Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5646
Gene name
LocationContig_57:44300..45081
Strand-
Gene length (bp)781
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14555 UBA_4 UBA-like domain 1.5E-05 173 213

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2447
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6922
Ophiocordyceps australis map64 (Brazil) OphauB2|780
Ophiocordyceps camponoti-floridani Ophcf2|04504
Ophiocordyceps camponoti-rufipedis Ophun1|5646 (this protein)
Ophiocordyceps kimflemingae Ophio5|5811
Ophiocordyceps subramaniannii Hirsu2|35

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5646
MESCCTCATLLPSKASISATRLPCCARIVCAPCLQTNRRFATCCPYCQVSTAPSPLPQGLRDPPAYRSVASTRAS
TASAVPPPPPYSPSPAAKARDKEASDIIHFLDHDHDTVSSLSLRYRVPASVLRRANNITSDQLLLGRKTILIPAQ
YCANGVSLSPCPVLGEEEELRKSKIRRFMIACKVADYDVALLYLEQSDYHLRAAVDSYFDDESWERKHPRPQSGD
NAKVGRRQKGRLRPWLGL*
Coding >Ophun1|5646
ATGGAAAGCTGCTGCACCTGCGCCACTCTACTCCCTTCCAAGGCCTCCATCTCCGCCACAAGACTCCCATGCTGC
GCCAGGATCGTCTGCGCCCCCTGCCTCCAAACCAACAGGCGGTTCGCTACCTGCTGTCCCTACTGCCAAGTCTCG
ACCGCGCCCTCGCCTCTGCCGCAGGGACTCCGAGATCCTCCGGCATACAGGTCCGTCGCCTCCACGCGCGCCTCC
ACCGCCTCCGCCGTCCCTCCGCCGCCTCCCTACTCCCCGTCTCCCGCAGCCAAGGCCCGAGACAAGGAGGCGTCC
GACATCATCCACTTCCTTGATCACGACCACGATACCGTCTCGTCCCTCTCCCTCCGCTATCGCGTTCCGGCCTCG
GTCCTGAGACGCGCCAACAACATCACCAGCGACCAGCTGCTCCTCGGCCGCAAGACCATCCTGATCCCCGCCCAA
TATTGCGCGAATGGCGTCAGCTTGTCACCGTGTCCGGTTCTTGGCGAAGAAGAGGAGCTGAGAAAGAGCAAGATT
CGTCGCTTCATGATAGCCTGCAAGGTGGCCGATTATGACGTCGCCCTGCTCTACCTCGAGCAGTCCGACTACCAC
CTGCGCGCCGCCGTAGACTCGTATTTCGACGACGAATCCTGGGAGAGAAAACATCCCCGACCGCAGTCAGGCGAC
AACGCCAAGGTCGGGAGACGGCAAAAGGGGCGCCTTCGTCCGTGGCTAGGACTGTGA
Transcript >Ophun1|5646
ATGGAAAGCTGCTGCACCTGCGCCACTCTACTCCCTTCCAAGGCCTCCATCTCCGCCACAAGACTCCCATGCTGC
GCCAGGATCGTCTGCGCCCCCTGCCTCCAAACCAACAGGCGGTTCGCTACCTGCTGTCCCTACTGCCAAGTCTCG
ACCGCGCCCTCGCCTCTGCCGCAGGGACTCCGAGATCCTCCGGCATACAGGTCCGTCGCCTCCACGCGCGCCTCC
ACCGCCTCCGCCGTCCCTCCGCCGCCTCCCTACTCCCCGTCTCCCGCAGCCAAGGCCCGAGACAAGGAGGCGTCC
GACATCATCCACTTCCTTGATCACGACCACGATACCGTCTCGTCCCTCTCCCTCCGCTATCGCGTTCCGGCCTCG
GTCCTGAGACGCGCCAACAACATCACCAGCGACCAGCTGCTCCTCGGCCGCAAGACCATCCTGATCCCCGCCCAA
TATTGCGCGAATGGCGTCAGCTTGTCACCGTGTCCGGTTCTTGGCGAAGAAGAGGAGCTGAGAAAGAGCAAGATT
CGTCGCTTCATGATAGCCTGCAAGGTGGCCGATTATGACGTCGCCCTGCTCTACCTCGAGCAGTCCGACTACCAC
CTGCGCGCCGCCGTAGACTCGTATTTCGACGACGAATCCTGGGAGAGAAAACATCCCCGACCGCAGTCAGGCGAC
AACGCCAAGGTCGGGAGACGGCAAAAGGGGCGCCTTCGTCCGTGGCTAGGACTGTGA
Gene >Ophun1|5646
ATGGAAAGCTGCTGCACCTGCGCCACTCTACTCCCTTCCAAGGCCTCCATCTCCGCCACAAGACTCCCATGCTGC
GCCAGGATCGTCTGCGCCCCCTGCCTCCAAGTCCGTCCGTCCAGGAAACCCATCTATTCATCCAGTTGACGCCGT
ACAGACCAACAGGCGGTTCGCTACCTGCTGTCCCTACTGCCAAGTCTCGACCGCGCCCTCGCCTCTGCCGCAGGG
ACTCCGAGATCCTCCGGCATACAGGTCCGTCGCCTCCACGCGCGCCTCCACCGCCTCCGCCGTCCCTCCGCCGCC
TCCCTACTCCCCGTCTCCCGCAGCCAAGGCCCGAGACAAGGAGGCGTCCGACATCATCCACTTCCTTGATCACGA
CCACGATACCGTCTCGTCCCTCTCCCTCCGCTATCGCGTTCCGGCCTCGGTCCTGAGACGCGCCAACAACATCAC
CAGCGACCAGCTGCTCCTCGGCCGCAAGACCATCCTGATCCCCGCCCAATATTGCGCGAATGGCGTCAGCTTGTC
ACCGTGTCCGGTTCTTGGCGAAGAAGAGGAGCTGAGAAAGAGCAAGATTCGTCGCTTCATGATAGCCTGCAAGGT
GGCCGATTATGACGTCGCCCTGCTCTACCTCGAGCAGTCCGACTACCACCTGCGCGCCGCCGTAGACTCGTATTT
CGACGACGAATCCTGGGAGAGAAAACATCCCCGACCGCAGTCAGGCGACAACGCCAAGGTCGGGAGACGGCAAAA
GGGGCGCCTTCGTCCGTGGCTAGGACTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail