Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|564
Gene name
LocationContig_1176:2105..2672
Strand-
Gene length (bp)567
Transcript length (bp)567
Coding sequence length (bp)567
Protein length (aa) 189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13857 Ank_5 Ankyrin repeats (many copies) 2.0E-07 22 65
PF13637 Ank_4 Ankyrin repeats (many copies) 2.9E-05 28 66
PF13606 Ank_3 Ankyrin repeat 1.5E-03 26 55

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UU77|YQMA_SCHPO Ankyrin repeat-containing protein P1E11.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCP1E11.10 PE=3 SV=1 24 117 1.0E-17
sp|P25631|YCU1_YEAST Ankyrin repeat-containing protein YCR051W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR051W PE=1 SV=1 19 113 2.0E-13

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|564
MVADNSSALLPFLWENPQTASLQDEHGYSLVHAAASYNRLDLLRALICEFDVDVNLKDEDDETALFVVETVEAAK
LLVEDLGVDVSHRGSGGLTAVERLEAEGEFPAVVTYLKSLRDSVESSATAAIQDAMRDPSEGISVPMSMASLAGP
EFHRRIQDFARRDDIDSAEGQADLRRMVEEALAAQDLE*
Coding >Ophun1|564
ATGGTAGCCGACAATAGCTCTGCCCTGCTACCTTTTCTATGGGAGAACCCGCAGACAGCCTCGTTACAGGACGAG
CACGGCTACTCCCTCGTACACGCCGCCGCGAGCTACAACCGGCTGGATCTGCTGCGTGCTCTGATATGCGAATTC
GACGTTGATGTCAATCTCAAGGACGAGGATGATGAAACAGCCCTATTCGTCGTCGAGACTGTAGAGGCTGCCAAA
CTTCTGGTCGAGGACTTGGGTGTCGACGTCAGCCACAGGGGCTCGGGCGGCTTGACGGCGGTGGAAAGGCTAGAG
GCAGAGGGCGAATTTCCCGCCGTCGTAACATACCTGAAATCTTTGAGAGATAGCGTGGAGTCATCGGCTACTGCT
GCTATTCAAGATGCCATGAGGGATCCATCAGAAGGTATCAGCGTCCCCATGTCCATGGCAAGCCTCGCCGGTCCG
GAATTCCATCGCCGCATCCAAGACTTTGCCCGCAGAGACGACATCGATTCCGCCGAAGGTCAGGCCGATTTGAGG
AGGATGGTCGAAGAGGCCCTCGCAGCTCAAGACTTAGAATAA
Transcript >Ophun1|564
ATGGTAGCCGACAATAGCTCTGCCCTGCTACCTTTTCTATGGGAGAACCCGCAGACAGCCTCGTTACAGGACGAG
CACGGCTACTCCCTCGTACACGCCGCCGCGAGCTACAACCGGCTGGATCTGCTGCGTGCTCTGATATGCGAATTC
GACGTTGATGTCAATCTCAAGGACGAGGATGATGAAACAGCCCTATTCGTCGTCGAGACTGTAGAGGCTGCCAAA
CTTCTGGTCGAGGACTTGGGTGTCGACGTCAGCCACAGGGGCTCGGGCGGCTTGACGGCGGTGGAAAGGCTAGAG
GCAGAGGGCGAATTTCCCGCCGTCGTAACATACCTGAAATCTTTGAGAGATAGCGTGGAGTCATCGGCTACTGCT
GCTATTCAAGATGCCATGAGGGATCCATCAGAAGGTATCAGCGTCCCCATGTCCATGGCAAGCCTCGCCGGTCCG
GAATTCCATCGCCGCATCCAAGACTTTGCCCGCAGAGACGACATCGATTCCGCCGAAGGTCAGGCCGATTTGAGG
AGGATGGTCGAAGAGGCCCTCGCAGCTCAAGACTTAGAATAA
Gene >Ophun1|564
ATGGTAGCCGACAATAGCTCTGCCCTGCTACCTTTTCTATGGGAGAACCCGCAGACAGCCTCGTTACAGGACGAG
CACGGCTACTCCCTCGTACACGCCGCCGCGAGCTACAACCGGCTGGATCTGCTGCGTGCTCTGATATGCGAATTC
GACGTTGATGTCAATCTCAAGGACGAGGATGATGAAACAGCCCTATTCGTCGTCGAGACTGTAGAGGCTGCCAAA
CTTCTGGTCGAGGACTTGGGTGTCGACGTCAGCCACAGGGGCTCGGGCGGCTTGACGGCGGTGGAAAGGCTAGAG
GCAGAGGGCGAATTTCCCGCCGTCGTAACATACCTGAAATCTTTGAGAGATAGCGTGGAGTCATCGGCTACTGCT
GCTATTCAAGATGCCATGAGGGATCCATCAGAAGGTATCAGCGTCCCCATGTCCATGGCAAGCCTCGCCGGTCCG
GAATTCCATCGCCGCATCCAAGACTTTGCCCGCAGAGACGACATCGATTCCGCCGAAGGTCAGGCCGATTTGAGG
AGGATGGTCGAAGAGGCCCTCGCAGCTCAAGACTTAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail