Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5641
Gene name
LocationContig_57:28375..35278
Strand-
Gene length (bp)6903
Transcript length (bp)6828
Coding sequence length (bp)6828
Protein length (aa) 2276

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.8E-76 5 255
PF00698 Acyl_transf_1 Acyl transferase domain 1.1E-66 535 819
PF14765 PS-DH Polyketide synthase dehydratase 8.6E-53 897 1188
PF08659 KR KR domain 1.1E-52 1747 1921
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 9.6E-37 264 381
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 2.2E-18 385 494
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 4.7E-16 1556 1648
PF00975 Thioesterase Thioesterase domain 1.9E-13 2104 2220
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 8.4E-12 1589 1723
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.9E-09 1752 1899
PF00106 adh_short short chain dehydrogenase 5.0E-11 1749 1903
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 8.3E-06 1433 1496

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 6 1928 0.0E+00
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 5 2083 0.0E+00
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 5 2053 0.0E+00
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 5 1194 1.0E-161
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 5 1194 1.0E-161
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 6 1928 0.0E+00
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 5 2083 0.0E+00
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 5 2053 0.0E+00
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 5 1194 1.0E-161
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 5 1194 1.0E-161
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 5 1194 1.0E-161
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 2 1115 2.0E-152
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 2 1115 2.0E-152
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 2 1115 2.0E-152
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 2 1115 2.0E-152
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 2 1115 5.0E-152
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 5 1142 5.0E-149
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 5 825 2.0E-145
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 5 825 2.0E-144
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 5 825 4.0E-144
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 5 824 1.0E-141
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 5 824 1.0E-141
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 5 824 1.0E-141
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 5 1110 1.0E-139
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 5 1110 1.0E-139
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 6 880 4.0E-139
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 4 880 3.0E-136
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 4 880 2.0E-135
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 5 877 7.0E-135
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 5 1171 6.0E-134
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 7 1111 1.0E-133
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 3 1114 1.0E-132
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 7 962 3.0E-132
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 3 891 3.0E-131
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 2 880 1.0E-130
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 7 1111 2.0E-130
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 451 2083 6.0E-130
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 6 1190 2.0E-129
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 1186 3.0E-129
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 1186 8.0E-129
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 7 1191 2.0E-128
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 4 1108 3.0E-126
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 7 1111 6.0E-126
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 4 1111 7.0E-126
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 5 1196 9.0E-126
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 2 880 1.0E-125
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 7 1111 2.0E-125
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 5 1196 1.0E-123
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 7 1111 2.0E-123
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 7 1072 1.0E-121
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 7 1206 3.0E-121
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 7 1112 2.0E-120
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 7 1072 2.0E-120
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 7 1016 3.0E-120
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 7 1016 5.0E-120
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 7 1207 7.0E-120
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 7 1183 2.0E-119
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 7 1276 3.0E-119
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 15 1174 1.0E-118
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 7 1183 3.0E-117
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1 880 2.0E-115
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 3 883 7.0E-115
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 3 883 8.0E-115
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 3 883 8.0E-115
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 7 1196 2.0E-114
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 7 1114 2.0E-113
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 7 1111 7.0E-113
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 4 1191 1.0E-112
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 7 1186 5.0E-112
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 7 1114 7.0E-112
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 7 1112 3.0E-111
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 7 1111 3.0E-111
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 8 1114 4.0E-111
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 7 1114 5.0E-111
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 7 1111 7.0E-110
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 7 811 8.0E-104
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 4 880 1.0E-101
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 7 880 2.0E-99
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 5 1075 3.0E-98
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 5 1075 1.0E-96
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 5 834 1.0E-95
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 5 1071 2.0E-94
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 5 1103 5.0E-94
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 5 521 2.0E-90
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 5 431 2.0E-89
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 7 482 3.0E-87
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 4 424 3.0E-86
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 7 517 6.0E-86
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 7 880 8.0E-86
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 2 435 2.0E-83
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 5 580 2.0E-83
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 5 501 7.0E-82
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 5 467 2.0E-81
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 7 517 3.0E-79
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 3 519 1.0E-76
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 5 471 1.0E-75
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 7 507 9.0E-73
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 5 510 2.0E-72
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1 524 4.0E-66
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 5 510 4.0E-66
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1410 2079 3.0E-65
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 7 433 5.0E-65
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1300 1992 2.0E-64
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1300 1992 2.0E-64
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 5 374 5.0E-64
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 7 433 6.0E-64
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 7 435 9.0E-63
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 7 521 1.0E-62
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1467 1940 4.0E-61
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1333 2058 2.0E-55
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1411 1943 3.0E-54
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 5 432 1.0E-53
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1433 1947 2.0E-53
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1433 1947 2.0E-53
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1433 1947 2.0E-53
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1433 1947 2.0E-53
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1433 1947 2.0E-53
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 7 432 3.0E-50
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 532 1203 3.0E-48
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1440 1923 3.0E-47
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1433 1935 6.0E-47
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1426 2051 9.0E-46
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1426 2051 4.0E-45
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 532 1111 4.0E-45
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1426 1923 1.0E-44
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1431 2096 4.0E-43
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1431 2057 6.0E-43
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1424 1923 6.0E-43
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1320 2083 5.0E-42
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1463 2090 4.0E-41
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1488 1933 2.0E-40
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1320 2083 5.0E-40
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1322 2098 5.0E-40
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1325 2083 4.0E-39
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1467 2057 6.0E-39
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1322 2053 1.0E-38
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 529 1200 2.0E-38
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1215 2097 3.0E-38
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1322 2053 4.0E-38
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1320 2083 9.0E-38
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1322 2053 9.0E-38
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1286 2056 1.0E-37
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1314 2056 2.0E-37
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1246 2051 8.0E-37
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 532 1188 1.0E-36
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 487 834 3.0E-36
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1322 2053 5.0E-36
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1322 2053 5.0E-36
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1322 2053 7.0E-36
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1459 2051 3.0E-35
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1467 2057 1.0E-34
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1467 1976 2.0E-34
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1294 2059 1.0E-33
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1486 2053 3.0E-33
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1431 2057 4.0E-33
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1424 2058 6.0E-33
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1382 2053 8.0E-33
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1431 1959 2.0E-32
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1467 2053 2.0E-32
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1425 2059 1.0E-31
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 4 432 1.0E-31
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1322 2053 2.0E-31
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 4 433 5.0E-28
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1282 2094 7.0E-27
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 534 818 1.0E-26
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 4 431 3.0E-26
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 75 431 4.0E-26
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 4 433 6.0E-26
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 4 433 6.0E-26
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 4 433 6.0E-26
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 4 433 6.0E-26
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 4 432 7.0E-26
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1747 2051 1.0E-25
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 4 433 2.0E-25
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 7 423 5.0E-25
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 534 823 6.0E-25
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1435 1726 7.0E-25
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 534 811 2.0E-24
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 152 431 5.0E-24
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1435 1708 9.0E-24
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 7 431 3.0E-23
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1438 1708 4.0E-23
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 533 811 5.0E-23
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 85 431 7.0E-23
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1429 2094 1.0E-22
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 104 431 1.0E-22
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1743 2079 3.0E-22
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1435 1705 5.0E-22
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1412 1728 7.0E-22
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1739 1957 1.0E-21
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 7 423 1.0E-21
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 86 433 1.0E-21
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 86 433 1.0E-21
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1402 1673 1.0E-21
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 86 429 2.0E-21
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 86 429 2.0E-21
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 86 429 2.0E-21
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1435 1705 2.0E-21
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1748 2059 3.0E-21
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 86 433 3.0E-21
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1468 1646 4.0E-21
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 86 433 4.0E-21
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 86 433 4.0E-21
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 86 433 4.0E-21
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 3 436 4.0E-21
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1416 1673 4.0E-21
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 86 432 5.0E-21
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 7 432 6.0E-21
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 7 423 7.0E-21
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1743 2098 1.0E-20
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1435 1646 1.0E-20
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 103 432 1.0E-20
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 144 432 1.0E-20
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 158 433 2.0E-20
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 158 433 2.0E-20
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 86 433 2.0E-20
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 158 433 2.0E-20
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1760 2094 3.0E-20
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 147 433 3.0E-20
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 158 433 1.0E-19
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 158 433 1.0E-19
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1435 1708 1.0E-19
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1742 2085 2.0E-19
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1742 2085 2.0E-19
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1742 2085 2.0E-19
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1706 1916 2.0E-19
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1706 1916 2.0E-19
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1706 1916 2.0E-19
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 165 436 3.0E-19
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1762 2083 4.0E-19
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 144 433 4.0E-19
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 144 433 4.0E-19
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 4 439 6.0E-19
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 2 431 9.0E-19
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1762 2053 1.0E-18
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 86 429 2.0E-18
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 103 432 3.0E-18
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 144 433 2.0E-17
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 144 426 2.0E-17
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 144 426 2.0E-17
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 144 426 2.0E-17
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 144 426 2.0E-17
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 533 818 3.0E-17
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 1433 1729 3.0E-17
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 533 818 4.0E-17
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 533 818 4.0E-17
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 533 818 4.0E-17
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 533 818 5.0E-17
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 533 818 5.0E-17
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 533 818 5.0E-17
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1416 1725 7.0E-17
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 143 433 8.0E-17
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 89 426 1.0E-16
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1427 1646 2.0E-16
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 144 433 3.0E-16
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 534 811 3.0E-16
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 7 433 3.0E-16
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 534 811 3.0E-16
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1738 2083 5.0E-16
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1739 2078 6.0E-16
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1427 1646 7.0E-16
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1679 2060 8.0E-16
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1734 2059 9.0E-16
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 1414 1726 9.0E-16
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1702 1921 1.0E-15
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 534 822 1.0E-15
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1702 1921 3.0E-15
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 534 830 6.0E-15
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 845 1358 7.0E-15
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1747 2083 8.0E-15
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1747 2053 1.0E-14
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1468 1724 1.0E-14
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 1433 1726 1.0E-14
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1424 1644 2.0E-14
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 533 811 2.0E-14
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1430 1643 2.0E-14
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1428 1646 3.0E-14
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 533 818 3.0E-14
sp|Q8WWV3|RT4I1_HUMAN Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens GN=RTN4IP1 PE=1 SV=2 1414 1607 3.0E-14
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1748 1970 5.0E-14
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1748 2053 1.0E-13
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 534 811 1.0E-13
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1422 1643 2.0E-13
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 849 1190 3.0E-13
sp|Q02062|KASB_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5088 PE=1 SV=1 7 378 7.0E-13
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 1434 1661 2.0E-12
sp|Q7YS70|MECR_BOVIN Trans-2-enoyl-CoA reductase, mitochondrial OS=Bos taurus GN=MECR PE=1 SV=1 1408 1726 3.0E-12
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 112 385 3.0E-12
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1421 1728 5.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 845 1181 6.0E-12
sp|O13698|FABD_SCHPO Malonyl CoA-acyl carrier protein transacylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mct1 PE=3 SV=1 537 827 9.0E-12
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 1401 1595 9.0E-12
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 1401 1595 1.0E-11
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 32 143 2.0E-11
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 533 818 5.0E-11
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 142 433 6.0E-11
sp|Q9DCS3|MECR_MOUSE Trans-2-enoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Mecr PE=1 SV=2 1382 1726 6.0E-11
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1745 2053 7.0E-11
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 533 818 1.0E-10
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 533 818 1.0E-10
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1467 1643 2.0E-10
sp|Q9Z311|MECR_RAT Trans-2-enoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Mecr PE=1 SV=1 1382 1726 2.0E-10
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 533 818 4.0E-10
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 1405 1595 8.0E-10
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 1405 1595 8.0E-10
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 1405 1595 8.0E-10
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 1405 1595 8.0E-10
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1428 1645 8.0E-10
sp|Q9BV79|MECR_HUMAN Trans-2-enoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=MECR PE=1 SV=2 1408 1726 1.0E-09
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 1405 1595 1.0E-09
sp|P14686|GRST_ANEMI Gramicidin S biosynthesis protein GrsT OS=Aneurinibacillus migulanus GN=grsT PE=3 SV=1 2100 2267 1.0E-09
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 1435 1597 3.0E-09
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 1405 1595 3.0E-09
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1426 1726 3.0E-09
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1503 1724 3.0E-09
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1734 1925 4.0E-09
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1734 1925 4.0E-09
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1734 1925 4.0E-09
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1503 1724 4.0E-09
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 1435 1724 4.0E-09
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1726 2049 2.0E-08
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 860 1353 2.0E-08
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1419 1637 2.0E-08
sp|O34812|YFMJ_BACSU Putative NADP-dependent oxidoreductase YfmJ OS=Bacillus subtilis (strain 168) GN=yfmJ PE=2 SV=1 1530 1728 8.0E-08
sp|Q54II4|RT4I1_DICDI Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=rtn4ip1 PE=3 SV=1 1435 1623 8.0E-08
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1419 1649 2.0E-07
sp|Q14914|PTGR1_HUMAN Prostaglandin reductase 1 OS=Homo sapiens GN=PTGR1 PE=1 SV=2 1464 1638 2.0E-07
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 1488 1638 2.0E-07
sp|Q921W4|QORL1_MOUSE Quinone oxidoreductase-like protein 1 OS=Mus musculus GN=Cryzl1 PE=1 SV=1 1436 1619 2.0E-07
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 1419 1668 3.0E-07
sp|O95825|QORL1_HUMAN Quinone oxidoreductase-like protein 1 OS=Homo sapiens GN=CRYZL1 PE=1 SV=2 1436 1619 3.0E-07
sp|Q9NV23|SAST_HUMAN S-acyl fatty acid synthase thioesterase, medium chain OS=Homo sapiens GN=OLAH PE=2 SV=1 2086 2196 3.0E-07
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 1745 1861 4.0E-07
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 1530 1638 5.0E-07
sp|Q8IVS2|FABD_HUMAN Malonyl-CoA-acyl carrier protein transacylase, mitochondrial OS=Homo sapiens GN=MCAT PE=1 SV=2 535 839 8.0E-07
sp|Q59A28|QORL1_BOVIN Quinone oxidoreductase-like protein 1 OS=Bos taurus GN=CRYZL1 PE=2 SV=1 1436 1619 8.0E-07
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1419 1649 2.0E-06
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 1435 1595 2.0E-06
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1467 1649 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 22 PKS

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup11
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1456
Ophiocordyceps camponoti-floridani Ophcf2|04509
Ophiocordyceps camponoti-floridani Ophcf2|05945
Ophiocordyceps camponoti-floridani Ophcf2|05210
Ophiocordyceps camponoti-floridani Ophcf2|04876
Ophiocordyceps camponoti-floridani Ophcf2|03559
Ophiocordyceps camponoti-floridani Ophcf2|02946
Ophiocordyceps camponoti-floridani Ophcf2|02940
Ophiocordyceps camponoti-floridani Ophcf2|02393
Ophiocordyceps camponoti-floridani Ophcf2|02162
Ophiocordyceps camponoti-floridani Ophcf2|01419
Ophiocordyceps camponoti-floridani Ophcf2|00877
Ophiocordyceps camponoti-floridani Ophcf2|00026
Ophiocordyceps camponoti-floridani Ophcf2|02640
Ophiocordyceps camponoti-rufipedis Ophun1|7018
Ophiocordyceps camponoti-rufipedis Ophun1|5875
Ophiocordyceps camponoti-rufipedis Ophun1|61
Ophiocordyceps camponoti-rufipedis Ophun1|7079
Ophiocordyceps camponoti-rufipedis Ophun1|2808
Ophiocordyceps camponoti-rufipedis Ophun1|7149
Ophiocordyceps camponoti-rufipedis Ophun1|7480
Ophiocordyceps camponoti-rufipedis Ophun1|5641 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7148
Ophiocordyceps camponoti-rufipedis Ophun1|5297
Ophiocordyceps camponoti-rufipedis Ophun1|839
Ophiocordyceps camponoti-rufipedis Ophun1|5181
Ophiocordyceps camponoti-rufipedis Ophun1|5180
Ophiocordyceps camponoti-rufipedis Ophun1|5123
Ophiocordyceps camponoti-rufipedis Ophun1|5085
Ophiocordyceps camponoti-rufipedis Ophun1|4013
Ophiocordyceps camponoti-rufipedis Ophun1|2837
Ophiocordyceps camponoti-rufipedis Ophun1|7483
Ophiocordyceps camponoti-rufipedis Ophun1|1461
Ophiocordyceps camponoti-rufipedis Ophun1|5183
Ophiocordyceps kimflemingae Ophio5|2713
Ophiocordyceps subramaniannii Hirsu2|2752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5641
MPPRQPIAIVGIGCRFPGPINSAPDLWQALTQSQDVISQVPPSRFDAPSLQDDDARKYGAIRSSRGGFLDDVHGF
DAEFFGLYPAEANRMDPQHRLLLEASVHALEDSGTPLEDVAGSTTSVFVGAFMYDHLVMQSAADQRDTIGPYTAH
GVVNFSLANRISHRLNLQGASVSLDSACSSSLVAVHLACESIWSGSCEGALAGGVNAILRPEGTMLLSMAGFLSP
DGACKPFDAAANGYVRSEGVGVVYLKPLASAIRDGNDIYATIRGCHVNSDGYTADGYTVPNPQAQTTLLSTAYAS
AGLDPSMVGYVECHGPGTPVGDPVEAAAVGGHIGQASGRDEALWIGSVKGNLGHCEGASGIASFIKAALILRHGT
IPPQTNHNNPNPIIDFGSLGLRIPRQMVPLPNRSGTRRIVGVNSFGAGGTNAHVILQEADPLSAPPALVHEPRVL
IFSAKSLAALEHMSRNLLAHLQHHQPHLKDVVHTLAKRRSRHNHIAVIPVSHQQQLLDCLDHLGSGQPSKETLVL
ENQSEFPRIVFVFSGQGGQWIRMGQSLAEQEPIFRDSLLAFDTVFRSKAGFSIVDEISKPQGESRIDSTVVVQPA
TVALQIALARTLMSYGLKPEAIVGHSIGEVSAAHISGALTLEQAVTVIYERSQSQKRVAGLGSMLAVGLSSSEAH
DVILSLDLDHDVAVAALNGPRTTIMTGDSTALHLIESHLKARQVFVRSVNVEVPYHSHFMDPLEHDLVESLATIR
GVPTDIPLYSTVTASLEPGTHLDGHYWFDNVRKPVRYVETAAKLIDNGFNLFVEVGPHPVLLSGTREIAQAASRG
ISALPAMTRVSHVEPLARVLGAAYALGADVDISSFNGGAGRLLSLPLYPFQRKHYSSEHPEAKHRRLRRSRHPFD
GGSTKLTDDGRAFVRLRASTGTSPFLAEHVAEGAILFPATAHIEAAYMAANEFLSLQDVCLRDVRFKRPLVLTSS
QDYAPQVLLEITSEANEYAISTRPADASPSSEWRICSTGRIDSLTSRSPSPVPEAVPEALETVASRLRLGKALDV
DEFYSTLEKSGLRYGDAFRGIKMLWHLGTEIYASVKLPSAQIREAARFRLHPALLDACMHASFAHMHRLGDSGIV
YLPHHIETVNISACASGETDVLVHVKIHHHDGDSVRADARVYTESGRVVATMTAITFKRFTSASGPEPVAYEASL
QEASLPAGGGIQDFDNILVLGDDSGEFASLARKAFPRASVSPRPASWISDFPKDFPLGPQTLILLAATGVHVCSS
DASFEQLGTCIGTLLQLSRWVQDRQETPTLAVVVAGAFMAPLDSQCNPISAAIEAAVRVMANELPQMGIRVIDLP
SNESDWPLQSVQEELLSTGGDLHDTVVALRPHGRFIRRITAVDADEHLESLPARGGKYSFELDPAGLLDKVVARR
QAPTSLAPGEVAIQVHAASLNSVEVINMSEKSVSGVPSDQNLGLEVAGKVIEVGEDVINVQLGTNVMARVANGLS
GYVTTDSRSVNEIPGNVTMAQAASIPVDYVTAFYALVHVGRLTRRDSVLVHAAAGGVGAVAIQIAKLYGARIFAT
ADSPESRQWVVRQGVQDVFDSTSAYFHHDVKAATDDRGVDVVLNCHSGPLLNQTLACLAPFGRFIELGKTGMSPN
MMEAFGENRSFMAVDISLMILHKPDLYSDLLASVCKLLETGELIPPPVAEHPITQLPETLKRPSPSEFIGKTVMT
MSEDATVETLPPTRLRLRADRSYLVTGGASGLGLQMARFLSERGAKHVILASRTGPKKAEDEAVVRDMKNRGVVV
KMEHVDVGNREAVAALFAKRDLPTIAGIIHCAGVAVDRHCYEMSLDDFWAAFNAKAIGAWNLHLATENMALEFFV
LTSSSTSLVGSHGQLNYVAANQFLDSLALHRRANGLAGLSLKCGVLGDFAGMTAGSKDLLSLLRSQGWSVINLPL
VLDALEHSILQGAKQRLIANIDWAKFLRAYPRLISDSAFAGLETQDDAASSDLSLWTLESIAEVLRERVAAIVGV
DASRLSVTEKIDKYSFDSLTLTQIRSSILDEFRVSYPMVKLSEGKAMKEVAKEVAGQLGIVETGDEKKSTMNGEA
GRGRLVLFPPMGAGASFFSDFLVDPPDDLDAVAVQLPERENRSQELVPLTMAEIVDGILSEIGTVKASDLFWGHS
IGGLIAFETMTALRGQGKELPRLTVSGTLAPHLTHRLQKREAVLKLLNDGQDSAWSLAQQFRRDVPYMKGYRRDE
VEMRLQTQITAFAARQDEMAYPDEG*
Coding >Ophun1|5641
ATGCCCCCCCGCCAACCCATCGCCATCGTCGGCATCGGCTGCCGTTTCCCCGGACCCATAAACTCCGCCCCAGAC
CTATGGCAAGCCCTCACCCAAAGCCAAGACGTGATATCCCAAGTCCCACCCTCCCGCTTCGACGCACCCTCCCTC
CAAGACGACGATGCCCGCAAGTACGGCGCCATCCGGTCCTCACGAGGCGGCTTCCTGGATGACGTCCACGGCTTC
GACGCCGAGTTCTTCGGCCTCTATCCCGCTGAAGCCAACAGGATGGATCCCCAGCATCGGCTCCTCCTCGAAGCT
TCAGTCCATGCTCTCGAGGATTCCGGCACTCCTCTTGAGGACGTAGCTGGATCAACCACCAGCGTCTTCGTCGGA
GCCTTCATGTACGACCATCTCGTCATGCAATCCGCCGCCGATCAGCGAGATACCATCGGCCCATACACAGCCCAC
GGCGTCGTCAACTTCTCACTGGCAAACCGCATCTCGCACCGACTGAACCTCCAAGGCGCCAGCGTCAGCCTCGAC
AGCGCCTGTTCCAGCAGCCTCGTTGCCGTCCACCTCGCTTGTGAGAGCATCTGGTCCGGATCCTGCGAGGGGGCT
CTGGCCGGGGGCGTCAACGCCATTCTTCGGCCCGAGGGGACCATGCTTCTGTCAATGGCTGGCTTTCTGTCCCCG
GACGGTGCTTGTAAGCCGTTTGATGCCGCTGCCAATGGTTATGTCCGCAGCGAGGGGGTCGGCGTCGTCTATTTG
AAGCCCCTGGCCAGCGCTATCCGAGACGGGAACGACATCTATGCCACCATCCGCGGCTGTCACGTCAACTCGGAC
GGATACACCGCAGACGGCTACACGGTTCCCAATCCTCAGGCTCAGACGACGCTCCTCTCAACCGCATACGCTTCC
GCCGGCTTGGACCCTTCCATGGTCGGATACGTCGAGTGCCACGGTCCGGGAACGCCGGTGGGAGACCCCGTCGAG
GCCGCCGCCGTCGGAGGGCACATCGGACAGGCCAGCGGTCGAGACGAAGCCTTATGGATAGGCTCCGTCAAGGGC
AACCTCGGCCACTGCGAGGGAGCCTCCGGTATTGCCTCCTTCATCAAGGCTGCCCTGATCCTCCGTCACGGCACC
ATCCCTCCGCAGACCAACCACAACAACCCCAACCCCATCATCGACTTTGGCTCTCTGGGTCTGAGGATCCCGCGC
CAGATGGTCCCTCTCCCGAATCGAAGTGGGACACGCCGTATCGTCGGAGTCAACTCGTTCGGCGCCGGTGGCACC
AATGCCCATGTCATCCTCCAAGAAGCCGATCCGTTGTCGGCTCCGCCAGCGCTTGTCCACGAGCCACGAGTTCTC
ATCTTCTCAGCCAAGTCTCTTGCTGCCCTGGAGCACATGTCGAGAAACCTGCTGGCCCATCTTCAGCACCACCAG
CCACATCTTAAAGACGTCGTTCATACTCTTGCCAAGCGTCGAAGCCGTCACAACCACATTGCTGTCATCCCCGTA
AGTCATCAACAGCAACTACTCGACTGCCTCGACCACCTGGGTTCCGGACAGCCGTCGAAAGAAACCCTCGTCCTG
GAAAACCAAAGCGAGTTTCCACGCATCGTCTTCGTCTTCTCCGGCCAAGGCGGCCAATGGATCCGTATGGGCCAG
TCTCTCGCCGAACAAGAGCCCATCTTCCGCGATTCACTCCTCGCCTTCGACACCGTCTTCCGCTCAAAGGCCGGC
TTCTCCATCGTCGACGAAATCTCAAAGCCCCAAGGCGAGTCCCGCATCGATAGCACCGTCGTCGTTCAGCCCGCC
ACTGTAGCCCTCCAGATCGCACTGGCGAGGACACTGATGTCGTACGGCCTCAAGCCCGAGGCCATCGTCGGCCAT
TCCATCGGCGAGGTCTCGGCTGCCCACATCTCCGGCGCCCTGACGCTCGAGCAAGCCGTCACCGTCATCTATGAG
CGCTCACAGAGTCAGAAGCGGGTTGCCGGCCTCGGCTCCATGCTGGCTGTTGGCCTATCTTCGTCCGAGGCTCAC
GACGTGATCCTGAGTCTCGACCTTGACCACGACGTCGCCGTTGCCGCCCTCAATGGCCCGAGAACGACAATCATG
ACAGGAGACTCGACAGCTCTACATCTCATCGAGTCCCATCTCAAGGCACGACAAGTCTTTGTTCGGTCCGTCAAC
GTAGAGGTCCCGTATCACAGCCACTTCATGGATCCCCTCGAGCACGATTTGGTCGAGTCCCTGGCCACGATCCGA
GGCGTACCGACCGACATTCCCCTATACTCTACTGTCACGGCTTCTCTTGAGCCCGGAACACATCTGGACGGCCAT
TATTGGTTTGATAACGTGCGTAAGCCGGTCCGTTACGTCGAGACGGCCGCCAAGCTCATCGACAATGGCTTCAAT
CTCTTCGTCGAGGTCGGTCCTCATCCGGTCCTTCTCTCCGGCACTCGAGAGATCGCCCAGGCCGCGAGCCGCGGC
ATTTCCGCCCTTCCGGCCATGACGAGGGTCAGCCACGTCGAGCCCCTTGCCCGTGTCTTGGGAGCTGCCTATGCT
CTGGGCGCAGATGTCGACATCTCTTCCTTCAATGGGGGTGCTGGTCGTCTCCTCAGTCTCCCCCTTTACCCCTTT
CAGCGAAAGCATTACTCAAGCGAGCACCCAGAGGCCAAACATCGCCGCCTCCGTAGATCCAGACACCCGTTCGAC
GGCGGATCGACTAAACTGACCGACGACGGCCGGGCATTCGTCCGTCTCAGGGCCAGCACAGGCACATCCCCGTTC
CTGGCCGAACACGTCGCCGAAGGGGCCATCCTGTTCCCGGCCACGGCTCACATTGAAGCCGCTTACATGGCAGCC
AACGAATTCCTGTCTCTGCAAGACGTGTGCCTACGAGACGTCAGATTCAAGCGTCCCCTGGTCCTGACCAGTTCT
CAGGACTATGCCCCTCAAGTCCTGCTCGAGATAACGTCGGAAGCAAACGAGTACGCCATTAGCACACGACCAGCC
GATGCCAGCCCGTCTTCCGAGTGGCGGATCTGCTCTACGGGACGCATCGATTCACTCACCTCTCGCTCTCCATCA
CCAGTGCCTGAAGCAGTGCCTGAAGCCTTGGAGACAGTCGCGTCTCGGCTGCGTCTCGGCAAGGCACTCGACGTC
GACGAATTCTACTCGACGCTGGAAAAGTCCGGGCTTCGATACGGCGACGCCTTCCGAGGCATCAAGATGCTGTGG
CATCTCGGCACCGAAATATATGCCTCGGTTAAGCTGCCGTCTGCCCAGATTCGAGAGGCTGCTCGCTTCCGGCTT
CACCCTGCTCTTCTCGATGCCTGTATGCACGCTTCATTCGCTCACATGCACCGTCTGGGAGACTCCGGAATCGTC
TACCTGCCTCATCACATCGAGACCGTCAACATCTCTGCTTGTGCGAGCGGTGAAACGGACGTCTTGGTCCATGTC
AAGATTCACCATCACGACGGCGACTCTGTGCGCGCAGATGCCCGCGTGTATACCGAGTCTGGCCGCGTGGTAGCA
ACGATGACTGCCATAACATTTAAACGCTTCACAAGCGCGTCAGGCCCCGAGCCAGTGGCATACGAAGCCAGTCTC
CAAGAGGCGTCTCTTCCAGCAGGAGGAGGGATTCAAGATTTTGATAATATTCTGGTTCTCGGAGACGATTCCGGT
GAATTCGCAAGTCTCGCCCGCAAGGCGTTTCCTCGGGCTTCTGTGTCGCCAAGGCCTGCGTCATGGATATCCGAC
TTCCCCAAAGACTTTCCATTGGGACCTCAGACACTCATACTGCTGGCAGCAACTGGCGTCCATGTCTGCAGCAGC
GACGCCTCTTTCGAGCAACTAGGCACCTGTATCGGAACTCTTCTGCAACTGTCTCGTTGGGTTCAAGACCGGCAG
GAAACTCCTACGTTGGCAGTCGTCGTTGCCGGTGCCTTTATGGCACCTTTGGATTCTCAGTGCAATCCGATATCA
GCCGCCATAGAGGCAGCGGTACGCGTCATGGCAAATGAATTACCTCAGATGGGAATACGCGTCATCGATCTGCCT
TCGAATGAGAGCGACTGGCCTCTTCAATCAGTTCAAGAGGAGCTGCTGTCGACTGGTGGCGACCTCCATGACACT
GTTGTCGCATTACGCCCCCACGGACGGTTCATCCGACGCATCACGGCTGTTGATGCCGACGAGCACCTGGAGAGT
CTCCCTGCCCGCGGAGGAAAGTATTCGTTCGAACTAGATCCGGCTGGCTTATTGGACAAGGTGGTCGCCCGAAGA
CAAGCTCCCACAAGCCTAGCCCCAGGCGAGGTGGCGATTCAAGTTCACGCTGCTTCTCTCAACTCCGTGGAGGTC
ATCAACATGAGCGAGAAATCCGTCTCGGGAGTACCGTCTGATCAGAATCTCGGCCTCGAAGTCGCAGGCAAGGTC
ATCGAAGTGGGAGAAGATGTCATTAATGTCCAGCTCGGTACGAACGTCATGGCACGAGTCGCCAACGGCCTTTCC
GGATATGTCACGACAGACAGCCGATCCGTAAACGAGATTCCCGGCAACGTCACTATGGCTCAGGCCGCATCCATC
CCTGTAGACTATGTCACGGCATTCTATGCCCTGGTCCATGTTGGGAGACTGACTCGTCGAGACTCTGTTCTTGTT
CACGCAGCGGCCGGTGGCGTCGGAGCCGTCGCCATACAAATCGCTAAGCTGTACGGAGCTCGCATCTTTGCGACG
GCTGACAGCCCTGAAAGTCGGCAATGGGTGGTCCGGCAGGGTGTTCAAGACGTCTTCGACTCAACATCTGCATAC
TTTCACCACGACGTCAAGGCTGCCACCGACGATCGTGGTGTCGATGTGGTGCTCAACTGCCACAGTGGCCCGCTG
CTGAACCAGACATTGGCCTGCCTCGCTCCCTTTGGACGCTTCATAGAACTTGGAAAGACCGGCATGAGTCCCAAT
ATGATGGAGGCATTCGGCGAGAACCGGTCCTTCATGGCTGTGGATATCAGTCTCATGATTCTGCATAAGCCGGAC
CTTTACTCCGACTTGCTGGCTTCGGTCTGCAAACTCTTAGAAACCGGCGAGCTGATCCCCCCTCCGGTGGCCGAG
CATCCCATCACGCAGCTGCCCGAGACTCTGAAGCGCCCCTCTCCATCAGAATTCATCGGCAAGACTGTCATGACA
ATGTCTGAAGATGCTACCGTCGAAACGCTCCCACCAACTCGTCTCAGACTCCGAGCTGACAGAAGCTACCTGGTC
ACCGGGGGGGCCAGCGGACTTGGCCTGCAGATGGCGAGATTCTTGAGTGAACGGGGAGCAAAGCATGTGATACTG
GCCAGCCGTACCGGTCCGAAGAAGGCCGAAGACGAAGCAGTCGTGCGTGACATGAAGAATCGAGGCGTCGTGGTC
AAGATGGAGCACGTGGATGTTGGCAACCGGGAAGCTGTCGCGGCGTTATTCGCCAAACGAGACTTGCCGACAATT
GCTGGCATCATCCATTGCGCAGGTGTTGCGGTCGACCGTCACTGCTATGAGATGTCTCTTGATGATTTCTGGGCC
GCCTTCAACGCCAAGGCTATCGGGGCTTGGAATCTGCATCTTGCAACGGAAAATATGGCACTCGAGTTCTTCGTC
TTGACGTCGTCTTCCACCAGTCTGGTGGGATCCCACGGTCAACTCAACTATGTTGCGGCAAACCAGTTCCTGGAT
TCGCTGGCGCTCCATCGTCGGGCAAATGGACTTGCAGGTCTCTCGCTCAAGTGCGGCGTCTTGGGAGACTTTGCC
GGTATGACAGCAGGCTCAAAGGACCTGCTGAGCCTGCTCCGGTCTCAAGGCTGGTCGGTCATCAACCTGCCGCTG
GTCCTCGACGCTTTGGAGCATTCCATCCTCCAAGGGGCGAAGCAGCGCTTGATTGCCAATATCGACTGGGCCAAG
TTTCTCAGAGCGTACCCTCGTCTTATCAGCGATTCTGCCTTTGCCGGTTTGGAGACGCAGGACGATGCGGCCTCA
TCGGATCTATCGCTCTGGACTCTGGAGTCCATCGCCGAGGTACTTCGTGAGCGGGTGGCAGCCATTGTTGGGGTT
GATGCTAGCCGATTGTCTGTCACGGAGAAGATAGACAAGTACTCGTTTGACTCTTTGACCCTAACGCAGATTCGA
AGCTCGATACTCGACGAGTTCCGGGTGTCATATCCGATGGTAAAGTTATCCGAGGGCAAGGCCATGAAGGAGGTG
GCCAAAGAAGTGGCAGGCCAATTGGGTATCGTTGAAACTGGAGACGAGAAGAAGAGTACGATGAATGGCGAAGCA
GGCCGAGGCCGACTGGTCCTGTTCCCCCCAATGGGAGCGGGAGCATCATTCTTTTCCGACTTCCTCGTCGACCCC
CCGGACGACTTGGATGCCGTTGCCGTTCAACTACCTGAGAGGGAGAATCGGAGTCAAGAGCTGGTGCCTTTAACC
ATGGCTGAGATTGTGGACGGCATCTTGAGCGAGATTGGCACGGTCAAAGCAAGCGATCTCTTTTGGGGCCATTCG
ATCGGAGGTCTAATTGCCTTTGAAACCATGACAGCTCTCAGGGGGCAAGGAAAAGAGCTTCCTCGCCTGACGGTC
AGCGGGACATTGGCTCCACATCTGACGCATCGATTGCAGAAACGAGAAGCCGTCTTGAAACTGTTAAACGACGGT
CAAGACTCGGCCTGGTCTTTGGCCCAACAGTTCAGGAGAGATGTCCCTTACATGAAGGGTTACCGGCGTGACGAA
GTGGAAATGCGTCTGCAAACACAAATCACGGCGTTTGCGGCACGACAGGACGAGATGGCGTACCCGGACGAGGGT
TGA
Transcript >Ophun1|5641
ATGCCCCCCCGCCAACCCATCGCCATCGTCGGCATCGGCTGCCGTTTCCCCGGACCCATAAACTCCGCCCCAGAC
CTATGGCAAGCCCTCACCCAAAGCCAAGACGTGATATCCCAAGTCCCACCCTCCCGCTTCGACGCACCCTCCCTC
CAAGACGACGATGCCCGCAAGTACGGCGCCATCCGGTCCTCACGAGGCGGCTTCCTGGATGACGTCCACGGCTTC
GACGCCGAGTTCTTCGGCCTCTATCCCGCTGAAGCCAACAGGATGGATCCCCAGCATCGGCTCCTCCTCGAAGCT
TCAGTCCATGCTCTCGAGGATTCCGGCACTCCTCTTGAGGACGTAGCTGGATCAACCACCAGCGTCTTCGTCGGA
GCCTTCATGTACGACCATCTCGTCATGCAATCCGCCGCCGATCAGCGAGATACCATCGGCCCATACACAGCCCAC
GGCGTCGTCAACTTCTCACTGGCAAACCGCATCTCGCACCGACTGAACCTCCAAGGCGCCAGCGTCAGCCTCGAC
AGCGCCTGTTCCAGCAGCCTCGTTGCCGTCCACCTCGCTTGTGAGAGCATCTGGTCCGGATCCTGCGAGGGGGCT
CTGGCCGGGGGCGTCAACGCCATTCTTCGGCCCGAGGGGACCATGCTTCTGTCAATGGCTGGCTTTCTGTCCCCG
GACGGTGCTTGTAAGCCGTTTGATGCCGCTGCCAATGGTTATGTCCGCAGCGAGGGGGTCGGCGTCGTCTATTTG
AAGCCCCTGGCCAGCGCTATCCGAGACGGGAACGACATCTATGCCACCATCCGCGGCTGTCACGTCAACTCGGAC
GGATACACCGCAGACGGCTACACGGTTCCCAATCCTCAGGCTCAGACGACGCTCCTCTCAACCGCATACGCTTCC
GCCGGCTTGGACCCTTCCATGGTCGGATACGTCGAGTGCCACGGTCCGGGAACGCCGGTGGGAGACCCCGTCGAG
GCCGCCGCCGTCGGAGGGCACATCGGACAGGCCAGCGGTCGAGACGAAGCCTTATGGATAGGCTCCGTCAAGGGC
AACCTCGGCCACTGCGAGGGAGCCTCCGGTATTGCCTCCTTCATCAAGGCTGCCCTGATCCTCCGTCACGGCACC
ATCCCTCCGCAGACCAACCACAACAACCCCAACCCCATCATCGACTTTGGCTCTCTGGGTCTGAGGATCCCGCGC
CAGATGGTCCCTCTCCCGAATCGAAGTGGGACACGCCGTATCGTCGGAGTCAACTCGTTCGGCGCCGGTGGCACC
AATGCCCATGTCATCCTCCAAGAAGCCGATCCGTTGTCGGCTCCGCCAGCGCTTGTCCACGAGCCACGAGTTCTC
ATCTTCTCAGCCAAGTCTCTTGCTGCCCTGGAGCACATGTCGAGAAACCTGCTGGCCCATCTTCAGCACCACCAG
CCACATCTTAAAGACGTCGTTCATACTCTTGCCAAGCGTCGAAGCCGTCACAACCACATTGCTGTCATCCCCGTA
AGTCATCAACAGCAACTACTCGACTGCCTCGACCACCTGGGTTCCGGACAGCCGTCGAAAGAAACCCTCGTCCTG
GAAAACCAAAGCGAGTTTCCACGCATCGTCTTCGTCTTCTCCGGCCAAGGCGGCCAATGGATCCGTATGGGCCAG
TCTCTCGCCGAACAAGAGCCCATCTTCCGCGATTCACTCCTCGCCTTCGACACCGTCTTCCGCTCAAAGGCCGGC
TTCTCCATCGTCGACGAAATCTCAAAGCCCCAAGGCGAGTCCCGCATCGATAGCACCGTCGTCGTTCAGCCCGCC
ACTGTAGCCCTCCAGATCGCACTGGCGAGGACACTGATGTCGTACGGCCTCAAGCCCGAGGCCATCGTCGGCCAT
TCCATCGGCGAGGTCTCGGCTGCCCACATCTCCGGCGCCCTGACGCTCGAGCAAGCCGTCACCGTCATCTATGAG
CGCTCACAGAGTCAGAAGCGGGTTGCCGGCCTCGGCTCCATGCTGGCTGTTGGCCTATCTTCGTCCGAGGCTCAC
GACGTGATCCTGAGTCTCGACCTTGACCACGACGTCGCCGTTGCCGCCCTCAATGGCCCGAGAACGACAATCATG
ACAGGAGACTCGACAGCTCTACATCTCATCGAGTCCCATCTCAAGGCACGACAAGTCTTTGTTCGGTCCGTCAAC
GTAGAGGTCCCGTATCACAGCCACTTCATGGATCCCCTCGAGCACGATTTGGTCGAGTCCCTGGCCACGATCCGA
GGCGTACCGACCGACATTCCCCTATACTCTACTGTCACGGCTTCTCTTGAGCCCGGAACACATCTGGACGGCCAT
TATTGGTTTGATAACGTGCGTAAGCCGGTCCGTTACGTCGAGACGGCCGCCAAGCTCATCGACAATGGCTTCAAT
CTCTTCGTCGAGGTCGGTCCTCATCCGGTCCTTCTCTCCGGCACTCGAGAGATCGCCCAGGCCGCGAGCCGCGGC
ATTTCCGCCCTTCCGGCCATGACGAGGGTCAGCCACGTCGAGCCCCTTGCCCGTGTCTTGGGAGCTGCCTATGCT
CTGGGCGCAGATGTCGACATCTCTTCCTTCAATGGGGGTGCTGGTCGTCTCCTCAGTCTCCCCCTTTACCCCTTT
CAGCGAAAGCATTACTCAAGCGAGCACCCAGAGGCCAAACATCGCCGCCTCCGTAGATCCAGACACCCGTTCGAC
GGCGGATCGACTAAACTGACCGACGACGGCCGGGCATTCGTCCGTCTCAGGGCCAGCACAGGCACATCCCCGTTC
CTGGCCGAACACGTCGCCGAAGGGGCCATCCTGTTCCCGGCCACGGCTCACATTGAAGCCGCTTACATGGCAGCC
AACGAATTCCTGTCTCTGCAAGACGTGTGCCTACGAGACGTCAGATTCAAGCGTCCCCTGGTCCTGACCAGTTCT
CAGGACTATGCCCCTCAAGTCCTGCTCGAGATAACGTCGGAAGCAAACGAGTACGCCATTAGCACACGACCAGCC
GATGCCAGCCCGTCTTCCGAGTGGCGGATCTGCTCTACGGGACGCATCGATTCACTCACCTCTCGCTCTCCATCA
CCAGTGCCTGAAGCAGTGCCTGAAGCCTTGGAGACAGTCGCGTCTCGGCTGCGTCTCGGCAAGGCACTCGACGTC
GACGAATTCTACTCGACGCTGGAAAAGTCCGGGCTTCGATACGGCGACGCCTTCCGAGGCATCAAGATGCTGTGG
CATCTCGGCACCGAAATATATGCCTCGGTTAAGCTGCCGTCTGCCCAGATTCGAGAGGCTGCTCGCTTCCGGCTT
CACCCTGCTCTTCTCGATGCCTGTATGCACGCTTCATTCGCTCACATGCACCGTCTGGGAGACTCCGGAATCGTC
TACCTGCCTCATCACATCGAGACCGTCAACATCTCTGCTTGTGCGAGCGGTGAAACGGACGTCTTGGTCCATGTC
AAGATTCACCATCACGACGGCGACTCTGTGCGCGCAGATGCCCGCGTGTATACCGAGTCTGGCCGCGTGGTAGCA
ACGATGACTGCCATAACATTTAAACGCTTCACAAGCGCGTCAGGCCCCGAGCCAGTGGCATACGAAGCCAGTCTC
CAAGAGGCGTCTCTTCCAGCAGGAGGAGGGATTCAAGATTTTGATAATATTCTGGTTCTCGGAGACGATTCCGGT
GAATTCGCAAGTCTCGCCCGCAAGGCGTTTCCTCGGGCTTCTGTGTCGCCAAGGCCTGCGTCATGGATATCCGAC
TTCCCCAAAGACTTTCCATTGGGACCTCAGACACTCATACTGCTGGCAGCAACTGGCGTCCATGTCTGCAGCAGC
GACGCCTCTTTCGAGCAACTAGGCACCTGTATCGGAACTCTTCTGCAACTGTCTCGTTGGGTTCAAGACCGGCAG
GAAACTCCTACGTTGGCAGTCGTCGTTGCCGGTGCCTTTATGGCACCTTTGGATTCTCAGTGCAATCCGATATCA
GCCGCCATAGAGGCAGCGGTACGCGTCATGGCAAATGAATTACCTCAGATGGGAATACGCGTCATCGATCTGCCT
TCGAATGAGAGCGACTGGCCTCTTCAATCAGTTCAAGAGGAGCTGCTGTCGACTGGTGGCGACCTCCATGACACT
GTTGTCGCATTACGCCCCCACGGACGGTTCATCCGACGCATCACGGCTGTTGATGCCGACGAGCACCTGGAGAGT
CTCCCTGCCCGCGGAGGAAAGTATTCGTTCGAACTAGATCCGGCTGGCTTATTGGACAAGGTGGTCGCCCGAAGA
CAAGCTCCCACAAGCCTAGCCCCAGGCGAGGTGGCGATTCAAGTTCACGCTGCTTCTCTCAACTCCGTGGAGGTC
ATCAACATGAGCGAGAAATCCGTCTCGGGAGTACCGTCTGATCAGAATCTCGGCCTCGAAGTCGCAGGCAAGGTC
ATCGAAGTGGGAGAAGATGTCATTAATGTCCAGCTCGGTACGAACGTCATGGCACGAGTCGCCAACGGCCTTTCC
GGATATGTCACGACAGACAGCCGATCCGTAAACGAGATTCCCGGCAACGTCACTATGGCTCAGGCCGCATCCATC
CCTGTAGACTATGTCACGGCATTCTATGCCCTGGTCCATGTTGGGAGACTGACTCGTCGAGACTCTGTTCTTGTT
CACGCAGCGGCCGGTGGCGTCGGAGCCGTCGCCATACAAATCGCTAAGCTGTACGGAGCTCGCATCTTTGCGACG
GCTGACAGCCCTGAAAGTCGGCAATGGGTGGTCCGGCAGGGTGTTCAAGACGTCTTCGACTCAACATCTGCATAC
TTTCACCACGACGTCAAGGCTGCCACCGACGATCGTGGTGTCGATGTGGTGCTCAACTGCCACAGTGGCCCGCTG
CTGAACCAGACATTGGCCTGCCTCGCTCCCTTTGGACGCTTCATAGAACTTGGAAAGACCGGCATGAGTCCCAAT
ATGATGGAGGCATTCGGCGAGAACCGGTCCTTCATGGCTGTGGATATCAGTCTCATGATTCTGCATAAGCCGGAC
CTTTACTCCGACTTGCTGGCTTCGGTCTGCAAACTCTTAGAAACCGGCGAGCTGATCCCCCCTCCGGTGGCCGAG
CATCCCATCACGCAGCTGCCCGAGACTCTGAAGCGCCCCTCTCCATCAGAATTCATCGGCAAGACTGTCATGACA
ATGTCTGAAGATGCTACCGTCGAAACGCTCCCACCAACTCGTCTCAGACTCCGAGCTGACAGAAGCTACCTGGTC
ACCGGGGGGGCCAGCGGACTTGGCCTGCAGATGGCGAGATTCTTGAGTGAACGGGGAGCAAAGCATGTGATACTG
GCCAGCCGTACCGGTCCGAAGAAGGCCGAAGACGAAGCAGTCGTGCGTGACATGAAGAATCGAGGCGTCGTGGTC
AAGATGGAGCACGTGGATGTTGGCAACCGGGAAGCTGTCGCGGCGTTATTCGCCAAACGAGACTTGCCGACAATT
GCTGGCATCATCCATTGCGCAGGTGTTGCGGTCGACCGTCACTGCTATGAGATGTCTCTTGATGATTTCTGGGCC
GCCTTCAACGCCAAGGCTATCGGGGCTTGGAATCTGCATCTTGCAACGGAAAATATGGCACTCGAGTTCTTCGTC
TTGACGTCGTCTTCCACCAGTCTGGTGGGATCCCACGGTCAACTCAACTATGTTGCGGCAAACCAGTTCCTGGAT
TCGCTGGCGCTCCATCGTCGGGCAAATGGACTTGCAGGTCTCTCGCTCAAGTGCGGCGTCTTGGGAGACTTTGCC
GGTATGACAGCAGGCTCAAAGGACCTGCTGAGCCTGCTCCGGTCTCAAGGCTGGTCGGTCATCAACCTGCCGCTG
GTCCTCGACGCTTTGGAGCATTCCATCCTCCAAGGGGCGAAGCAGCGCTTGATTGCCAATATCGACTGGGCCAAG
TTTCTCAGAGCGTACCCTCGTCTTATCAGCGATTCTGCCTTTGCCGGTTTGGAGACGCAGGACGATGCGGCCTCA
TCGGATCTATCGCTCTGGACTCTGGAGTCCATCGCCGAGGTACTTCGTGAGCGGGTGGCAGCCATTGTTGGGGTT
GATGCTAGCCGATTGTCTGTCACGGAGAAGATAGACAAGTACTCGTTTGACTCTTTGACCCTAACGCAGATTCGA
AGCTCGATACTCGACGAGTTCCGGGTGTCATATCCGATGGTAAAGTTATCCGAGGGCAAGGCCATGAAGGAGGTG
GCCAAAGAAGTGGCAGGCCAATTGGGTATCGTTGAAACTGGAGACGAGAAGAAGAGTACGATGAATGGCGAAGCA
GGCCGAGGCCGACTGGTCCTGTTCCCCCCAATGGGAGCGGGAGCATCATTCTTTTCCGACTTCCTCGTCGACCCC
CCGGACGACTTGGATGCCGTTGCCGTTCAACTACCTGAGAGGGAGAATCGGAGTCAAGAGCTGGTGCCTTTAACC
ATGGCTGAGATTGTGGACGGCATCTTGAGCGAGATTGGCACGGTCAAAGCAAGCGATCTCTTTTGGGGCCATTCG
ATCGGAGGTCTAATTGCCTTTGAAACCATGACAGCTCTCAGGGGGCAAGGAAAAGAGCTTCCTCGCCTGACGGTC
AGCGGGACATTGGCTCCACATCTGACGCATCGATTGCAGAAACGAGAAGCCGTCTTGAAACTGTTAAACGACGGT
CAAGACTCGGCCTGGTCTTTGGCCCAACAGTTCAGGAGAGATGTCCCTTACATGAAGGGTTACCGGCGTGACGAA
GTGGAAATGCGTCTGCAAACACAAATCACGGCGTTTGCGGCACGACAGGACGAGATGGCGTACCCGGACGAGGGT
TGA
Gene >Ophun1|5641
ATGCCCCCCCGCCAACCCATCGCCATCGTCGGCATCGGCTGCCGTTTCCCCGGACCCATAAACTCCGCCCCAGAC
CTATGGCAAGCCCTCACCCAAAGCCAAGACGTGATATCCCAAGTCCCACCCTCCCGCTTCGACGCACCCTCCCTC
CAAGACGACGATGCCCGCAAGTACGGCGCCATCCGGTCCTCACGAGGCGGCTTCCTGGATGACGTCCACGGCTTC
GACGCCGAGTTCTTCGGCCTCTATCCCGCTGAAGCCAACAGGATGGATCCCCAGCATCGGCTCCTCCTCGAAGCT
TCAGTCCATGCTCTCGAGGATTCCGGCACTCCTCTTGAGGACGTAGCTGGATCAACCACCAGCGTCTTCGTCGGA
GCCTTCATGTACGACCATCTCGTCATGCAATCCGCCGCCGATCAGCGAGATACCATCGGCCCATACACAGCCCAC
GGCGTCGTCAACTTCTCACTGGCAAACCGCATCTCGCACCGACTGAACCTCCAAGGCGCCAGCGTCAGCCTCGAC
AGCGCCTGTTCCAGCAGCCTCGTTGCCGTCCACCTCGCTTGTGAGAGCATCTGGTCCGGATCCTGCGAGGGGGCT
CTGGCCGGGGGCGTCAACGCCATTCTTCGGCCCGAGGGGACCATGCTTCTGTCAATGGCTGGCTTTCTGTCCCCG
GACGGTGCTTGTAAGCCGTTTGATGCCGCTGCCAATGGTTATGTCCGCAGCGAGGGGGTCGGCGTCGTCTATTTG
AAGCCCCTGGCCAGCGCTATCCGAGACGGGAACGACATCTATGCCACCATCCGCGGCTGTCACGTCAACTCGGAC
GGATACACCGCAGACGGCTACACGGTTCCCAATCCTCAGGCTCAGACGACGCTCCTCTCAACCGCATACGCTTCC
GCCGGCTTGGACCCTTCCATGGTCGGATACGTCGAGTGCCACGGTCCGGGAACGCCGGTGGGAGACCCCGTCGAG
GCCGCCGCCGTCGGAGGGCACATCGGACAGGCCAGCGGTCGAGACGAAGCCTTATGGATAGGCTCCGTCAAGGGC
AACCTCGGCCACTGCGAGGGAGCCTCCGGTATTGCCTCCTTCATCAAGGCTGCCCTGATCCTCCGTCACGGCACC
ATCCCTCCGCAGACCAACCACAACAACCCCAACCCCATCATCGACTTTGGCTCTCTGGGTCTGAGGATCCCGCGC
CAGATGGTCCCTCTCCCGAATCGAAGTGGGACACGCCGTATCGTCGGAGTCAACTCGTTCGGCGCCGGTGGCACC
AATGCCCATGTCATCCTCCAAGAAGCCGATCCGTTGTCGGCTCCGCCAGCGCTTGTCCACGAGCCACGAGTTCTC
ATCTTCTCAGCCAAGTCTCTTGCTGCCCTGGAGCACATGTCGAGAAACCTGCTGGCCCATCTTCAGCACCACCAG
CCACATCTTAAAGACGTCGTTCATACTCTTGCCAAGCGTCGAAGCCGTCACAACCACATTGCTGTCATCCCCGTA
AGTCATCAACAGCAACTACTCGACTGCCTCGACCACCTGGGTTCCGGACAGCCGTCGAAAGAAACCCTCGTCCTG
GAAAACCAAAGCGAGTTTCCACGCATCGTCTTCGTCTTCTCCGGCCAAGGCGGCCAATGGATCCGTATGGGCCAG
TCTCTCGCCGAACAAGAGCCCATCTTCCGCGATTCACTCCTCGCCTTCGACACCGTCTTCCGCTCAAAGGCCGGC
TTCTCCATCGTCGACGAAATCTCAAAGCCCCAAGGCGAGTCCCGCATCGATAGCACCGTCGTCGTTCAGCCCGCC
ACTGTAGCCCTCCAGATCGCACTGGCGAGGACACTGATGTCGTACGGCCTCAAGCCCGAGGCCATCGTCGGCCAT
TCCATCGGCGAGGTCTCGGCTGCCCACATCTCCGGCGCCCTGACGCTCGAGCAAGCCGTCACCGTCATCTATGAG
CGCTCACAGAGTCAGAAGCGGGTTGCCGGCCTCGGCTCCATGCTGGCTGTTGGCCTATCTTCGTCCGAGGCTCAC
GACGTGATCCTGAGTCTCGACCTTGACCACGACGTCGCCGTTGCCGCCCTCAATGGCCCGAGAACGACAATCATG
ACAGGAGACTCGACAGCTCTACATCTCATCGAGTCCCATCTCAAGGCACGACAAGTCTTTGTTCGGTCCGTCAAC
GTAGAGGTCCCGTATCACAGCCACTTCATGGATCCCCTCGAGCACGATTTGGTCGAGTCCCTGGCCACGATCCGA
GGCGTACCGACCGACATTCCCCTATACTCTACTGTCACGGCTTCTCTTGAGCCCGGAACACATCTGGACGGCCAT
TATTGGTTTGATAACGTGCGTAAGCCGGTCCGTTACGTCGAGACGGCCGCCAAGCTCATCGACAATGGCTTCAAT
CTCTTCGTCGAGGTCGGTCCTCATCCGGTCCTTCTCTCCGGCACTCGAGAGATCGCCCAGGCCGCGAGCCGCGGC
ATTTCCGCCCTTCCGGCCATGACGAGGGTCAGCCACGTCGAGCCCCTTGCCCGTGTCTTGGGAGCTGCCTATGCT
CTGGGCGCAGATGTCGACATCTCTTCCTTCAATGGGGGTGCTGGTCGTCTCCTCAGTCTCCCCCTTTACCCCTTT
CAGCGAAAGCATTACTCAAGCGAGCACCCAGAGGCCAAACATCGCCGCCTCCGTAGATCCAGACACCCGTTCGAC
GGCGGATCGACTAAACTGACCGACGACGGCCGGGCATTCGTCCGTCTCAGGGCCAGCACAGGCACATCCCCGTTC
CTGGCCGAACACGTCGCCGAAGGGGCCATCCTGTTCCCGGCCACGGCTCACATTGAAGCCGCTTACATGGCAGCC
AACGAATTCCTGTCTCTGCAAGACGTGTGCCTACGAGACGTCAGATTCAAGCGTCCCCTGGTCCTGACCAGTTCT
CAGGACTATGCCCCTCAAGTCCTGCTCGAGATAACGTCGGAAGCAAACGAGTACGCCATTAGCACACGACCAGCC
GATGCCAGCCCGTCTTCCGAGTGGCGGATCTGCTCTACGGGACGCATCGATTCACTCACCTCTCGCTCTCCATCA
CCAGTGCCTGAAGCAGTGCCTGAAGCCTTGGAGACAGTCGCGTCTCGGCTGCGTCTCGGCAAGGCACTCGACGTC
GACGAATTCTACTCGACGCTGGAAAAGTCCGGGCTTCGATACGGCGACGCCTTCCGAGGCATCAAGATGCTGTGG
CATCTCGGCACCGAAATATATGCCTCGGTTAAGCTGCCGTCTGCCCAGATTCGAGAGGCTGCTCGCTTCCGGCTT
CACCCTGCTCTTCTCGATGCCTGTATGCACGCTTCATTCGCTCACATGCACCGTCTGGGAGACTCCGGAATCGTC
TACCTGCCTCATCACATCGAGACCGTCAACATCTCTGCTTGTGCGAGCGGTGAAACGGACGTCTTGGTCCATGTC
AAGATTCACCATCACGACGGCGACTCTGTGCGCGCAGATGCCCGCGTGTATACCGAGTCTGGCCGCGTGGTAGCA
ACGATGACTGCCATAACATTTAAACGCTTCACAAGCGCGTCAGGCCCCGAGCCAGTGGCATACGAAGCCAGTCTC
CAAGAGGCGTCTCTTCCAGCAGGAGGAGGGATTCAAGATTTTGATAATATTCTGGTTCTCGGAGACGATTCCGGT
GAATTCGCAAGTCTCGCCCGCAAGGCGTTTCCTCGGGCTTCTGTGTCGCCAAGGCCTGCGTCATGGATATCCGAC
TTCCCCAAAGACTTTCCATTGGGACCTCAGACACTCATACTGCTGGCAGCAACTGGCGTCCATGTCTGCAGCAGC
GACGCCTCTTTCGAGCAACTAGGCACCTGTATCGGAACTCTTCTGCAACTGTCTCGTTGGGTTCAAGACCGGCAG
GAAACTCCTACGTTGGCAGTCGTCGTTGCCGGTGCCTTTATGGCACCTTTGGATTCTCAGTGCAATCCGATATCA
GCCGCCATAGAGGCAGCGGTACGCGTCATGGCAAATGAATTACCTCAGATGGGAATACGCGTCATCGATCTGCCT
TCGAATGAGAGCGACTGGCCTCTTCAATCAGTTCAAGAGGAGCTGCTGTCGACTGGTGGCGACCTCCATGACACT
GTTGTCGCATTACGCCCCCACGGACGGTTCATCCGACGCATCACGGCTGTTGATGCCGACGAGCACCTGGAGAGT
CTCCCTGCCCGCGGAGGAAAGTATTCGTTCGAACTAGATCCGGCTGGCTTATTGGACAAGGTGGTCGCCCGAAGA
CAAGCTCCCACAAGCCTAGCCCCAGGCGAGGTGGCGATTCAAGTTCACGCTGCTTCTCTCAACTCCGTGGAGGTC
ATCAACATGAGCGAGAAATCCGTCTCGGGAGTACCGTCTGATCAGAATCTCGGCCTCGAAGTCGCAGGCAAGGTC
ATCGAAGTGGGAGAAGATGTCATTAATGTCCAGCTCGGTACGAACGTCATGGCACGAGTCGCCAACGGCCTTTCC
GGATATGTCACGACAGACAGCCGATCCGTAAACGAGATTCCCGGCAACGTCACTATGGCTCAGGCCGCATCCATC
CCTGTAGACTATGTCACGGCATTCTATGCCCTGGTCCATGTTGGGAGACTGACTCGTCGAGACTCTGTTCTTGTT
CACGCAGCGGCCGGTGGCGTCGGAGCCGTCGCCATACAAATCGCTAAGCTGTACGGAGCTCGCATCTTTGCGACG
GCTGACAGCCCTGAAAGTCGGCAATGGGTGGTCCGGCAGGGTGTTCAAGACGTCTTCGACTCAACATCTGCATAC
TTTCACCACGACGTCAAGGCTGCCACCGACGATCGTGGTGTCGATGTGGTGCTCAACTGCCACAGTGGCCCGCTG
CTGAACCAGACATTGGCCTGCCTCGCTCCCTTTGGACGCTTCATAGAACTTGGAAAGACCGGCATGAGTCCCAAT
ATGATGGAGGCATTCGGCGAGAACCGGTCCTTCATGGCTGTGGATATCAGTCTCATGATTCTGCATAAGCCGGAC
CTTTACTCCGACTTGCTGGCTTCGGTCTGCAAACTCTTAGAAACCGGCGAGCTGATCCCCCCTCCGGTGGCCGAG
CATCCCATCACGCAGCTGCCCGAGACTCTGAAGCGCCCCTCTCCATCAGAATTCATCGGCAAGACTGTCATGACA
ATGTCTGAAGATGCTACCGTCGAAACGCTCCCACCAACTCGTCTCAGACTCCGAGCTGACAGAAGCTACCTGGTC
ACCGGGGGGGCCAGCGGACTTGGCCTGCAGATGGCGAGATTCTTGAGTGAACGGGGAGCAAAGCATGTGATACTG
GCCAGCCGTACCGGTCCGAAGAAGGCCGAAGACGAAGCAGTCGTGCGTGACATGAAGAATCGAGGCGTCGTGGTC
AAGATGGAGCACGTGGATGTTGGCAACCGGGAAGCTGTCGCGGCGTTATTCGCCAAACGAGACTTGCCGACAATT
GCTGGCATCATCCATTGCGCAGGTGTTGCGGTCGACCGTCACTGCTATGAGATGTCTCTTGATGATTTCTGGGCC
GCCTTCAACGCCAAGGCTATCGGGGCTTGGAATCTGCATCTTGCAACGGAAAATATGGCACTCGAGTTCTTCGTC
TTGACGTCGTCTTCCACCAGTCTGGTGGGATCCCACGGTCAACTCAACTATGTTGCGGCAAACCAGTTCCTGGAT
TCGCTGGCGCTCCATCGTCGGGCAAATGGACTTGCAGGTCTCTCGCTCAAGTGCGGCGTCTTGGGAGACTTTGCC
GGTATGACAGCAGGCTCAAAGGACCTGCTGAGCCTGCTCCGGTCTCAAGGCTGGTCGGTCATCAACCTGCCGCTG
GTCCTCGACGCTTTGGAGCATTCCATCCTCCAAGGGGCGAAGCAGCGCTTGATTGCCAATATCGACTGGGCCAAG
TTTCTCAGAGCGTACCCTCGTCTTATCAGCGATTCTGCCTTTGCCGGTTTGGAGACGCAGGACGATGCGGCCTCA
TCGGATCTATCGCTCTGGACTCTGGAGTCCATCGCCGAGGTACTTCGTGAGCGGGTGGCAGCCATTGTTGGGGTT
GATGCTAGCCGATTGTCTGTCACGGAGAAGATAGACAAGTACTCGTTTGACTCTTTGACCCTAACGCAGATTCGA
AGCTCGATACTCGACGAGTTCCGGGTGTCATATCCGATGGTAAAGTTATCCGAGGGCAAGGCCATGAAGGAGGTG
GCCAAAGAAGTGGCAGGCCAATTGGGTATCGTTGAAACTGGAGACGAGAAGAAGAGTACGATGAATGGCGAAGCA
GGGTTGGTTGACGGATTGGCCGACGGACTCAGCGTTGTCTCCAAGTGGTTCATCAGAGGAAAACAGTAGGTGGCA
AGCCGAGGCCGACTGGTCCTGTTCCCCCCAATGGGAGCGGGAGCATCATTCTTTTCCGACTTCCTCGTCGACCCC
CCGGACGACTTGGATGCCGTTGCCGTTCAACTACCTGAGAGGGAGAATCGGAGTCAAGAGCTGGTGCCTTTAACC
ATGGCTGAGATTGTGGACGGCATCTTGAGCGAGATTGGCACGGTCAAAGCAAGCGATCTCTTTTGGGGCCATTCG
ATCGGAGGTCTAATTGCCTTTGAAACCATGACAGCTCTCAGGGGGCAAGGAAAAGAGCTTCCTCGCCTGACGGTC
AGCGGGACATTGGCTCCACATCTGACGCATCGATTGCAGAAACGAGAAGCCGTCTTGAAACTGTTAAACGACGGT
CAAGACTCGGCCTGGTCTTTGGCCCAACAGTTCAGGAGAGATGTCCCTTACATGAAGGGTTACCGGCGTGACGAA
GTGGAAATGCGTCTGCAAACACAAATCACGGCGTTTGCGGCACGACAGGACGAGATGGCGTACCCGGACGAGGGT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail