 1120 3.0E-08
sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoC PE=3 SV=1 1071 1120 3.0E-08
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 1073 1144 3.0E-08
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 1071 1120 3.0E-08
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 1076 1124 3.0E-08
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 1073 1124 3.0E-08
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 1073 1124 3.0E-08
sp|B8G4U8|RPOC_CHLAD DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoC PE=3 SV=1 1072 1120 3.0E-08
sp|A5D5I3|RPOC_PELTS DNA-directed RNA polymerase subunit beta' OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpoC PE=3 SV=1 1073 1120 4.0E-08
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 1073 1120 4.0E-08
sp|B2UYA4|RPOC_CLOBA DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpoC PE=3 SV=1 1073 1124 4.0E-08
sp|B2TIG9|RPOC_CLOBB DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpoC PE=3 SV=1 1073 1124 4.0E-08
sp|A4J104|RPOC_DESRM DNA-directed RNA polymerase subunit beta' OS=Desulfotomaculum reducens (strain MI-1) GN=rpoC PE=3 SV=1 1073 1120 6.0E-08
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 1073 1124 8.0E-08
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 1555 1651 9.0E-08
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 1595 1708 9.0E-08
sp|A9B6J1|RPOC_HERA2 DNA-directed RNA polymerase subunit beta' OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoC PE=3 SV=1 1072 1120 1.0E-07
sp|Q2RFP0|RPOC_MOOTA DNA-directed RNA polymerase subunit beta' OS=Moorella thermoacetica (strain ATCC 39073) GN=rpoC PE=3 SV=1 1073 1124 2.0E-07
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 1073 1120 2.0E-07
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoC PE=3 SV=2 1073 1120 2.0E-07
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 1072 1120 2.0E-07
sp|P0C0D9|RPOC_STRPY DNA-directed RNA polymerase subunit beta' (Fragment) OS=Streptococcus pyogenes GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 1073 1120 2.0E-07
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|Q9LQ02|NRPD1_ARATH DNA-directed RNA polymerase IV subunit 1 OS=Arabidopsis thaliana GN=NRPD1 PE=1 SV=1 1076 1471 3.0E-07
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 1073 1120 3.0E-07
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 1073 1120 3.0E-07
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 1073 1120 3.0E-07
sp|A1SEK2|RPOC_NOCSJ DNA-directed RNA polymerase subunit beta' OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoC PE=3 SV=1 1072 1120 4.0E-07
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 1073 1120 6.0E-07
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 1073 1120 6.0E-07
sp|B8DWJ5|RPOC_BIFA0 DNA-directed RNA polymerase subunit beta' OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpoC PE=3 SV=1 1072 1120 6.0E-07
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 1073 1120 7.0E-07
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 1073 1120 8.0E-07
sp|Q8EWX0|RPOC_MYCPE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma penetrans (strain HF-2) GN=rpoC PE=3 SV=1 1313 1461 9.0E-07
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 1073 1120 1.0E-06
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 1073 1120 1.0E-06
sp|B2GDX6|RPOC_LACF3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpoC PE=3 SV=1 1073 1120 1.0E-06
sp|B2VG97|RPOC_ERWT9 DNA-directed RNA polymerase subunit beta' OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpoC PE=3 SV=1 1336 1461 1.0E-06
sp|Q7VJ82|RPOBC_HELHP Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpoBC PE=3 SV=1 1066 1108 1.0E-06
sp|Q3Z8V3|RPOC_DEHM1 DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpoC PE=3 SV=1 1079 1120 1.0E-06
sp|O67763|RPOC_AQUAE DNA-directed RNA polymerase subunit beta' OS=Aquifex aeolicus (strain VF5) GN=rpoC PE=3 SV=1 1068 1125 1.0E-06
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 1073 1120 2.0E-06
sp|Q87A33|RPOC_XYLFT DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpoC PE=3 SV=1 1357 1462 2.0E-06
sp|B2IA67|RPOC_XYLF2 DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain M23) GN=rpoC PE=3 SV=1 1357 1462 2.0E-06
sp|Q9PA87|RPOC_XYLFA DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain 9a5c) GN=rpoC PE=3 SV=2 1357 1462 2.0E-06
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 1073 1120 2.0E-06
sp|A6W5T1|RPOC_KINRD DNA-directed RNA polymerase subunit beta' OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rpoC PE=3 SV=1 1072 1120 2.0E-06
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 1073 1120 2.0E-06
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 1073 1120 2.0E-06
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 1073 1130 2.0E-06
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 1325 1479 3.0E-06
sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1 1066 1108 3.0E-06
sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoC PE=3 SV=1 1073 1120 3.0E-06
sp|B3WAM7|RPOC_LACCB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain BL23) GN=rpoC PE=3 SV=1 1073 1120 3.0E-06
sp|Q034X1|RPOC_LACC3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain ATCC 334) GN=rpoC PE=3 SV=1 1073 1120 3.0E-06
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 1357 1461 4.0E-06
sp|C4LBV1|RPOC_TOLAT DNA-directed RNA polymerase subunit beta' OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpoC PE=3 SV=1 1357 1461 5.0E-06
sp|A9KJL3|RPOC_CLOPH DNA-directed RNA polymerase subunit beta' OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpoC PE=3 SV=1 1290 1461 6.0E-06
sp|Q7N9A3|RPOC_PHOLL DNA-directed RNA polymerase subunit beta' OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpoC PE=3 SV=1 1336 1461 6.0E-06
sp|P41185|RPOC_BUCAP DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpoC PE=3 SV=2 1336 1461 8.0E-06
sp|A4SHV0|RPOC_AERS4 DNA-directed RNA polymerase subunit beta' OS=Aeromonas salmonicida (strain A449) GN=rpoC PE=3 SV=1 1336 1461 9.0E-06
sp|A0KQA4|RPOC_AERHH DNA-directed RNA polymerase subunit beta' OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpoC PE=3 SV=1 1336 1461 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0006366 transcription by RNA polymerase II Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016740 transferase activity No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034062 5'-3' RNA polymerase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0090304 nucleic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0097747 RNA polymerase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2809
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6461
Ophiocordyceps australis map64 (Brazil) OphauB2|4439
Ophiocordyceps camponoti-floridani Ophcf2|03360
Ophiocordyceps camponoti-rufipedis Ophun1|5675 (this protein)
Ophiocordyceps kimflemingae Ophio5|2250
Ophiocordyceps subramaniannii Hirsu2|4522

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5675
MANLYFTHSSAPLKTVEEIQFGLMSPEEIKSMSVAHILYAETMEDNKTKPRDGGLNDPLLGSIDRQFKCKTCTQA
MGECPGHFGHIELAKPVYHPGFIRKVKKILECVCHNCSKVLADTSDPEFVTAINTRDPKARFSHVWNVCKKKKRC
ENEDRQNKDKDEEIAQGLKQPLAVENHGGCGNVQPAVRQTALQLKASFEVVQEDGPKRKEQVPITPEMAHGILRR
ISEEDLRNMGLNSDYARPEWMILTVLPVPPPPVRPSISMDGTGTGMRNEDDLTYKLGDIIRANNNVTQAIREGSP
QHIARDFEELLQYHVATYMDNDIAGQPRALQKSGRPIKAIRARLKGKEGRLRGNLMGKRVDFSARTVITGDANIS
LHEVGVPRSIARTLTYPETVTPYNIGKLHQLVENGPNEHPGAKYVIRSDGTRIDLRHHRRAAQISLEYGWKVERH
LMDGDYIIFNRQPSLHKESMMGHRVRVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAEIRELCLVPKN
IVSPQKNGPLMGIVQDSLAGAYKICRRDTFIDKAMVMNLMLWVPNWDGVIPPPAILKPRPRWTGKQIISMIIPKE
ISLNTPEGDSDIPLNDTGLLIQSGQLMYGLMKKKNIGSAAGGIVHLCYNELGPDGAMAFLNGVQQVVTYWLLHSG
HSIGIGDTVPDKQTIEKVQVHIDTQKSEVARLTAQATANELEALPGMNVRATFENKVSMALNQARDQAGTTTQKS
LKDSNNAVTMAESGSKGSSINISQMTALVGQQIVEGKRIPFGFKYRTLPHFTKDDYSPEARGFVENSYLRGLTPS
EFFFHAMAGREGLIDTAVKTAETGYIQRRLVKALEDLSARYDGTVRNSLGDIIQFLYGEDGLDAMCIEKQRLGIL
KMSDGAFEKKYRLDLANPPDWFKTDYEYGNELTGDKASMSLLDEEWEALLSDRRETRLINRTKMGEEMMQLPLNI
GRMIETAKRVFNVKATDRSNLRPSDVIPAVQNVLANMKIVRGGDPISEEADRNATILIKALLRSRLAFKEIVKEH
RLNKLAFDHVLGELQNRWDRSFVSPGEMVGVLAAQSIGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEILNLAKD
IKTPSMGVYLNTPLAKQEEAKKLRSLVEYTNLRSITSVTEIYYDPDIQSTRIAEDVDMVESYFLIPDDTQDTLDQ
QSRWLLRITLDRQKLLDKEIRIDDVAQRIKEEYPNDLAIIFSDNNADEQVIRIRTVKTEDEKDDGGEKRIEDDVM
LKRLEAHLLDTLTLRGVPGVERAFLTKGTRLVEAADGSELAVKDDARCTQWYLDTSGSALQDVLAVDGVDPTRTY
TNDLWQIVEVFGIEAARSALVKELTNVLAFDGSYVNHRHIALLTDVMTYRGSISAVTRHGINRADTGALMRCSFE
ETVEILLEAAASGELDDCRGISENVMLGQMAPMGTGNFDVLLDPKMLETVISDNSRMGLMPGMPANDGEAEGAAT
PYDTGSPMGDSGYMTMNSPAAGNFSPIQGAGSDVQTGFGTEYGGGAGGGFGGIGSLSPYAPRGAASPFNTSPTSP
FGGGAMGGYSPSSPNAGYSPTSPLIDGGGRYAASPSFSPSSPSFSPTSPMLRPTSPASPNYSPTSPSYSPASPSS
PRHYSPTSPAQFNSPTSPSYSPASPNYSPASPNLHGAGATSPSYSPASPSWSPTSPEAYSPTSPGFSRSPGNQQS
PTSPSYSPTSPSFSPRTPGPGSSGNQ*
Coding >Ophun1|5675
ATGGCGAACCTCTACTTCACTCATTCGAGCGCGCCGCTCAAGACGGTCGAGGAGATTCAGTTCGGCCTCATGTCG
CCCGAGGAAATCAAGAGCATGAGCGTCGCCCATATCCTCTATGCCGAAACCATGGAGGACAACAAGACGAAGCCG
CGCGACGGGGGTCTCAACGACCCGCTCCTCGGATCCATCGACCGCCAGTTCAAGTGCAAGACGTGCACCCAGGCC
ATGGGCGAGTGTCCTGGTCATTTCGGTCACATCGAACTCGCCAAGCCCGTCTACCACCCAGGCTTCATCAGAAAG
GTCAAAAAGATCTTGGAGTGTGTTTGCCATAACTGCAGCAAGGTGTTGGCCGATACTAGCGACCCCGAGTTCGTG
ACGGCCATCAACACCAGAGACCCCAAGGCTCGCTTCAGTCACGTCTGGAACGTCTGCAAGAAGAAGAAGAGATGC
GAGAACGAGGATCGACAGAACAAGGACAAGGACGAGGAGATTGCACAGGGTCTCAAGCAGCCTCTCGCCGTTGAG
AACCATGGCGGCTGCGGAAACGTCCAGCCCGCCGTGCGGCAGACGGCCTTGCAGCTCAAGGCCTCGTTCGAGGTT
GTTCAGGAGGACGGTCCTAAGCGAAAGGAACAGGTCCCCATCACTCCGGAGATGGCGCACGGCATCCTGCGCCGC
ATATCCGAGGAGGACCTGCGCAACATGGGGCTCAATTCCGACTACGCTCGTCCCGAGTGGATGATTCTCACGGTG
TTGCCGGTGCCGCCGCCACCGGTGCGCCCTAGCATATCCATGGACGGCACGGGCACGGGCATGCGGAACGAGGAC
GACTTGACGTACAAGCTCGGCGACATCATCCGGGCCAACAACAACGTCACGCAGGCCATCCGAGAGGGCTCTCCT
CAGCACATTGCCCGCGACTTCGAAGAGCTGCTACAGTACCACGTCGCCACCTACATGGACAACGACATTGCTGGA
CAGCCGCGGGCTCTGCAGAAGAGCGGCCGGCCGATCAAGGCCATCCGCGCTCGCTTAAAAGGCAAGGAGGGCCGG
CTGCGAGGCAACTTGATGGGGAAACGTGTCGACTTCTCGGCCCGTACCGTCATCACCGGTGACGCCAACATCTCG
CTCCACGAGGTCGGCGTCCCTCGCAGCATCGCAAGAACGCTGACGTACCCGGAGACGGTGACGCCCTACAACATT
GGCAAGCTGCATCAGCTCGTCGAGAACGGTCCCAACGAACACCCTGGAGCAAAATACGTCATTCGATCCGACGGC
ACGCGCATCGACCTGCGTCATCACAGACGCGCCGCTCAGATCTCGCTCGAGTACGGATGGAAGGTGGAGCGACAT
CTCATGGATGGCGACTACATCATCTTCAACCGTCAGCCGTCGCTTCACAAGGAGTCGATGATGGGCCATCGCGTC
CGCGTCATGCCCTACTCGACCTTTCGGCTGAACCTGTCCGTCACGTCGCCGTACAATGCCGATTTTGACGGCGAC
GAGATGAATCTGCACGTCCCTCAGAGCGAGGAGACTCGCGCCGAGATCAGGGAGCTCTGCCTCGTGCCCAAGAAC
ATCGTCTCGCCGCAGAAGAACGGTCCCCTGATGGGCATCGTCCAGGACAGCTTGGCTGGGGCGTACAAGATTTGC
CGCCGAGACACCTTCATCGACAAGGCCATGGTGATGAACCTCATGCTCTGGGTCCCCAACTGGGATGGCGTCATC
CCCCCTCCGGCCATCCTGAAGCCCCGGCCGCGGTGGACGGGGAAGCAGATCATCAGCATGATCATCCCCAAGGAG
ATTAGCCTCAACACTCCCGAGGGCGACAGTGACATTCCCCTCAACGACACCGGTCTTCTCATCCAGAGCGGTCAG
CTCATGTACGGTCTTATGAAGAAGAAGAACATTGGGTCCGCGGCCGGTGGCATCGTCCATCTCTGCTACAACGAG
CTGGGCCCGGACGGAGCCATGGCTTTCCTCAACGGGGTGCAGCAGGTGGTGACGTACTGGCTCCTGCACAGCGGC
CACAGCATCGGCATCGGCGATACGGTTCCCGACAAGCAGACGATTGAAAAGGTCCAGGTGCACATTGACACGCAA
AAGTCCGAGGTGGCGCGGTTGACGGCCCAGGCGACGGCCAACGAGCTCGAGGCGCTTCCCGGCATGAACGTGCGT
GCCACGTTTGAGAACAAGGTGTCGATGGCCCTCAACCAGGCGCGTGACCAGGCCGGTACGACGACGCAGAAGAGT
TTGAAGGACTCCAACAACGCCGTGACCATGGCCGAGTCCGGCTCCAAGGGCTCGTCCATCAACATCTCCCAGATG
ACGGCGCTGGTGGGACAGCAGATTGTCGAGGGCAAGCGAATCCCGTTTGGCTTCAAGTACCGGACGCTGCCGCAC
TTTACAAAGGACGATTACTCGCCCGAGGCCCGGGGCTTCGTGGAGAACTCGTATCTCCGCGGTCTGACGCCCAGC
GAGTTCTTCTTCCACGCCATGGCCGGTCGAGAAGGTCTCATCGACACGGCGGTCAAGACGGCCGAGACGGGATAC
ATCCAGCGGCGGCTGGTCAAGGCGCTCGAGGATCTCAGCGCGAGGTACGACGGAACCGTCCGCAACTCCCTGGGG
GATATCATTCAGTTCCTGTACGGCGAGGACGGCTTGGATGCCATGTGCATCGAGAAGCAGAGGCTGGGCATCCTT
AAGATGTCGGACGGCGCGTTCGAGAAAAAGTACCGGCTGGACCTGGCCAACCCGCCCGACTGGTTCAAGACAGAC
TACGAATACGGCAACGAGCTGACGGGTGACAAGGCGTCCATGTCGCTGCTGGACGAGGAGTGGGAGGCTCTGCTG
AGCGACAGGCGCGAGACGCGGCTGATCAACCGCACCAAGATGGGCGAGGAGATGATGCAGCTGCCGCTCAACATC
GGGCGGATGATTGAGACGGCCAAGCGCGTGTTCAACGTCAAGGCGACGGACCGAAGCAACCTTCGTCCATCGGAC
GTGATCCCCGCGGTCCAGAACGTGCTCGCCAACATGAAGATTGTGCGAGGCGGGGATCCCATCTCTGAGGAGGCG
GACAGGAACGCGACGATCCTGATCAAGGCCCTGCTGCGGTCTCGACTGGCCTTTAAGGAGATTGTCAAGGAGCAC
CGGCTCAACAAGCTCGCGTTCGACCACGTCCTGGGCGAGCTGCAGAACCGCTGGGACCGATCGTTTGTGAGCCCC
GGCGAGATGGTGGGCGTGCTGGCGGCGCAGTCGATTGGCGAGCCGGCGACGCAGATGACGCTCAACACGTTCCAT
TTTGCCGGTGTCTCGTCCAAGAACGTGACGCTGGGTGTGCCCCGGCTCAAGGAGATTCTCAATCTGGCCAAGGAC
ATCAAGACTCCAAGCATGGGAGTCTACCTGAACACACCGCTGGCGAAGCAGGAGGAAGCCAAGAAGCTCCGCAGC
CTGGTCGAGTACACGAACCTGCGGTCCATCACGTCGGTGACGGAGATTTACTACGATCCGGACATTCAGTCGACC
AGGATCGCCGAGGACGTTGACATGGTGGAGTCGTACTTTTTGATCCCGGACGACACGCAAGATACGCTCGATCAG
CAGTCGAGATGGCTGCTCCGCATCACGCTGGACCGGCAGAAGCTGCTGGACAAGGAGATACGGATCGACGACGTG
GCGCAGCGTATCAAGGAGGAGTACCCCAACGACCTCGCCATCATCTTCAGCGACAACAATGCGGATGAGCAGGTG
ATTCGGATCCGGACCGTTAAGACGGAGGACGAAAAGGACGACGGCGGGGAGAAGCGGATCGAGGACGACGTGATG
CTCAAGAGACTCGAGGCTCACTTGCTGGACACGCTGACGCTCCGTGGCGTGCCGGGCGTCGAGAGGGCCTTTCTC
ACCAAGGGCACGCGGCTCGTCGAGGCGGCCGACGGATCGGAGCTGGCGGTCAAGGACGACGCGAGATGCACGCAG
TGGTATCTGGATACCAGCGGATCGGCGCTGCAGGACGTGCTGGCGGTCGACGGCGTGGATCCGACGCGGACGTAC
ACCAACGACCTGTGGCAGATTGTCGAGGTGTTTGGCATCGAGGCGGCTCGGTCGGCGCTGGTCAAGGAGTTGACC
AACGTGTTGGCGTTTGACGGGTCCTACGTCAACCATCGGCACATTGCGCTGCTGACGGACGTCATGACGTACCGG
GGAAGCATCTCGGCGGTGACGCGACACGGCATCAACCGGGCCGACACGGGCGCTCTGATGCGATGCTCGTTTGAG
GAGACGGTCGAGATCCTACTCGAGGCGGCCGCTTCGGGCGAGCTGGACGACTGCCGGGGCATATCGGAGAACGTG
ATGCTGGGACAGATGGCGCCCATGGGCACGGGCAACTTTGACGTGCTGCTGGACCCCAAGATGCTGGAGACGGTC
ATCTCGGACAACTCGCGCATGGGGCTGATGCCGGGAATGCCGGCCAACGACGGGGAGGCCGAGGGAGCTGCCACG
CCGTACGACACGGGGTCTCCCATGGGCGACTCGGGCTACATGACGATGAACTCTCCGGCGGCCGGCAACTTCTCG
CCCATCCAGGGCGCGGGCTCGGACGTGCAGACGGGCTTCGGCACCGAGTACGGAGGCGGAGCGGGCGGTGGATTC
GGCGGCATCGGGTCACTGAGTCCGTACGCGCCTCGGGGGGCGGCGAGTCCGTTCAACACGTCGCCGACTTCTCCG
TTCGGAGGCGGTGCAATGGGAGGATACTCGCCGTCTTCGCCCAACGCCGGATACTCGCCGACTTCGCCGCTCATC
GACGGGGGAGGACGTTATGCGGCCTCACCCTCGTTCAGCCCGTCGTCGCCCAGCTTCTCTCCGACGTCGCCGATG
CTGCGGCCGACGAGCCCGGCGAGTCCCAACTACAGCCCGACCTCGCCATCGTACTCTCCGGCATCGCCGTCTTCG
CCTCGGCACTACTCGCCCACGTCACCGGCTCAGTTCAACTCGCCCACGTCGCCGTCTTACTCGCCGGCAAGCCCC
AACTACAGCCCGGCGTCGCCGAACCTGCACGGGGCGGGCGCCACTTCGCCGTCTTACTCGCCCGCCTCGCCTTCC
TGGTCGCCGACGTCTCCGGAGGCGTACTCGCCCACCAGTCCGGGCTTCTCGCGGAGTCCGGGCAATCAGCAGTCG
CCGACGAGCCCGAGCTACTCGCCCACGTCGCCGTCGTTTTCGCCGCGCACTCCGGGGCCGGGCTCGTCTGGGAAT
CAATAG
Transcript >Ophun1|5675
ATGGCGAACCTCTACTTCACTCATTCGAGCGCGCCGCTCAAGACGGTCGAGGAGATTCAGTTCGGCCTCATGTCG
CCCGAGGAAATCAAGAGCATGAGCGTCGCCCATATCCTCTATGCCGAAACCATGGAGGACAACAAGACGAAGCCG
CGCGACGGGGGTCTCAACGACCCGCTCCTCGGATCCATCGACCGCCAGTTCAAGTGCAAGACGTGCACCCAGGCC
ATGGGCGAGTGTCCTGGTCATTTCGGTCACATCGAACTCGCCAAGCCCGTCTACCACCCAGGCTTCATCAGAAAG
GTCAAAAAGATCTTGGAGTGTGTTTGCCATAACTGCAGCAAGGTGTTGGCCGATACTAGCGACCCCGAGTTCGTG
ACGGCCATCAACACCAGAGACCCCAAGGCTCGCTTCAGTCACGTCTGGAACGTCTGCAAGAAGAAGAAGAGATGC
GAGAACGAGGATCGACAGAACAAGGACAAGGACGAGGAGATTGCACAGGGTCTCAAGCAGCCTCTCGCCGTTGAG
AACCATGGCGGCTGCGGAAACGTCCAGCCCGCCGTGCGGCAGACGGCCTTGCAGCTCAAGGCCTCGTTCGAGGTT
GTTCAGGAGGACGGTCCTAAGCGAAAGGAACAGGTCCCCATCACTCCGGAGATGGCGCACGGCATCCTGCGCCGC
ATATCCGAGGAGGACCTGCGCAACATGGGGCTCAATTCCGACTACGCTCGTCCCGAGTGGATGATTCTCACGGTG
TTGCCGGTGCCGCCGCCACCGGTGCGCCCTAGCATATCCATGGACGGCACGGGCACGGGCATGCGGAACGAGGAC
GACTTGACGTACAAGCTCGGCGACATCATCCGGGCCAACAACAACGTCACGCAGGCCATCCGAGAGGGCTCTCCT
CAGCACATTGCCCGCGACTTCGAAGAGCTGCTACAGTACCACGTCGCCACCTACATGGACAACGACATTGCTGGA
CAGCCGCGGGCTCTGCAGAAGAGCGGCCGGCCGATCAAGGCCATCCGCGCTCGCTTAAAAGGCAAGGAGGGCCGG
CTGCGAGGCAACTTGATGGGGAAACGTGTCGACTTCTCGGCCCGTACCGTCATCACCGGTGACGCCAACATCTCG
CTCCACGAGGTCGGCGTCCCTCGCAGCATCGCAAGAACGCTGACGTACCCGGAGACGGTGACGCCCTACAACATT
GGCAAGCTGCATCAGCTCGTCGAGAACGGTCCCAACGAACACCCTGGAGCAAAATACGTCATTCGATCCGACGGC
ACGCGCATCGACCTGCGTCATCACAGACGCGCCGCTCAGATCTCGCTCGAGTACGGATGGAAGGTGGAGCGACAT
CTCATGGATGGCGACTACATCATCTTCAACCGTCAGCCGTCGCTTCACAAGGAGTCGATGATGGGCCATCGCGTC
CGCGTCATGCCCTACTCGACCTTTCGGCTGAACCTGTCCGTCACGTCGCCGTACAATGCCGATTTTGACGGCGAC
GAGATGAATCTGCACGTCCCTCAGAGCGAGGAGACTCGCGCCGAGATCAGGGAGCTCTGCCTCGTGCCCAAGAAC
ATCGTCTCGCCGCAGAAGAACGGTCCCCTGATGGGCATCGTCCAGGACAGCTTGGCTGGGGCGTACAAGATTTGC
CGCCGAGACACCTTCATCGACAAGGCCATGGTGATGAACCTCATGCTCTGGGTCCCCAACTGGGATGGCGTCATC
CCCCCTCCGGCCATCCTGAAGCCCCGGCCGCGGTGGACGGGGAAGCAGATCATCAGCATGATCATCCCCAAGGAG
ATTAGCCTCAACACTCCCGAGGGCGACAGTGACATTCCCCTCAACGACACCGGTCTTCTCATCCAGAGCGGTCAG
CTCATGTACGGTCTTATGAAGAAGAAGAACATTGGGTCCGCGGCCGGTGGCATCGTCCATCTCTGCTACAACGAG
CTGGGCCCGGACGGAGCCATGGCTTTCCTCAACGGGGTGCAGCAGGTGGTGACGTACTGGCTCCTGCACAGCGGC
CACAGCATCGGCATCGGCGATACGGTTCCCGACAAGCAGACGATTGAAAAGGTCCAGGTGCACATTGACACGCAA
AAGTCCGAGGTGGCGCGGTTGACGGCCCAGGCGACGGCCAACGAGCTCGAGGCGCTTCCCGGCATGAACGTGCGT
GCCACGTTTGAGAACAAGGTGTCGATGGCCCTCAACCAGGCGCGTGACCAGGCCGGTACGACGACGCAGAAGAGT
TTGAAGGACTCCAACAACGCCGTGACCATGGCCGAGTCCGGCTCCAAGGGCTCGTCCATCAACATCTCCCAGATG
ACGGCGCTGGTGGGACAGCAGATTGTCGAGGGCAAGCGAATCCCGTTTGGCTTCAAGTACCGGACGCTGCCGCAC
TTTACAAAGGACGATTACTCGCCCGAGGCCCGGGGCTTCGTGGAGAACTCGTATCTCCGCGGTCTGACGCCCAGC
GAGTTCTTCTTCCACGCCATGGCCGGTCGAGAAGGTCTCATCGACACGGCGGTCAAGACGGCCGAGACGGGATAC
ATCCAGCGGCGGCTGGTCAAGGCGCTCGAGGATCTCAGCGCGAGGTACGACGGAACCGTCCGCAACTCCCTGGGG
GATATCATTCAGTTCCTGTACGGCGAGGACGGCTTGGATGCCATGTGCATCGAGAAGCAGAGGCTGGGCATCCTT
AAGATGTCGGACGGCGCGTTCGAGAAAAAGTACCGGCTGGACCTGGCCAACCCGCCCGACTGGTTCAAGACAGAC
TACGAATACGGCAACGAGCTGACGGGTGACAAGGCGTCCATGTCGCTGCTGGACGAGGAGTGGGAGGCTCTGCTG
AGCGACAGGCGCGAGACGCGGCTGATCAACCGCACCAAGATGGGCGAGGAGATGATGCAGCTGCCGCTCAACATC
GGGCGGATGATTGAGACGGCCAAGCGCGTGTTCAACGTCAAGGCGACGGACCGAAGCAACCTTCGTCCATCGGAC
GTGATCCCCGCGGTCCAGAACGTGCTCGCCAACATGAAGATTGTGCGAGGCGGGGATCCCATCTCTGAGGAGGCG
GACAGGAACGCGACGATCCTGATCAAGGCCCTGCTGCGGTCTCGACTGGCCTTTAAGGAGATTGTCAAGGAGCAC
CGGCTCAACAAGCTCGCGTTCGACCACGTCCTGGGCGAGCTGCAGAACCGCTGGGACCGATCGTTTGTGAGCCCC
GGCGAGATGGTGGGCGTGCTGGCGGCGCAGTCGATTGGCGAGCCGGCGACGCAGATGACGCTCAACACGTTCCAT
TTTGCCGGTGTCTCGTCCAAGAACGTGACGCTGGGTGTGCCCCGGCTCAAGGAGATTCTCAATCTGGCCAAGGAC
ATCAAGACTCCAAGCATGGGAGTCTACCTGAACACACCGCTGGCGAAGCAGGAGGAAGCCAAGAAGCTCCGCAGC
CTGGTCGAGTACACGAACCTGCGGTCCATCACGTCGGTGACGGAGATTTACTACGATCCGGACATTCAGTCGACC
AGGATCGCCGAGGACGTTGACATGGTGGAGTCGTACTTTTTGATCCCGGACGACACGCAAGATACGCTCGATCAG
CAGTCGAGATGGCTGCTCCGCATCACGCTGGACCGGCAGAAGCTGCTGGACAAGGAGATACGGATCGACGACGTG
GCGCAGCGTATCAAGGAGGAGTACCCCAACGACCTCGCCATCATCTTCAGCGACAACAATGCGGATGAGCAGGTG
ATTCGGATCCGGACCGTTAAGACGGAGGACGAAAAGGACGACGGCGGGGAGAAGCGGATCGAGGACGACGTGATG
CTCAAGAGACTCGAGGCTCACTTGCTGGACACGCTGACGCTCCGTGGCGTGCCGGGCGTCGAGAGGGCCTTTCTC
ACCAAGGGCACGCGGCTCGTCGAGGCGGCCGACGGATCGGAGCTGGCGGTCAAGGACGACGCGAGATGCACGCAG
TGGTATCTGGATACCAGCGGATCGGCGCTGCAGGACGTGCTGGCGGTCGACGGCGTGGATCCGACGCGGACGTAC
ACCAACGACCTGTGGCAGATTGTCGAGGTGTTTGGCATCGAGGCGGCTCGGTCGGCGCTGGTCAAGGAGTTGACC
AACGTGTTGGCGTTTGACGGGTCCTACGTCAACCATCGGCACATTGCGCTGCTGACGGACGTCATGACGTACCGG
GGAAGCATCTCGGCGGTGACGCGACACGGCATCAACCGGGCCGACACGGGCGCTCTGATGCGATGCTCGTTTGAG
GAGACGGTCGAGATCCTACTCGAGGCGGCCGCTTCGGGCGAGCTGGACGACTGCCGGGGCATATCGGAGAACGTG
ATGCTGGGACAGATGGCGCCCATGGGCACGGGCAACTTTGACGTGCTGCTGGACCCCAAGATGCTGGAGACGGTC
ATCTCGGACAACTCGCGCATGGGGCTGATGCCGGGAATGCCGGCCAACGACGGGGAGGCCGAGGGAGCTGCCACG
CCGTACGACACGGGGTCTCCCATGGGCGACTCGGGCTACATGACGATGAACTCTCCGGCGGCCGGCAACTTCTCG
CCCATCCAGGGCGCGGGCTCGGACGTGCAGACGGGCTTCGGCACCGAGTACGGAGGCGGAGCGGGCGGTGGATTC
GGCGGCATCGGGTCACTGAGTCCGTACGCGCCTCGGGGGGCGGCGAGTCCGTTCAACACGTCGCCGACTTCTCCG
TTCGGAGGCGGTGCAATGGGAGGATACTCGCCGTCTTCGCCCAACGCCGGATACTCGCCGACTTCGCCGCTCATC
GACGGGGGAGGACGTTATGCGGCCTCACCCTCGTTCAGCCCGTCGTCGCCCAGCTTCTCTCCGACGTCGCCGATG
CTGCGGCCGACGAGCCCGGCGAGTCCCAACTACAGCCCGACCTCGCCATCGTACTCTCCGGCATCGCCGTCTTCG
CCTCGGCACTACTCGCCCACGTCACCGGCTCAGTTCAACTCGCCCACGTCGCCGTCTTACTCGCCGGCAAGCCCC
AACTACAGCCCGGCGTCGCCGAACCTGCACGGGGCGGGCGCCACTTCGCCGTCTTACTCGCCCGCCTCGCCTTCC
TGGTCGCCGACGTCTCCGGAGGCGTACTCGCCCACCAGTCCGGGCTTCTCGCGGAGTCCGGGCAATCAGCAGTCG
CCGACGAGCCCGAGCTACTCGCCCACGTCGCCGTCGTTTTCGCCGCGCACTCCGGGGCCGGGCTCGTCTGGGAAT
CAATAG
Gene >Ophun1|5675
ATGGCGAACCTCTACTTCACTCATTCGAGCGCGCCGCTCAAGACGGTCGAGGAGATTCAGTTCGGCCTCATGTCG
CCCGAGGAAATCAAGAGCATGAGCGTCGCCCATATCCTCTATGCCGAAACCATGGAGGACAACAAGACGAAGCCG
CGCGACGGGGGTCTCAACGACCCGCTCCTCGGATCCATCGACCGCCAGTTCAAGTGCAAGACGTGCACCCAGGCC
ATGGGCGAGTGTCCTGGTCATTTCGGTCACATCGAACTCGCCAAGCCCGTCTACCACCCAGGCTTCATCAGAAAG
GTCAAAAAGATCTTGGAGTGTGTTTGCCATAACTGCAGCAAGGTGTTGGCCGATACTGTCAGTTTATGCTTCCCT
CTTCAAGGTCTGTTTTGTCGCTGAATGATGTTTGCTGACGCGTTGTCTTTTTTGTAGAGCGACCCCGAGTTCGTG
ACGGCCATCAACACCAGAGACCCCAAGGCTCGCTTCAGTCACGTCTGGAACGTCTGCAAGAAGAAGAAGAGATGC
GAGAACGAGGATCGACAGAACAAGGACAAGGACGAGGAGATTGCACAGGGTCTCAAGCAGCCTCTCGCCGTTGAG
AACCATGGCGGCTGCGGAAACGTCCAGCCCGCCGTGCGGCAGACGGCCTTGCAGCTCAAGGCCTCGTTCGAGGTT
GTTCAGGAGGACGGTCCTAAGCGAAAGGAACAGGTCCCCATCACTCCGGAGATGGCGCACGGCATCCTGCGCCGC
ATATCCGAGGAGGACCTGCGCAACATGGGGCTCAATTCCGACTACGCTCGTCCCGAGTGGATGATTCTCACGGTG
TTGCCGGTGCCGCCGCCACCGGTGCGCCCTAGCATATCCATGGACGGCACGGGCACGGGCATGCGGAACGAGGAC
GACTTGACGTACAAGCTCGGCGACATCATCCGGGCCAACAACAACGTCACGCAGGCCATCCGAGAGGGCTCTCCT
CAGCACATTGCCCGCGACTTCGAAGAGCTGCTACAGTACCACGTCGCCACCTACATGGACAACGACATTGCTGGA
CAGCCGCGGGCTCTGCAGAAGAGCGGCCGGCCGATCAAGGCCATCCGCGCTCGCTTAAAAGGCAAGGAGGGCCGG
CTGCGAGGCAACTTGATGGGGAAACGTGTCGACTTCTCGGCCCGTACCGTCATCACCGGTGACGCCAACATCTCG
CTCCACGAGGTCGGCGTCCCTCGCAGCATCGCAAGAACGCTGACGTACCCGGAGACGGTGACGCCCTACAACATT
GGCAAGCTGCATCAGCTCGTCGAGAACGGTCCCAACGAACACCCTGGAGCAAAATACGTCATTCGATCCGACGGC
ACGCGCATCGACCTGCGTCATCACAGACGCGCCGCTCAGATCTCGCTCGAGTACGGATGGAAGGTGGAGCGACAT
CTCATGGATGGCGACTACATCATCTTCAACCGTCAGCCGTCGCTTCACAAGGAGTCGATGATGGGCCATCGCGTC
CGCGTCATGCCCTACTCGACCTTTCGGCTGAACCTGTCCGTCACGTCGCCGTACAATGCCGATTTTGACGGCGAC
GAGATGAATCTGCACGTCCCTCAGAGCGAGGAGACTCGCGCCGAGATCAGGGAGCTCTGCCTCGTGCCCAAGAAC
ATCGTCTCGCCGCAGAAGAACGGTCCCCTGATGGGCATCGTCCAGGACAGCTTGGCTGGGGCGTACAAGATTTGC
CGCCGAGACACCTTCATCGACAAGGCCATGGTGATGAACCTCATGCTCTGGGTCCCCAACTGGGATGGCGTCATC
CCCCCTCCGGCCATCCTGAAGCCCCGGCCGCGGTGGACGGGGAAGCAGATCATCAGCATGATCATCCCCAAGGAG
ATTAGCCTCAACACTCCCGAGGGCGACAGTGACATTCCCCTCAACGACACCGGTCTTCTCATCCAGAGCGGTCAG
CTCATGTACGGTCTTATGAAGAAGAAGAACATTGGGTCCGCGGCCGGTGGCATCGTCCATCTCTGCTACAACGAG
CTGGGCCCGGACGGAGCCATGGCTTTCCTCAACGGGGTGCAGCAGGTGGTGACGTACTGGCTCCTGCACAGCGGC
CACAGCATCGGCATCGGCGATACGGTTCCCGACAAGCAGACGATTGAAAAGGTCCAGGTGCACATTGACACGCAA
AAGTCCGAGGTGGCGCGGTTGACGGCCCAGGCGACGGCCAACGAGCTCGAGGCGCTTCCCGGCATGAACGTGCGT
GCCACGTTTGAGAACAAGGTGTCGATGGCCCTCAACCAGGCGCGTGACCAGGCCGGTACGACGACGCAGAAGAGT
TTGAAGGACTCCAACAACGCCGTGACCATGGCCGAGTCCGGCTCCAAGGGCTCGTCCATCAACATCTCCCAGATG
ACGGCGCTGGTGGGACAGCAGATTGTCGAGGGCAAGCGAATCCCGTTTGGCTTCAAGTACCGGACGCTGCCGCAC
TTTACAAAGGACGATTACTCGCCCGAGGCCCGGGGCTTCGTGGAGAACTCGTATCTCCGCGGTCTGACGCCCAGC
GAGTTCTTCTTCCACGCCATGGCCGGTCGAGAAGGTCTCATCGACACGGCGGTCAAGACGGCCGAGACGGGATAC
ATCCAGCGGCGGCTGGTCAAGGCGCTCGAGGATCTCAGCGCGAGGTACGACGGAACCGTCCGCAACTCCCTGGGG
GATATCATTCAGTTCCTGTACGGCGAGGACGGCTTGGATGCCATGTGCATCGAGAAGCAGAGGCTGGGCATCCTT
AAGATGTCGGACGGCGCGTTCGAGAAAAAGTACCGGCTGGACCTGGCCAACCCGCCCGACTGGTTCAAGACAGAC
TACGAATACGGCAACGAGCTGACGGGTGACAAGGCGTCCATGTCGCTGCTGGACGAGGAGTGGGAGGCTCTGCTG
AGCGACAGGCGCGAGACGCGGCTGATCAACCGCACCAAGATGGGCGAGGAGATGATGCAGCTGCCGCTCAACATC
GGGCGGATGATTGAGACGGCCAAGCGCGTGTTCAACGTCAAGGCGACGGACCGAAGCAACCTTCGTCCATCGGAC
GTGATCCCCGCGGTCCAGAACGTGCTCGCCAACATGAAGATTGTGCGAGGCGGGGATCCCATCTCTGAGGAGGCG
GACAGGAACGCGACGATCCTGATCAAGGCCCTGCTGCGGTCTCGACTGGCCTTTAAGGAGATTGTCAAGGAGCAC
CGGCTCAACAAGCTCGCGTTCGACCACGTCCTGGGCGAGCTGCAGAACCGCTGGGACCGATCGTTTGTGAGCCCC
GGCGAGATGGTGGGCGTGCTGGCGGCGCAGTCGATTGGCGAGCCGGCGACGCAGATGACGCTCAACACGTTCCAT
TTTGCCGGTGTCTCGTCCAAGAACGTGACGCTGGGTGTGCCCCGGCTCAAGGAGATTCTCAATCTGGCCAAGGAC
ATCAAGACTCCAAGCATGGGAGTCTACCTGAACACACCGCTGGCGAAGCAGGAGGAAGCCAAGAAGCTCCGCAGC
CTGGTCGAGTACACGAACCTGCGGTCCATCACGTCGGTGACGGAGATTTACTACGATCCGGACATTCAGTCGACC
AGGATCGCCGAGGACGTTGACATGGTGGAGTCGTACTTTTTGATCCCGGACGACACGCAAGATACGCTCGATCAG
CAGTCGAGATGGCTGCTCCGCATCACGCTGGACCGGCAGAAGCTGCTGGACAAGGAGATACGGATCGACGACGTG
GCGCAGCGTATCAAGGAGGAGTACCCCAACGACCTCGCCATCATCTTCAGCGACAACAATGCGGATGAGCAGGTG
ATTCGGATCCGGACCGTTAAGACGGAGGACGAAAAGGACGACGGCGGGGAGAAGCGGATCGAGGACGACGTGATG
CTCAAGAGACTCGAGGCTCACTTGCTGGACACGCTGACGCTCCGTGGCGTGCCGGGCGTCGAGAGGGCCTTTCTC
ACCAAGGGCACGCGGCTCGTCGAGGCGGCCGACGGATCGGAGCTGGCGGTCAAGGACGACGCGAGATGCACGCAG
TGGTATCTGGATACCAGCGGATCGGCGCTGCAGGACGTGCTGGCGGTCGACGGCGTGGATCCGACGCGGACGTAC
ACCAACGACCTGTGGCAGATTGTCGAGGTGTTTGGCATCGAGGCGGCTCGGTCGGCGCTGGTCAAGGAGTTGACC
AACGTGTTGGCGTTTGACGGGTCCTACGTCAACCATCGGCACATTGCGCTGCTGACGGACGTCATGACGTACCGG
GGAAGCATCTCGGCGGTGACGCGACACGGCATCAACCGGGCCGACACGGGCGCTCTGATGCGATGCTCGTTTGAG
GAGACGGTCGAGATCCTACTCGAGGCGGCCGCTTCGGGCGAGCTGGACGACTGCCGGGGCATATCGGAGAACGTG
ATGCTGGGACAGATGGCGCCCATGGGCACGGGCAACTTTGACGTGCTGCTGGACCCCAAGATGCTGGAGACGGTC
ATCTCGGACAACTCGCGCATGGGGCTGATGCCGGGAATGCCGGCCAACGACGGGGAGGCCGAGGGAGCTGCCACG
CCGTACGACACGGGGTCTCCCATGGGCGACTCGGGCTACATGACGATGAACTCTCCGGCGGCCGGCAACTTCTCG
CCCATCCAGGGCGCGGGCTCGGACGTGCAGACGGGCTTCGGCACCGAGTACGGAGGCGGAGCGGGCGGTGGATTC
GGCGGCATCGGGTCACTGAGTCCGTACGCGCCTCGGGGGGCGGCGAGTCCGTTCAACACGTCGCCGACTTCTCCG
TTCGGAGGCGGTGCAATGGGAGGATACTCGCCGTCTTCGCCCAACGCCGGATACTCGCCGACTTCGCCGCTCATC
GACGGGGGAGGACGTTATGCGGCCTCACCCTCGTTCAGCCCGTCGTCGCCCAGCTTCTCTCCGACGTCGCCGATG
CTGCGGCCGACGAGCCCGGCGAGTCCCAACTACAGCCCGACCTCGCCATCGTACTCTCCGGCATCGCCGTCTTCG
CCTCGGCACTACTCGCCCACGTCACCGGCTCAGTTCAACTCGCCCACGTCGCCGTCTTACTCGCCGGCAAGCCCC
AACTACAGCCCGGCGTCGCCGAACCTGCACGGGGCGGGCGCCACTTCGCCGTCTTACTCGCCCGCCTCGCCTTCC
TGGTCGCCGACGTCTCCGGAGGCGTACTCGCCCACCAGTCCGGGCTTCTCGCGGAGTCCGGGCAATCAGCAGTCG
CCGACGAGCCCGAGCTACTCGCCCACGTCGCCGTCGTTTTCGCCGCGCACTCCGGGGCCGGGCTCGTCTGGGAAT
CAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail