Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5639
Gene name
LocationContig_57:23366..25295
Strand-
Gene length (bp)1929
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 293 315 22
2 330 349 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup425
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7170
Ophiocordyceps australis map64 (Brazil) OphauB2|775
Ophiocordyceps camponoti-floridani Ophcf2|04512
Ophiocordyceps camponoti-rufipedis Ophun1|5639 (this protein)
Ophiocordyceps kimflemingae Ophio5|189
Ophiocordyceps kimflemingae Ophio5|647
Ophiocordyceps subramaniannii Hirsu2|4479
Ophiocordyceps subramaniannii Hirsu2|6047
Ophiocordyceps subramaniannii Hirsu2|9425

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5639
MDDYMFRHYVGECRVVEEATSYIEMLNYSDPTYNTSEEHALTSDEFDNFLRRRGAFEPPKLREGVKLLSGIRLVV
QKNAKDKDTFAPRVISLPKEAYGDMDEGDRHLQIIHRKSDVRKKGKTRGWEMLLSHNFTTSLTTGFIKGTPSSDI
PAALHHMLQCGSQHSPTTAHGLLLPTIMLSLDLSPAHDQKQRDARDWLRRLENAVSLRDEVEVQERDLLRLHASI
TARLEFYRVKLTGLENYVHTTLARLKVQREALYNIMSQREARLNLEIAGEQRRIAHASKRDSTAMKTISLMGAVF
LPGTYLASVFSTSFFDFKPTSSRVASELWIYFIVTIPLTAAIVGSWWWWDRRREAQFARDDEDLEKNIDKMEKDI
MHHLRKRTMSKAHTWNTISAPPRP*
Coding >Ophun1|5639
ATGGACGACTACATGTTCCGGCACTACGTGGGGGAGTGTCGGGTGGTAGAAGAGGCGACGAGTTATATCGAGATG
CTCAACTATTCGGATCCGACGTACAATACCAGCGAGGAGCATGCGTTGACGAGCGATGAGTTTGACAATTTCCTG
CGCAGACGGGGGGCGTTTGAGCCGCCCAAGTTGCGCGAGGGGGTGAAGCTGCTGAGCGGGATCCGACTGGTGGTG
CAGAAGAATGCAAAGGATAAGGATACGTTTGCGCCGAGGGTGATTTCGTTGCCCAAGGAGGCGTATGGGGATATG
GATGAGGGGGATAGGCATCTTCAAATCATCCATCGCAAGTCCGACGTCCGCAAAAAGGGCAAGACCCGAGGCTGG
GAAATGCTCCTCTCTCACAACTTCACCACCAGCCTAACAACGGGCTTCATAAAAGGAACCCCCAGCAGCGACATC
CCCGCCGCCCTCCACCACATGCTCCAATGCGGAAGCCAACACAGCCCGACGACAGCCCACGGCCTGCTCCTCCCG
ACGATAATGCTATCGCTGGATCTGTCGCCTGCGCACGATCAGAAGCAGCGGGACGCGCGGGACTGGCTCCGTCGT
CTGGAGAATGCGGTGAGTTTGCGGGATGAGGTTGAGGTGCAGGAACGAGACCTCCTCCGCTTACACGCCAGCATC
ACCGCCCGCCTCGAATTCTACCGCGTTAAACTGACGGGCCTGGAAAACTACGTCCACACCACCCTCGCCCGCCTC
AAAGTCCAACGCGAAGCCCTCTACAACATCATGTCCCAGCGCGAAGCCCGCCTCAACCTCGAAATCGCAGGCGAA
CAACGCCGCATCGCCCACGCAAGTAAACGCGACAGCACCGCCATGAAGACCATTTCCCTCATGGGCGCCGTGTTC
CTGCCGGGCACGTACCTAGCCTCCGTCTTCTCCACCTCCTTTTTCGACTTTAAGCCCACTTCGTCGCGGGTGGCC
TCGGAGCTTTGGATCTACTTCATCGTCACTATCCCCCTTACCGCCGCCATCGTTGGCTCGTGGTGGTGGTGGGAT
CGTCGGCGGGAGGCCCAGTTTGCGCGTGATGATGAGGATCTGGAGAAGAATATCGATAAGATGGAGAAGGATATT
ATGCATCATCTTCGGAAGCGGACTATGAGCAAGGCTCATACTTGGAACACCATCAGCGCGCCGCCGAGGCCGTAG
Transcript >Ophun1|5639
ATGGACGACTACATGTTCCGGCACTACGTGGGGGAGTGTCGGGTGGTAGAAGAGGCGACGAGTTATATCGAGATG
CTCAACTATTCGGATCCGACGTACAATACCAGCGAGGAGCATGCGTTGACGAGCGATGAGTTTGACAATTTCCTG
CGCAGACGGGGGGCGTTTGAGCCGCCCAAGTTGCGCGAGGGGGTGAAGCTGCTGAGCGGGATCCGACTGGTGGTG
CAGAAGAATGCAAAGGATAAGGATACGTTTGCGCCGAGGGTGATTTCGTTGCCCAAGGAGGCGTATGGGGATATG
GATGAGGGGGATAGGCATCTTCAAATCATCCATCGCAAGTCCGACGTCCGCAAAAAGGGCAAGACCCGAGGCTGG
GAAATGCTCCTCTCTCACAACTTCACCACCAGCCTAACAACGGGCTTCATAAAAGGAACCCCCAGCAGCGACATC
CCCGCCGCCCTCCACCACATGCTCCAATGCGGAAGCCAACACAGCCCGACGACAGCCCACGGCCTGCTCCTCCCG
ACGATAATGCTATCGCTGGATCTGTCGCCTGCGCACGATCAGAAGCAGCGGGACGCGCGGGACTGGCTCCGTCGT
CTGGAGAATGCGGTGAGTTTGCGGGATGAGGTTGAGGTGCAGGAACGAGACCTCCTCCGCTTACACGCCAGCATC
ACCGCCCGCCTCGAATTCTACCGCGTTAAACTGACGGGCCTGGAAAACTACGTCCACACCACCCTCGCCCGCCTC
AAAGTCCAACGCGAAGCCCTCTACAACATCATGTCCCAGCGCGAAGCCCGCCTCAACCTCGAAATCGCAGGCGAA
CAACGCCGCATCGCCCACGCAAGTAAACGCGACAGCACCGCCATGAAGACCATTTCCCTCATGGGCGCCGTGTTC
CTGCCGGGCACGTACCTAGCCTCCGTCTTCTCCACCTCCTTTTTCGACTTTAAGCCCACTTCGTCGCGGGTGGCC
TCGGAGCTTTGGATCTACTTCATCGTCACTATCCCCCTTACCGCCGCCATCGTTGGCTCGTGGTGGTGGTGGGAT
CGTCGGCGGGAGGCCCAGTTTGCGCGTGATGATGAGGATCTGGAGAAGAATATCGATAAGATGGAGAAGGATATT
ATGCATCATCTTCGGAAGCGGACTATGAGCAAGGCTCATACTTGGAACACCATCAGCGCGCCGCCGAGGCCGTAG
Gene >Ophun1|5639
ATGGACGACTACATGTTCCGGCACTACGTGGGGGAGTGTCGGGTGGTAGAAGAGGCGACGAGTTATATCGAGATG
CTCAACTATTCGGTTCGAATTTCCCGGGGGGGGGGTCGTTAACAGAGGGGAGGAGGCTTACCGTCGTCGACAGGA
TCCGACGTACAATACCAGCGAGGAGCATGCGTTGACGAGCGATGAGTTTGACAATTTCCTGCGCAGACGGGTTCG
TTGAAGGGTTTCCCTTTTTGCTTGTCTGAAGCTGATTATGTGGCGTAGGGGGCGTTTGAGCCGCCCAAGTTGCGC
GAGGGGGTGAAGCTGCTGAGCGGGATCCGACTGGTGTGAGAAACCATTGTCTTGTTTGTTTCGTTTCAACGAGCC
ATGCGGTATTAACATGGGGGGAATAACAGGGTGCAGAAGAATGCAAAGGATAAGGATACGTTTGCGCCGAGGGTG
ATTTCGTTGCCCAAGGAGGCGTATGGGGATATGGTGAGGTTGCTTCGGTTGCCGTACCGGGGGATTGAGACGACG
GCGGTGGTTGGGCCGTTTTTTTGGAGTTCGTTTGATCAGGATGAGGGGGATAGGCATCTTCGTGAGTGTTTTCCC
GGTTGGAGAGATGGGAGAGGAAGCTGACGAGGATAGAAATCATCCATCGCAAGTCCGACGTCCGCAAAAAGGGCA
AGACCCGAGGCTGGGAAATGCTCCTCTCTCACAACTTCACCACCAGCCTAACAACGGGCTTCATAAAAGGAACCC
CCAGCAGCGACATCCCCGCCGCCCTCCACCACATGCTCCAATGCGGAAGCCAACACAGCCCGACGACAGCCCACG
GCCTGCTCCTCCCGACGATAATGCTATCGCTGGATCTGTCGCCTGCGCACGATCAGAAGCAGCGGGACGCGCGGG
ACTGGCTCCGTCGTCTGGAGAATGCGGTGAGTTTGCGGGATGAGGTTGAGGTGCAGGAACGGTATGCGCCGGATG
GGTTGCTGGAGATTGATGGGTTGAGTAGGGATTTGGTCGAGTGTCATGGGCATGTGATGTGGAAGAGGCCGCAGG
CTTATCGGGCGCTGGTTGGGGAGATGGAGGTTGCGATGGAGAGGTTTCGGGAGGAGGTTGAGCGGCGGGGTTGTG
GTTATGGTGGTGAGGGTGGTTGTAATGGTTGTGATGGTGATGATGACCTCGCCAGCAGACAACTCTCCCACCACA
GAGACCTCCTCCGCTTACACGCCAGCATCACCGCCCGCCTCGAATTCTACCGCGTTAAACTGACGGGCCTGGAAA
ACTACGTCCACACCACCCTCGCCCGCCTCAAAGTCCAACGCGAAGCCGTCCGTCTCCTCACCCCTTCATCTCTCC
ACTCTCACAACGTGTCAACTAACAAGACACACAGCTCTACAACATCATGTCCCAGCGCGAAGCCCGCCTCAACCT
CGAAATCGCAGGCGAACAACGCCGCATCGCCCACGCAAGTAAACGCGACAGCACCGCCATGAAGACCATTTCCCT
CATGGGCGCCGTGTTCCTGCCGGGCACGTACCTAGCCTCCGTCTTCTCCACCTCCTTTTTCGACTTTAAGCCCAG
TTGCGTTATCCCCCCCCCCCCTTTTTCGCTTTTAACCCCGTTTGGTTTTTCCCCCCCCCCCCCCCCCCCCCTTTG
TGAGGATACAAGAGGTGAAGATCTGACCATGCTGTAGCTTCGTCGCGGGTGGCCTCGGAGCTTTGGATCTACTTC
ATCGTCACTATCCCCCTTACCGCCGCCATCGTTGGCTCGTGGTGGTGGTGGGATCGTCGGCGGGAGGCCCAGTTT
GCGCGTGATGATGAGGATCTGGAGAAGAATATCGATAAGATGGAGAAGGATATTATGCATCATCTTCGGAAGCGG
ACTATGAGCAAGGCTCATACTTGGAACACCATCAGCGCGCCGCCGAGGCCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail