Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5643
Gene name
LocationContig_57:37314..38386
Strand-
Gene length (bp)1072
Transcript length (bp)957
Coding sequence length (bp)957
Protein length (aa) 319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03388 Lectin_leg-like Legume-like lectin family 4.0E-64 31 250
PF18483 Bact_lectin Bacterial lectin 2.8E-08 48 242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94401|YQF8_SCHPO L-type lectin-like domain-containing protein C126.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.08c PE=3 SV=1 31 252 2.0E-50
sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=1 SV=1 32 314 2.0E-48
sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 32 252 3.0E-48
sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 32 252 3.0E-48
sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 32 252 3.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94401|YQF8_SCHPO L-type lectin-like domain-containing protein C126.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.08c PE=3 SV=1 31 252 2.0E-50
sp|P59481|LMA2L_MOUSE VIP36-like protein OS=Mus musculus GN=Lman2l PE=1 SV=1 32 314 2.0E-48
sp|Q2HJD1|LMA2L_BOVIN VIP36-like protein OS=Bos taurus GN=LMAN2L PE=2 SV=1 32 252 3.0E-48
sp|Q5RCF0|LMA2L_PONAB VIP36-like protein OS=Pongo abelii GN=LMAN2L PE=3 SV=1 32 252 3.0E-48
sp|Q9H0V9|LMA2L_HUMAN VIP36-like protein OS=Homo sapiens GN=LMAN2L PE=1 SV=1 32 252 3.0E-48
sp|Q9DBH5|LMAN2_MOUSE Vesicular integral-membrane protein VIP36 OS=Mus musculus GN=Lman2 PE=1 SV=2 18 247 1.0E-43
sp|P49256|LMAN2_CANLF Vesicular integral-membrane protein VIP36 OS=Canis lupus familiaris GN=LMAN2 PE=1 SV=1 18 247 1.0E-43
sp|Q12907|LMAN2_HUMAN Vesicular integral-membrane protein VIP36 OS=Homo sapiens GN=LMAN2 PE=1 SV=1 18 247 2.0E-43
sp|Q9D0F3|LMAN1_MOUSE Protein ERGIC-53 OS=Mus musculus GN=Lman1 PE=1 SV=1 53 246 1.0E-29
sp|Q62902|LMAN1_RAT Protein ERGIC-53 OS=Rattus norvegicus GN=Lman1 PE=1 SV=1 53 246 1.0E-29
sp|Q9TU32|LMAN1_CHLAE Protein ERGIC-53 OS=Chlorocebus aethiops GN=LMAN1 PE=2 SV=1 53 246 3.0E-28
sp|P49257|LMAN1_HUMAN Protein ERGIC-53 OS=Homo sapiens GN=LMAN1 PE=1 SV=2 2 246 4.0E-28
sp|Q9HAT1|LMA1L_HUMAN Protein ERGIC-53-like OS=Homo sapiens GN=LMAN1L PE=2 SV=2 54 246 1.0E-22
sp|Q8VCD3|LMA1L_MOUSE Protein ERGIC-53-like OS=Mus musculus GN=Lman1l PE=2 SV=2 54 246 2.0E-21
sp|Q5FB95|LMA1L_RAT Protein ERGIC-53-like OS=Rattus norvegicus GN=Lman1l PE=1 SV=1 54 254 2.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 285 307 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5643
MRLPSVSAVLLAALSWRVRADEHDDLKSITLRTHSLQQPYLDSELQSRWFDFGGDTIVRTDSYIRLTSDRASQSG
WLFSRVPLTATNWEIEVEFKISGKNNLYGDGLAMWITKQRGQIGPVFGSIDRFEGLGIFIDTYKNGRQGTSFPYV
MAMAGDGHISYDKSTDGKDHELAGCSARGLRSATMPTKLRLTYVQDKQLRLELQYKVEGEWELCFETTKPPTLPN
VAYLGFSAETGELSDNHDIISVAAKNLYNHPAAAGASSSKQGSSSHGAPPSSLRPRGGSWTWFFTKMMLLIVVVA
GGYAGWTAWRAKSRSHRF*
Coding >Ophun1|5643
ATGAGGCTGCCGTCGGTGTCGGCGGTGCTGCTGGCGGCCCTGAGCTGGAGGGTGCGCGCAGACGAGCACGATGAC
CTCAAGAGCATAACGCTGCGGACGCATAGTCTGCAACAGCCTTATCTTGACTCGGAGTTGCAGAGTCGGTGGTTT
GACTTTGGCGGCGATACCATTGTGCGGACGGATTCATATATTCGCCTCACCTCAGACCGCGCCTCGCAGTCCGGC
TGGCTATTCTCACGCGTGCCACTGACGGCAACAAACTGGGAAATCGAAGTCGAGTTCAAAATCTCTGGCAAAAAC
AACCTCTACGGCGACGGTCTAGCAATGTGGATAACAAAGCAACGCGGCCAAATAGGCCCCGTCTTCGGCTCAATC
GACCGCTTCGAAGGCCTAGGAATCTTCATCGACACGTACAAGAACGGCAGACAAGGGACCTCATTCCCCTACGTC
ATGGCCATGGCCGGCGACGGCCACATCTCGTACGATAAGAGCACCGACGGGAAGGACCACGAGCTGGCCGGCTGT
TCGGCCCGGGGTCTTCGGTCCGCGACCATGCCGACCAAGTTGAGGCTGACGTACGTTCAGGACAAGCAGCTCAGG
CTCGAGTTGCAGTACAAGGTTGAGGGGGAGTGGGAGCTGTGCTTTGAGACGACGAAGCCGCCTACCCTGCCCAAC
GTGGCGTATCTGGGCTTCAGCGCGGAAACGGGCGAGCTGAGCGACAACCACGACATCATCTCCGTCGCAGCCAAG
AATCTATACAACCACCCAGCAGCAGCGGGTGCCTCGTCCTCCAAGCAAGGGTCCTCCTCACACGGCGCACCCCCG
TCATCGTTGAGACCCCGCGGCGGAAGCTGGACCTGGTTCTTCACCAAGATGATGCTGCTCATCGTTGTCGTGGCG
GGTGGTTACGCTGGGTGGACGGCGTGGAGGGCCAAGAGCCGAAGCCATCGGTTCTGA
Transcript >Ophun1|5643
ATGAGGCTGCCGTCGGTGTCGGCGGTGCTGCTGGCGGCCCTGAGCTGGAGGGTGCGCGCAGACGAGCACGATGAC
CTCAAGAGCATAACGCTGCGGACGCATAGTCTGCAACAGCCTTATCTTGACTCGGAGTTGCAGAGTCGGTGGTTT
GACTTTGGCGGCGATACCATTGTGCGGACGGATTCATATATTCGCCTCACCTCAGACCGCGCCTCGCAGTCCGGC
TGGCTATTCTCACGCGTGCCACTGACGGCAACAAACTGGGAAATCGAAGTCGAGTTCAAAATCTCTGGCAAAAAC
AACCTCTACGGCGACGGTCTAGCAATGTGGATAACAAAGCAACGCGGCCAAATAGGCCCCGTCTTCGGCTCAATC
GACCGCTTCGAAGGCCTAGGAATCTTCATCGACACGTACAAGAACGGCAGACAAGGGACCTCATTCCCCTACGTC
ATGGCCATGGCCGGCGACGGCCACATCTCGTACGATAAGAGCACCGACGGGAAGGACCACGAGCTGGCCGGCTGT
TCGGCCCGGGGTCTTCGGTCCGCGACCATGCCGACCAAGTTGAGGCTGACGTACGTTCAGGACAAGCAGCTCAGG
CTCGAGTTGCAGTACAAGGTTGAGGGGGAGTGGGAGCTGTGCTTTGAGACGACGAAGCCGCCTACCCTGCCCAAC
GTGGCGTATCTGGGCTTCAGCGCGGAAACGGGCGAGCTGAGCGACAACCACGACATCATCTCCGTCGCAGCCAAG
AATCTATACAACCACCCAGCAGCAGCGGGTGCCTCGTCCTCCAAGCAAGGGTCCTCCTCACACGGCGCACCCCCG
TCATCGTTGAGACCCCGCGGCGGAAGCTGGACCTGGTTCTTCACCAAGATGATGCTGCTCATCGTTGTCGTGGCG
GGTGGTTACGCTGGGTGGACGGCGTGGAGGGCCAAGAGCCGAAGCCATCGGTTCTGA
Gene >Ophun1|5643
ATGAGGCTGCCGTCGGTGTCGGCGGTGCTGCTGGCGGCCCTGAGCTGGAGGGTGCGCGCAGACGAGCACGATGAC
CTCAAGAGCATAACGCTGCGGACGCATAGTCTGCAACAGGTTCGTCCGGAAGAGTCGAATTGGGGGATGGGACGC
GGCTGACGGTCGGTCATAGCCTTATCTTGACTCGGAGTTGCAGAGTCGGTGGTTTGACTTTGGCGGCGATACCAT
TGTGCGGACGGATTCGTATGTTGATCTCCTCACTTGAGTCGTGAGAATCTGCTAATGTGTGTCTCTTGATCGCAG
ATATATTCGCCTCACCTCAGACCGCGCCTCGCAGTCCGGCTGGCTATTCTCACGCGTGCCACTGACGGCAACAAA
CTGGGAAATCGAAGTCGAGTTCAAAATCTCTGGCAAAAACAACCTCTACGGCGACGGTCTAGCAATGTGGATAAC
AAAGCAACGCGGCCAAATAGGCCCCGTCTTCGGCTCAATCGACCGCTTCGAAGGCCTAGGAATCTTCATCGACAC
GTACAAGAACGGCAGACAAGGGACCTCATTCCCCTACGTCATGGCCATGGCCGGCGACGGCCACATCTCGTACGA
TAAGAGCACCGACGGGAAGGACCACGAGCTGGCCGGCTGTTCGGCCCGGGGTCTTCGGTCCGCGACCATGCCGAC
CAAGTTGAGGCTGACGTACGTTCAGGACAAGCAGCTCAGGCTCGAGTTGCAGTACAAGGTTGAGGGGGAGTGGGA
GCTGTGCTTTGAGACGACGAAGCCGCCTACCCTGCCCAACGTGGCGTATCTGGGCTTCAGCGCGGAAACGGGCGA
GCTGAGCGACAACCACGACATCATCTCCGTCGCAGCCAAGAATCTATACAACCACCCAGCAGCAGCGGGTGCCTC
GTCCTCCAAGCAAGGGTCCTCCTCACACGGCGCACCCCCGTCATCGTTGAGACCCCGCGGCGGAAGCTGGACCTG
GTTCTTCACCAAGATGATGCTGCTCATCGTTGTCGTGGCGGGTGGTTACGCTGGGTGGACGGCGTGGAGGGCCAA
GAGCCGAAGCCATCGGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail