Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5635
Gene name
LocationContig_57:16490..17358
Strand-
Gene length (bp)868
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12243 CTK3 CTD kinase subunit gamma CTK3 1.0E-43 2 110
PF12350 CTK3_C CTD kinase subunit gamma CTK3 C-terminus 4.7E-20 170 229

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USJ8|CTK3_SCHPO CTD kinase subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctk3 PE=1 SV=1 3 230 8.0E-38

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3297
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4933
Ophiocordyceps australis map64 (Brazil) OphauB2|771
Ophiocordyceps camponoti-floridani Ophcf2|04516
Ophiocordyceps camponoti-rufipedis Ophun1|5635 (this protein)
Ophiocordyceps kimflemingae Ophio5|185
Ophiocordyceps subramaniannii Hirsu2|607

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5635
MADPFEVRMRFSSQLQHLNASVNSAQKAAQYALKYKDMDEDLHSCILEQIERNNMNTRANIMYFIEHFLDLAKEG
HPDYVRMLSRDIIRVVDAVAPDDGSGAANIKVVLQGLRDKGHLENQAVTQIEDVLRERETNDEDIGLVSSPPAGE
VDVADALRSGGKRPAAPRLDRRQIEQRIEEDRERHKRLRESIWATPRGEDAEMNRLWEETSDFGDDDYRLLAEEA
EDFSKEMAMQLCPHKRAANGERS*
Coding >Ophun1|5635
ATGGCTGATCCTTTCGAGGTTCGCATGCGCTTCAGCTCGCAGCTTCAGCATCTCAACGCGTCGGTCAACTCGGCG
CAGAAGGCGGCGCAGTATGCGCTCAAGTACAAGGACATGGACGAGGACCTGCATTCGTGCATCCTGGAGCAGATC
GAGCGGAATAACATGAATACGCGCGCAAACATCATGTACTTTATCGAACACTTTCTCGACCTGGCCAAGGAAGGA
CACCCCGATTACGTTCGCATGCTATCGCGCGATATCATACGTGTCGTCGACGCTGTCGCACCAGACGATGGCTCC
GGGGCCGCCAATATCAAGGTCGTCCTACAAGGCCTCCGGGACAAGGGCCATCTCGAGAATCAGGCCGTAACCCAA
ATAGAAGACGTGTTACGTGAGCGAGAAACCAACGACGAAGATATTGGACTCGTCTCCTCGCCGCCGGCGGGGGAA
GTCGACGTTGCGGATGCGCTTCGATCTGGAGGGAAGCGGCCGGCGGCTCCGCGGCTTGATCGACGGCAGATTGAG
CAGCGCATCGAAGAGGATCGGGAGCGCCACAAGCGTCTTAGGGAGAGCATATGGGCCACTCCTAGAGGAGAAGAC
GCTGAGATGAACAGGCTGTGGGAGGAGACGAGCGACTTTGGTGACGATGATTACCGGTTGTTGGCTGAGGAGGCT
GAGGACTTTTCCAAGGAGATGGCTATGCAGTTGTGTCCTCACAAACGAGCTGCCAACGGGGAGCGGTCTTGA
Transcript >Ophun1|5635
ATGGCTGATCCTTTCGAGGTTCGCATGCGCTTCAGCTCGCAGCTTCAGCATCTCAACGCGTCGGTCAACTCGGCG
CAGAAGGCGGCGCAGTATGCGCTCAAGTACAAGGACATGGACGAGGACCTGCATTCGTGCATCCTGGAGCAGATC
GAGCGGAATAACATGAATACGCGCGCAAACATCATGTACTTTATCGAACACTTTCTCGACCTGGCCAAGGAAGGA
CACCCCGATTACGTTCGCATGCTATCGCGCGATATCATACGTGTCGTCGACGCTGTCGCACCAGACGATGGCTCC
GGGGCCGCCAATATCAAGGTCGTCCTACAAGGCCTCCGGGACAAGGGCCATCTCGAGAATCAGGCCGTAACCCAA
ATAGAAGACGTGTTACGTGAGCGAGAAACCAACGACGAAGATATTGGACTCGTCTCCTCGCCGCCGGCGGGGGAA
GTCGACGTTGCGGATGCGCTTCGATCTGGAGGGAAGCGGCCGGCGGCTCCGCGGCTTGATCGACGGCAGATTGAG
CAGCGCATCGAAGAGGATCGGGAGCGCCACAAGCGTCTTAGGGAGAGCATATGGGCCACTCCTAGAGGAGAAGAC
GCTGAGATGAACAGGCTGTGGGAGGAGACGAGCGACTTTGGTGACGATGATTACCGGTTGTTGGCTGAGGAGGCT
GAGGACTTTTCCAAGGAGATGGCTATGCAGTTGTGTCCTCACAAACGAGCTGCCAACGGGGAGCGGTCTTGA
Gene >Ophun1|5635
ATGGCTGATCCTTTCGAGGTTCGCATGCGCTTCAGCTCGCAGCTTCAGCATCTCAACGCGTCGGTCAACTCGGCG
CAGAAGGCGGCGCAGTATGCGCTCAAGTACAAGGACATGGACGAGGACCTGCATTCGTGCATCCTGGAGCAGATC
GAGCGGGTGCGTCATCGGCTGCCGCTATGAGAATTGAATGGGCAGCTAACAGAATCTCGCAGAATAACATGAATA
CGCGCGCAAACATCATGTACTTTATCGAACACTTTCTCGACCTGGCCAAGGAAGGACACCCCGATTACGTTCGCA
TGCTATCGCGCGATATCATACGTGTCGTCGACGCTGTCGCACCAGACGATGGCTCCGGGGCCGCCAATATCAAGG
TCGTCCGCAAGGCGAGCCGCTCTCAGATACCCGTCTCCTGTCATCACCGGCTGACACGCAAGCGCAGGTCCTACA
AGGCCTCCGGGACAAGGGCCATCTCGAGAATCAGGCCGTAACCCAAATAGAAGACGTGTTACGTGAGCGAGAAAC
CAACGACGAAGATATTGGACTCGTCTCCTCGCCGCCGGCGGGGGAAGTCGACGTTGCGGATGCGCTTCGATCTGG
AGGGAAGCGGCCGGCGGCTCCGCGGCTTGATCGACGGCAGATTGAGCAGCGCATCGAAGAGGATCGGGAGCGCCA
CAAGCGTCTTAGGGAGAGCATATGGGCCACTCCTAGAGGAGAAGACGCTGAGATGAACAGGCTGTGGGAGGAGAC
GAGCGACTTTGGTGACGATGATTACCGGTTGTTGGCTGAGGAGGCTGAGGACTTTTCCAAGGAGATGGCTATGCA
GTTGTGTCCTCACAAACGAGCTGCCAACGGGGAGCGGTCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail