Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5634
Gene name
LocationContig_57:15632..16241
Strand+
Gene length (bp)609
Transcript length (bp)549
Coding sequence length (bp)549
Protein length (aa) 183

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain 2.3E-19 115 181
PF16320 Ribosomal_L12_N Ribosomal protein L7/L12 dimerisation domain 9.3E-12 50 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53163|MNP1_YEAST 54S ribosomal protein L12, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNP1 PE=1 SV=1 48 182 1.0E-34
sp|Q9USJ9|MNP1_SCHPO 54S ribosomal protein L12, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl12 PE=3 SV=2 13 182 6.0E-33
sp|Q7YR75|RM12_BOVIN 39S ribosomal protein L12, mitochondrial OS=Bos taurus GN=MRPL12 PE=1 SV=1 25 182 2.0E-21
sp|P52815|RM12_HUMAN 39S ribosomal protein L12, mitochondrial OS=Homo sapiens GN=MRPL12 PE=1 SV=2 49 182 1.0E-20
sp|Q9DB15|RM12_MOUSE 39S ribosomal protein L12, mitochondrial OS=Mus musculus GN=Mrpl12 PE=1 SV=2 49 182 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53163|MNP1_YEAST 54S ribosomal protein L12, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNP1 PE=1 SV=1 48 182 1.0E-34
sp|Q9USJ9|MNP1_SCHPO 54S ribosomal protein L12, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl12 PE=3 SV=2 13 182 6.0E-33
sp|Q7YR75|RM12_BOVIN 39S ribosomal protein L12, mitochondrial OS=Bos taurus GN=MRPL12 PE=1 SV=1 25 182 2.0E-21
sp|P52815|RM12_HUMAN 39S ribosomal protein L12, mitochondrial OS=Homo sapiens GN=MRPL12 PE=1 SV=2 49 182 1.0E-20
sp|Q9DB15|RM12_MOUSE 39S ribosomal protein L12, mitochondrial OS=Mus musculus GN=Mrpl12 PE=1 SV=2 49 182 4.0E-20
sp|P52827|RM12_CRICR 39S ribosomal protein L12, mitochondrial OS=Cricetus cricetus GN=MRPL12 PE=2 SV=1 49 182 1.0E-17
sp|B3EER1|RL7_CHLL2 50S ribosomal protein L7/L12 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rplL PE=3 SV=1 51 181 2.0E-17
sp|O78414|RK12_GUITH 50S ribosomal protein L12, chloroplastic OS=Guillardia theta GN=rpl12 PE=3 SV=1 50 181 1.0E-14
sp|Q1XDE8|RK12_PYRYE 50S ribosomal protein L12, chloroplastic OS=Pyropia yezoensis GN=rpl12 PE=3 SV=1 48 179 5.0E-13
sp|Q9TL30|RK12_NEPOL 50S ribosomal protein L12, chloroplastic OS=Nephroselmis olivacea GN=rpl12 PE=3 SV=1 53 181 5.0E-13
sp|Q6B905|RK12_GRATL 50S ribosomal protein L12, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl12 PE=3 SV=1 48 181 1.0E-12
sp|Q9ZE21|RL7_RICPR 50S ribosomal protein L7/L12 OS=Rickettsia prowazekii (strain Madrid E) GN=rplL PE=3 SV=1 51 181 2.0E-12
sp|A8MLD1|RL7_ALKOO 50S ribosomal protein L7/L12 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplL PE=3 SV=1 51 181 2.0E-12
sp|Q2II87|RL7_ANADE 50S ribosomal protein L7/L12 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplL PE=3 SV=1 54 181 2.0E-12
sp|Q2GCD1|RL7_NOVAD 50S ribosomal protein L7/L12 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplL PE=3 SV=1 51 181 2.0E-12
sp|A6GYU1|RL7_FLAPJ 50S ribosomal protein L7/L12 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rplL PE=3 SV=1 53 181 3.0E-12
sp|B1GZ74|RL7_UNCTG 50S ribosomal protein L7/L12 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rplL PE=3 SV=1 53 181 5.0E-12
sp|Q20F00|RK12_OLTVI 50S ribosomal protein L12, chloroplastic OS=Oltmannsiellopsis viridis GN=rpl12 PE=3 SV=1 52 181 5.0E-12
sp|A7GK11|RL7_BACCN 50S ribosomal protein L7/L12 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplL PE=3 SV=1 53 181 8.0E-12
sp|B3PM75|RL7_MYCA5 50S ribosomal protein L7/L12 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rplL PE=3 SV=1 112 182 9.0E-12
sp|B4S496|RL7_PROA2 50S ribosomal protein L7/L12 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rplL PE=3 SV=1 51 181 1.0E-11
sp|A5GPD2|RL7_SYNPW 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain WH7803) GN=rplL PE=3 SV=1 48 181 1.0E-11
sp|Q68XM9|RL7_RICTY 50S ribosomal protein L7/L12 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplL PE=3 SV=1 51 181 1.0E-11
sp|A0T0Q7|RK12_THAPS 50S ribosomal protein L12, chloroplastic OS=Thalassiosira pseudonana GN=rpl12 PE=3 SV=1 48 181 1.0E-11
sp|Q60A07|RL7_METCA 50S ribosomal protein L7/L12 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplL PE=3 SV=1 53 181 2.0E-11
sp|B1VAM7|RL7_PHYAS 50S ribosomal protein L7/L12 OS=Phytoplasma australiense GN=rplL PE=3 SV=1 54 182 2.0E-11
sp|B2S2I7|RL7_TREPS 50S ribosomal protein L7/L12 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rplL PE=3 SV=1 53 181 2.0E-11
sp|O83268|RL7_TREPA 50S ribosomal protein L7/L12 OS=Treponema pallidum (strain Nichols) GN=rplL PE=3 SV=1 53 181 2.0E-11
sp|Q8KG16|RL7_CHLTE 50S ribosomal protein L7/L12 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rplL PE=3 SV=1 51 181 3.0E-11
sp|Q160X6|RL7_ROSDO 50S ribosomal protein L7/L12 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplL PE=3 SV=1 53 181 3.0E-11
sp|Q11QA4|RL7_CYTH3 50S ribosomal protein L7/L12 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rplL PE=3 SV=1 56 181 4.0E-11
sp|A5CW26|RL7_VESOH 50S ribosomal protein L7/L12 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplL PE=3 SV=1 53 181 4.0E-11
sp|A5VR16|RL7_BRUO2 50S ribosomal protein L7/L12 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rplL PE=3 SV=1 51 181 4.0E-11
sp|A1BD22|RL7_CHLPD 50S ribosomal protein L7/L12 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rplL PE=3 SV=1 51 181 5.0E-11
sp|P41189|RL7_LIBAF 50S ribosomal protein L7/L12 OS=Liberibacter africanus GN=rplL PE=3 SV=1 51 181 6.0E-11
sp|A5FZX2|RL7_ACICJ 50S ribosomal protein L7/L12 OS=Acidiphilium cryptum (strain JF-5) GN=rplL PE=3 SV=1 51 182 7.0E-11
sp|Q3ZJ41|RK12_PSEAK 50S ribosomal protein L12, chloroplastic OS=Pseudendoclonium akinetum GN=rpl12 PE=3 SV=1 51 181 7.0E-11
sp|P49550|RK12_ODOSI 50S ribosomal protein L12, chloroplastic OS=Odontella sinensis GN=rpl12 PE=3 SV=1 48 181 7.0E-11
sp|Q2N5R5|RL7_ERYLH 50S ribosomal protein L7/L12 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplL PE=3 SV=1 54 181 9.0E-11
sp|B8EMS0|RL7_METSB 50S ribosomal protein L7/L12 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplL PE=3 SV=1 53 181 1.0E-10
sp|B8IS76|RL7_METNO 50S ribosomal protein L7/L12 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplL PE=3 SV=1 51 181 1.0E-10
sp|A8ZV50|RL7_DESOH 50S ribosomal protein L7/L12 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rplL PE=3 SV=1 53 181 1.0E-10
sp|B3QQS3|RL7_CHLP8 50S ribosomal protein L7/L12 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rplL PE=3 SV=1 51 181 1.0E-10
sp|B3QC01|RL7_RHOPT 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rplL PE=3 SV=1 53 181 2.0E-10
sp|Q6N4R8|RL7_RHOPA 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rplL PE=1 SV=3 53 181 2.0E-10
sp|Q5WZM0|RL7_LEGPL 50S ribosomal protein L7/L12 OS=Legionella pneumophila (strain Lens) GN=rplL PE=3 SV=1 53 181 2.0E-10
sp|Q5ZYQ1|RL7_LEGPH 50S ribosomal protein L7/L12 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplL PE=3 SV=1 53 181 2.0E-10
sp|A5IHS2|RL7_LEGPC 50S ribosomal protein L7/L12 OS=Legionella pneumophila (strain Corby) GN=rplL PE=3 SV=1 53 181 2.0E-10
sp|Q5X867|RL7_LEGPA 50S ribosomal protein L7/L12 OS=Legionella pneumophila (strain Paris) GN=rplL PE=3 SV=1 53 181 2.0E-10
sp|B5YEX7|RL7_DICT6 50S ribosomal protein L7/L12 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplL PE=3 SV=1 53 181 2.0E-10
sp|P0A469|RL7_BRUSU 50S ribosomal protein L7/L12 OS=Brucella suis biovar 1 (strain 1330) GN=rplL PE=3 SV=1 51 181 2.0E-10
sp|B0CH42|RL7_BRUSI 50S ribosomal protein L7/L12 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rplL PE=3 SV=1 51 181 2.0E-10
sp|P0A468|RL7_BRUME 50S ribosomal protein L7/L12 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rplL PE=3 SV=1 51 181 2.0E-10
sp|C0RJL2|RL7_BRUMB 50S ribosomal protein L7/L12 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rplL PE=3 SV=1 51 181 2.0E-10
sp|A9M5R1|RL7_BRUC2 50S ribosomal protein L7/L12 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rplL PE=3 SV=1 51 181 2.0E-10
sp|P0A470|RL7_BRUAB 50S ribosomal protein L7/L12 OS=Brucella abortus biovar 1 (strain 9-941) GN=rplL PE=3 SV=1 51 181 2.0E-10
sp|Q2YM14|RL7_BRUA2 50S ribosomal protein L7/L12 OS=Brucella abortus (strain 2308) GN=rplL PE=3 SV=1 51 181 2.0E-10
sp|B2S688|RL7_BRUA1 50S ribosomal protein L7/L12 OS=Brucella abortus (strain S19) GN=rplL PE=3 SV=1 51 181 2.0E-10
sp|P51339|RK12_PORPU 50S ribosomal protein L12, chloroplastic OS=Porphyra purpurea GN=rpl12 PE=3 SV=1 48 181 2.0E-10
sp|A7HCH8|RL7_ANADF 50S ribosomal protein L7/L12 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplL PE=3 SV=1 54 181 2.0E-10
sp|Q3ATP6|RL7_CHLCH 50S ribosomal protein L7/L12 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplL PE=3 SV=1 51 181 2.0E-10
sp|B3EL60|RL7_CHLPB 50S ribosomal protein L7/L12 OS=Chlorobium phaeobacteroides (strain BS1) GN=rplL PE=3 SV=1 54 181 2.0E-10
sp|A2C031|RL7_PROM1 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain NATL1A) GN=rplL PE=3 SV=1 111 181 2.0E-10
sp|Q11HB2|RL7_CHESB 50S ribosomal protein L7/L12 OS=Chelativorans sp. (strain BNC1) GN=rplL PE=3 SV=1 51 181 3.0E-10
sp|B1ZGR9|RL7_METPB 50S ribosomal protein L7/L12 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplL PE=3 SV=1 51 181 3.0E-10
sp|A5VC06|RL7_SPHWW 50S ribosomal protein L7/L12 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rplL PE=3 SV=1 53 181 3.0E-10
sp|Q8R7U5|RL7_CALS4 50S ribosomal protein L7/L12 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplL PE=3 SV=1 53 181 3.0E-10
sp|C3LR59|RL7_VIBCM 50S ribosomal protein L7/L12 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplL PE=3 SV=1 53 181 4.0E-10
sp|Q9KV31|RL7_VIBCH 50S ribosomal protein L7/L12 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplL PE=3 SV=1 53 181 4.0E-10
sp|A5F3P4|RL7_VIBC3 50S ribosomal protein L7/L12 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplL PE=3 SV=1 53 181 4.0E-10
sp|Q3B1H6|RL7_CHLL7 50S ribosomal protein L7/L12 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplL PE=3 SV=1 51 181 4.0E-10
sp|A4YSI0|RL7_BRASO 50S ribosomal protein L7/L12 OS=Bradyrhizobium sp. (strain ORS278) GN=rplL PE=3 SV=1 53 181 4.0E-10
sp|B2IK54|RL7_BEII9 50S ribosomal protein L7/L12 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplL PE=3 SV=1 51 181 4.0E-10
sp|Q1IHH3|RL7_KORVE 50S ribosomal protein L7/L12 OS=Koribacter versatilis (strain Ellin345) GN=rplL PE=3 SV=1 51 181 4.0E-10
sp|B1LY44|RL7_METRJ 50S ribosomal protein L7/L12 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplL PE=3 SV=1 51 181 4.0E-10
sp|Q85G10|RK12_CYAME 50S ribosomal protein L12, chloroplastic OS=Cyanidioschyzon merolae GN=rpl12 PE=3 SV=1 48 181 5.0E-10
sp|B4U736|RL7_HYDS0 50S ribosomal protein L7/L12 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rplL PE=3 SV=1 46 181 5.0E-10
sp|B5Z8J6|RL7_HELPG 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain G27) GN=rplL PE=3 SV=1 53 181 6.0E-10
sp|B6JN38|RL7_HELP2 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain P12) GN=rplL PE=3 SV=1 53 181 6.0E-10
sp|Q1GSF9|RL7_SPHAL 50S ribosomal protein L7/L12 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplL PE=3 SV=1 51 181 6.0E-10
sp|Q0I6L0|RL7_SYNS3 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain CC9311) GN=rplL PE=3 SV=1 111 181 8.0E-10
sp|A4SGK7|RL7_CHLPM 50S ribosomal protein L7/L12 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rplL PE=3 SV=1 51 181 8.0E-10
sp|A7ZCN6|RL7_CAMC1 50S ribosomal protein L7/L12 OS=Campylobacter concisus (strain 13826) GN=rplL PE=3 SV=1 53 181 9.0E-10
sp|Q1D7U4|RL7_MYXXD 50S ribosomal protein L7/L12 OS=Myxococcus xanthus (strain DK 1622) GN=rplL PE=3 SV=1 54 181 9.0E-10
sp|B0K5G7|RL7_THEPX 50S ribosomal protein L7/L12 OS=Thermoanaerobacter sp. (strain X514) GN=rplL PE=3 SV=1 53 181 1.0E-09
sp|Q7U3T9|RL7_SYNPX 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain WH8102) GN=rplL PE=3 SV=1 112 181 1.0E-09
sp|Q2K9M5|RL7_RHIEC 50S ribosomal protein L7/L12 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rplL PE=3 SV=1 51 177 1.0E-09
sp|B3PW58|RL7_RHIE6 50S ribosomal protein L7/L12 OS=Rhizobium etli (strain CIAT 652) GN=rplL PE=3 SV=1 51 177 1.0E-09
sp|A6X0A8|RL7_OCHA4 50S ribosomal protein L7/L12 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rplL PE=3 SV=1 51 181 1.0E-09
sp|B0KCJ1|RL7_THEP3 50S ribosomal protein L7/L12 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplL PE=3 SV=1 53 181 1.0E-09
sp|A0AF50|RL7_LISW6 50S ribosomal protein L7/L12 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplL PE=3 SV=1 111 181 1.0E-09
sp|Q17VN5|RL7_HELAH 50S ribosomal protein L7/L12 OS=Helicobacter acinonychis (strain Sheeba) GN=rplL PE=3 SV=1 53 181 1.0E-09
sp|Q8DM25|RL7_THEEB 50S ribosomal protein L7/L12 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplL PE=3 SV=1 53 181 1.0E-09
sp|Q73JJ6|RL7_TREDE 50S ribosomal protein L7/L12 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplL PE=3 SV=1 53 174 1.0E-09
sp|A5ELN8|RL7_BRASB 50S ribosomal protein L7/L12 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rplL PE=3 SV=1 53 181 1.0E-09
sp|Q7VRP6|RL7_BLOFL 50S ribosomal protein L7/L12 OS=Blochmannia floridanus GN=rplL PE=3 SV=1 48 181 1.0E-09
sp|Q724G1|RL7_LISMF 50S ribosomal protein L7/L12 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplL PE=3 SV=1 111 181 1.0E-09
sp|C1KYI3|RL7_LISMC 50S ribosomal protein L7/L12 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplL PE=3 SV=1 111 181 1.0E-09
sp|A9BDG4|RL7_PROM4 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9211) GN=rplL PE=3 SV=1 112 181 1.0E-09
sp|B2UUW1|RL7_HELPS 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain Shi470) GN=rplL PE=3 SV=1 53 181 1.0E-09
sp|P56875|RL7_HELPJ 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rplL PE=3 SV=1 53 181 1.0E-09
sp|Q1CS67|RL7_HELPH 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain HPAG1) GN=rplL PE=3 SV=1 53 181 1.0E-09
sp|P36688|RK12_NICSY 50S ribosomal protein L12, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 44 181 1.0E-09
sp|P24929|RK12_TOBAC 50S ribosomal protein L12, chloroplastic OS=Nicotiana tabacum GN=RPL12 PE=1 SV=1 44 181 1.0E-09
sp|O22386|RK12_ORYSJ 50S ribosomal protein L12, chloroplastic OS=Oryza sativa subsp. japonica GN=RPL12-2 PE=2 SV=2 45 181 1.0E-09
sp|P55834|RL7_HELPY 50S ribosomal protein L7/L12 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rplL PE=1 SV=1 53 181 2.0E-09
sp|B4SG12|RL7_PELPB 50S ribosomal protein L7/L12 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rplL PE=3 SV=1 51 181 2.0E-09
sp|A0T0C0|RK12_PHATC 50S ribosomal protein L12, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl12 PE=3 SV=1 48 166 2.0E-09
sp|A1USC7|RL7_BARBK 50S ribosomal protein L7/L12 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rplL PE=3 SV=1 51 181 2.0E-09
sp|Q46HH2|RL7_PROMT 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain NATL2A) GN=rplL PE=3 SV=1 111 181 2.0E-09
sp|B1IGG3|RL7_CLOBK 50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|C1FMW0|RL7_CLOBJ 50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|A5I7L5|RL7_CLOBH 50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|A7FZ78|RL7_CLOB1 50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|Q07KK6|RL7_RHOP5 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|A7IKP9|RL7_XANP2 50S ribosomal protein L7/L12 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplL PE=3 SV=1 51 181 2.0E-09
sp|Q06030|RK121_SECCE 50S ribosomal protein L12-1, chloroplastic OS=Secale cereale GN=RPL12-1 PE=2 SV=1 43 181 2.0E-09
sp|Q4L3K1|RL7_STAHJ 50S ribosomal protein L7/L12 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|B8D6V1|RL7_BUCAT 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|P57147|RL7_BUCAI 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|B8D8J7|RL7_BUCA5 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|A7GJ83|RL7_CLOBL 50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplL PE=3 SV=1 111 181 2.0E-09
sp|Q9L5W4|RL7_LIBAC 50S ribosomal protein L7/L12 OS=Liberibacter africanus subsp. capensis GN=rplL PE=3 SV=1 51 181 2.0E-09
sp|Q1ACG9|RK12_CHAVU 50S ribosomal protein L12, chloroplastic OS=Chara vulgaris GN=rpl12 PE=3 SV=2 53 181 2.0E-09
sp|Q89J73|RL7_BRADU 50S ribosomal protein L7/L12 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|B4UDT3|RL7_ANASK 50S ribosomal protein L7/L12 OS=Anaeromyxobacter sp. (strain K) GN=rplL PE=3 SV=1 54 181 2.0E-09
sp|B8JB71|RL7_ANAD2 50S ribosomal protein L7/L12 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplL PE=3 SV=1 54 181 2.0E-09
sp|A8GYW8|RL7_SHEPA 50S ribosomal protein L7/L12 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|B8GV66|RL7_THISH 50S ribosomal protein L7/L12 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|Q0BUQ8|RL7_GRABC 50S ribosomal protein L7/L12 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplL PE=3 SV=1 51 181 2.0E-09
sp|B1KSN4|RL7_CLOBM 50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplL PE=3 SV=1 111 181 2.0E-09
sp|C3KVR0|RL7_CLOB6 50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplL PE=3 SV=1 111 181 2.0E-09
sp|B8E0K0|RL7_DICTD 50S ribosomal protein L7/L12 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|Q134R7|RL7_RHOPS 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain BisB5) GN=rplL PE=3 SV=1 53 181 2.0E-09
sp|A7GZK0|RL7_CAMC5 50S ribosomal protein L7/L12 OS=Campylobacter curvus (strain 525.92) GN=rplL PE=3 SV=1 53 181 3.0E-09
sp|Q92QH8|RL7_RHIME 50S ribosomal protein L7/L12 OS=Rhizobium meliloti (strain 1021) GN=rplL PE=3 SV=1 51 181 3.0E-09
sp|P02395|RL7_MICLU 50S ribosomal protein L7/L12 OS=Micrococcus luteus GN=rplL PE=1 SV=1 53 181 3.0E-09
sp|B9JDS0|RL7_AGRRK 50S ribosomal protein L7/L12 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rplL PE=3 SV=1 51 177 3.0E-09
sp|Q8UE07|RL7_AGRFC 50S ribosomal protein L7/L12 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplL PE=1 SV=1 51 181 3.0E-09
sp|A6LKB9|RL7_THEM4 50S ribosomal protein L7/L12 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplL PE=3 SV=1 50 181 3.0E-09
sp|A6U850|RL7_SINMW 50S ribosomal protein L7/L12 OS=Sinorhizobium medicae (strain WSM419) GN=rplL PE=3 SV=1 51 181 3.0E-09
sp|B8DF04|RL7_LISMH 50S ribosomal protein L7/L12 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplL PE=3 SV=1 111 181 3.0E-09
sp|Q92F24|RL7_LISIN 50S ribosomal protein L7/L12 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplL PE=3 SV=1 111 181 3.0E-09
sp|B0CAD2|RL7_ACAM1 50S ribosomal protein L7/L12 OS=Acaryochloris marina (strain MBIC 11017) GN=rplL PE=3 SV=1 53 181 3.0E-09
sp|Q06036|RK122_SECCE 50S ribosomal protein L12-2, chloroplastic OS=Secale cereale GN=RPL12-2 PE=2 SV=1 48 181 3.0E-09
sp|Q2W2I0|RL7_MAGSA 50S ribosomal protein L7/L12 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplL PE=3 SV=1 51 181 3.0E-09
sp|C0QQL5|RL7_PERMH 50S ribosomal protein L7/L12 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rplL PE=3 SV=1 53 181 3.0E-09
sp|Q7VDY8|RL7_PROMA 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rplL PE=3 SV=1 112 181 3.0E-09
sp|A8GMA6|RL7_RICAH 50S ribosomal protein L7/L12 OS=Rickettsia akari (strain Hartford) GN=rplL PE=3 SV=1 51 181 3.0E-09
sp|B2KEN2|RL7_ELUMP 50S ribosomal protein L7/L12 OS=Elusimicrobium minutum (strain Pei191) GN=rplL PE=3 SV=1 53 181 4.0E-09
sp|Q38V11|RL7_LACSS 50S ribosomal protein L7/L12 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplL PE=3 SV=1 51 181 4.0E-09
sp|Q31CY0|RL7_PROM9 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplL PE=3 SV=1 111 181 4.0E-09
sp|P36211|RK122_ARATH 50S ribosomal protein L12-2, chloroplastic OS=Arabidopsis thaliana GN=RPL12B PE=3 SV=2 44 181 4.0E-09
sp|Q2JM48|RL7_SYNJB 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplL PE=3 SV=1 48 181 4.0E-09
sp|Q3SSY1|RL7_NITWN 50S ribosomal protein L7/L12 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplL PE=3 SV=1 53 181 4.0E-09
sp|Q8YAA3|RL7_LISMO 50S ribosomal protein L7/L12 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplL PE=3 SV=1 111 181 4.0E-09
sp|A1QZH8|RL7_BORT9 50S ribosomal protein L7/L12 OS=Borrelia turicatae (strain 91E135) GN=rplL PE=3 SV=1 105 181 4.0E-09
sp|Q1AU21|RL7_RUBXD 50S ribosomal protein L7/L12 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplL PE=3 SV=1 53 181 5.0E-09
sp|Q2GFP2|RL7_EHRCR 50S ribosomal protein L7/L12 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rplL PE=3 SV=1 51 150 5.0E-09
sp|A8G2K8|RL7_PROM2 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9215) GN=rplL PE=3 SV=1 111 181 6.0E-09
sp|Q5NPK7|RL7_ZYMMO 50S ribosomal protein L7/L12 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplL PE=3 SV=1 51 181 6.0E-09
sp|Q98N67|RL7_RHILO 50S ribosomal protein L7/L12 OS=Rhizobium loti (strain MAFF303099) GN=rplL PE=3 SV=1 51 181 6.0E-09
sp|A4J102|RL7_DESRM 50S ribosomal protein L7/L12 OS=Desulfotomaculum reducens (strain MI-1) GN=rplL PE=3 SV=1 50 181 6.0E-09
sp|B0UHX7|RL7_METS4 50S ribosomal protein L7/L12 OS=Methylobacterium sp. (strain 4-46) GN=rplL PE=3 SV=1 51 181 6.0E-09
sp|P36212|RK123_ARATH 50S ribosomal protein L12-3, chloroplastic OS=Arabidopsis thaliana GN=RPL12C PE=2 SV=2 17 181 6.0E-09
sp|A2BNZ6|RL7_PROMS 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain AS9601) GN=rplL PE=3 SV=1 111 181 6.0E-09
sp|A3PAR9|RL7_PROM0 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9301) GN=rplL PE=3 SV=1 111 181 6.0E-09
sp|Q2IXS1|RL7_RHOP2 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplL PE=3 SV=1 53 181 7.0E-09
sp|P48124|RK12_CYAPA 50S ribosomal protein L12, cyanelle OS=Cyanophora paradoxa GN=rpl12 PE=3 SV=1 48 175 7.0E-09
sp|Q7V384|RL7_PROMP 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplL PE=3 SV=1 111 181 8.0E-09
sp|A9W8N7|RL7_METEP 50S ribosomal protein L7/L12 OS=Methylobacterium extorquens (strain PA1) GN=rplL PE=3 SV=1 51 181 8.0E-09
sp|B7KN44|RL7_METC4 50S ribosomal protein L7/L12 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplL PE=3 SV=1 51 181 8.0E-09
sp|Q1QN45|RL7_NITHX 50S ribosomal protein L7/L12 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplL PE=3 SV=1 53 181 8.0E-09
sp|B7GJ57|RL7_ANOFW 50S ribosomal protein L7/L12 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplL PE=3 SV=1 53 181 9.0E-09
sp|A2BUH8|RL7_PROM5 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplL PE=3 SV=1 111 181 1.0E-08
sp|C0ZIG8|RL7_BREBN 50S ribosomal protein L7/L12 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplL PE=3 SV=1 111 181 1.0E-08
sp|A9ISF8|RL7_BART1 50S ribosomal protein L7/L12 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplL PE=3 SV=1 51 181 1.0E-08
sp|B6JER8|RL7_OLICO 50S ribosomal protein L7/L12 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplL PE=3 SV=1 53 181 1.0E-08
sp|Q211D7|RL7_RHOPB 50S ribosomal protein L7/L12 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplL PE=3 SV=1 53 181 1.0E-08
sp|Q8F0S1|RL7_LEPIN 50S ribosomal protein L7/L12 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rplL PE=3 SV=1 54 181 1.0E-08
sp|Q72UA9|RL7_LEPIC 50S ribosomal protein L7/L12 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rplL PE=3 SV=1 54 181 1.0E-08
sp|P31915|RK12_EUGGR 50S ribosomal protein L12, chloroplastic OS=Euglena gracilis GN=rpl12 PE=3 SV=1 48 177 1.0E-08
sp|Q3A9Q5|RL7_CARHZ 50S ribosomal protein L7/L12 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplL PE=3 SV=1 50 181 1.0E-08
sp|B2S093|RL7_BORHD 50S ribosomal protein L7/L12 OS=Borrelia hermsii (strain HS1 / DAH) GN=rplL PE=3 SV=1 111 181 1.0E-08
sp|A7HWQ3|RL7_PARL1 50S ribosomal protein L7/L12 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplL PE=3 SV=1 51 181 1.0E-08
sp|Q250P5|RL7_DESHY 50S ribosomal protein L7/L12 OS=Desulfitobacterium hafniense (strain Y51) GN=rplL PE=3 SV=1 50 181 1.0E-08
sp|B8G1V3|RL7_DESHD 50S ribosomal protein L7/L12 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplL PE=3 SV=1 50 181 1.0E-08
sp|Q9KGE3|RL7_BACHD 50S ribosomal protein L7/L12 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplL PE=3 SV=1 53 181 1.0E-08
sp|P36247|RL7_LIBAS 50S ribosomal protein L7/L12 OS=Liberibacter asiaticus GN=rplL PE=3 SV=1 51 177 2.0E-08
sp|Q0SNB7|RL7_BORAP 50S ribosomal protein L7/L12 OS=Borrelia afzelii (strain PKo) GN=rplL PE=3 SV=1 64 181 2.0E-08
sp|A8HTY4|RL7_AZOC5 50S ribosomal protein L7/L12 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplL PE=3 SV=1 51 181 2.0E-08
sp|Q5FTX6|RL7_GLUOX 50S ribosomal protein L7/L12 OS=Gluconobacter oxydans (strain 621H) GN=rplL PE=3 SV=1 51 181 2.0E-08
sp|B5RRJ8|RL7_BORRA 50S ribosomal protein L7/L12 OS=Borrelia recurrentis (strain A1) GN=rplL PE=3 SV=1 111 181 2.0E-08
sp|B5RLV0|RL7_BORDL 50S ribosomal protein L7/L12 OS=Borrelia duttonii (strain Ly) GN=rplL PE=3 SV=1 111 181 2.0E-08
sp|Q6FZL8|RL7_BARQU 50S ribosomal protein L7/L12 OS=Bartonella quintana (strain Toulouse) GN=rplL PE=3 SV=1 51 181 2.0E-08
sp|P0A467|RL7_AQUPY 50S ribosomal protein L7/L12 OS=Aquifex pyrophilus GN=rplL PE=3 SV=1 51 181 2.0E-08
sp|P0A466|RL7_AQUAE 50S ribosomal protein L7/L12 OS=Aquifex aeolicus (strain VF5) GN=rplL PE=3 SV=1 51 181 2.0E-08
sp|Q3YST6|RL7_EHRCJ 50S ribosomal protein L7/L12 OS=Ehrlichia canis (strain Jake) GN=rplL PE=3 SV=1 51 150 2.0E-08
sp|C1D0S3|RL7_DEIDV 50S ribosomal protein L7/L12 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rplL PE=3 SV=1 54 181 2.0E-08
sp|B6IRP5|RL7_RHOCS 50S ribosomal protein L7/L12 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplL PE=3 SV=1 50 181 2.0E-08
sp|P36210|RK121_ARATH 50S ribosomal protein L12-1, chloroplastic OS=Arabidopsis thaliana GN=RPL12A PE=2 SV=1 44 181 2.0E-08
sp|Q7NK76|RL7_GLOVI 50S ribosomal protein L7/L12 OS=Gloeobacter violaceus (strain PCC 7421) GN=rplL PE=3 SV=1 46 181 2.0E-08
sp|C3MAX1|RL7_RHISN 50S ribosomal protein L7/L12 OS=Rhizobium sp. (strain NGR234) GN=rplL PE=3 SV=1 51 181 2.0E-08
sp|Q4A5Y8|RL7_MYCS5 50S ribosomal protein L7/L12 OS=Mycoplasma synoviae (strain 53) GN=rplL PE=3 SV=1 123 182 2.0E-08
sp|A4IJH9|RL7_GEOTN 50S ribosomal protein L7/L12 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplL PE=3 SV=1 53 181 2.0E-08
sp|Q0ABI3|RL7_ALKEH 50S ribosomal protein L7/L12 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rplL PE=3 SV=1 53 181 2.0E-08
sp|B9JVM7|RL7_AGRVS 50S ribosomal protein L7/L12 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplL PE=3 SV=1 51 181 2.0E-08
sp|Q1MIF0|RL7_RHIL3 50S ribosomal protein L7/L12 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rplL PE=3 SV=1 51 177 3.0E-08
sp|P02398|RK12_SPIOL 50S ribosomal protein L12, chloroplastic OS=Spinacia oleracea GN=RPL12 PE=1 SV=2 33 181 3.0E-08
sp|A9NEL5|RL7_ACHLI 50S ribosomal protein L7/L12 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplL PE=3 SV=1 54 181 3.0E-08
sp|Q1KVU3|RK12_ACUOB 50S ribosomal protein L12, chloroplastic OS=Acutodesmus obliquus GN=rpl12 PE=3 SV=1 51 181 3.0E-08
sp|Q7V476|RL7_PROMM 50S ribosomal protein L7/L12 OS=Prochlorococcus marinus (strain MIT 9313) GN=rplL PE=3 SV=1 112 181 3.0E-08
sp|Q1WST5|RL7_LACS1 50S ribosomal protein L7/L12 OS=Lactobacillus salivarius (strain UCC118) GN=rplL PE=3 SV=1 111 181 3.0E-08
sp|Q058E4|RL7_BUCCC 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rplL PE=3 SV=1 53 177 3.0E-08
sp|P23349|RL7_SYNY3 50S ribosomal protein L7/L12 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplL PE=1 SV=3 53 177 3.0E-08
sp|P0C8S3|RL7_COXBU 50S ribosomal protein L7/L12 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplL PE=1 SV=1 53 161 3.0E-08
sp|A9NAL3|RL7_COXBR 50S ribosomal protein L7/L12 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplL PE=3 SV=1 53 161 3.0E-08
sp|A9KD40|RL7_COXBN 50S ribosomal protein L7/L12 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplL PE=3 SV=1 53 161 3.0E-08
sp|B6J272|RL7_COXB2 50S ribosomal protein L7/L12 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplL PE=3 SV=1 53 161 3.0E-08
sp|B6J5C1|RL7_COXB1 50S ribosomal protein L7/L12 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplL PE=3 SV=1 53 161 3.0E-08
sp|A0RQI6|RL7_CAMFF 50S ribosomal protein L7/L12 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rplL PE=3 SV=1 53 181 4.0E-08
sp|B2TIG7|RL7_CLOBB 50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplL PE=3 SV=1 111 181 4.0E-08
sp|B2UYA2|RL7_CLOBA 50S ribosomal protein L7/L12 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplL PE=3 SV=1 111 181 4.0E-08
sp|Q2RQV2|RL7_RHORT 50S ribosomal protein L7/L12 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplL PE=3 SV=1 51 181 4.0E-08
sp|Q74L08|RL7_LACJO 50S ribosomal protein L7/L12 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplL PE=3 SV=1 111 181 4.0E-08
sp|Q045V5|RL7_LACGA 50S ribosomal protein L7/L12 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplL PE=3 SV=1 111 181 4.0E-08
sp|Q2JTQ2|RL7_SYNJA 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplL PE=3 SV=1 46 181 4.0E-08
sp|B1X073|RL7_CYAA5 50S ribosomal protein L7/L12 OS=Cyanothece sp. (strain ATCC 51142) GN=rplL PE=3 SV=1 53 181 5.0E-08
sp|B5ZYS6|RL7_RHILW 50S ribosomal protein L7/L12 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rplL PE=3 SV=1 51 177 5.0E-08
sp|B1HMZ8|RL7_LYSSC 50S ribosomal protein L7/L12 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplL PE=3 SV=1 53 181 5.0E-08
sp|Q3AUJ8|RL7_SYNS9 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain CC9902) GN=rplL PE=3 SV=1 112 181 6.0E-08
sp|Q7VJ81|RL7_HELHP 50S ribosomal protein L7/L12 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rplL PE=3 SV=1 53 181 7.0E-08
sp|Q9RST0|RL7_DEIRA 50S ribosomal protein L7/L12 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rplL PE=1 SV=1 54 181 7.0E-08
sp|A8EXK7|RL7_RICCK 50S ribosomal protein L7/L12 OS=Rickettsia canadensis (strain McKiel) GN=rplL PE=3 SV=1 51 181 8.0E-08
sp|Q6G3X6|RL7_BARHE 50S ribosomal protein L7/L12 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rplL PE=3 SV=1 51 181 9.0E-08
sp|B0S065|RL7_FINM2 50S ribosomal protein L7/L12 OS=Finegoldia magna (strain ATCC 29328) GN=rplL PE=3 SV=1 51 181 9.0E-08
sp|A7I3U0|RL7_CAMHC 50S ribosomal protein L7/L12 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rplL PE=3 SV=1 53 181 9.0E-08
sp|B0TC46|RL7_HELMI 50S ribosomal protein L7/L12 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplL PE=3 SV=1 50 181 9.0E-08
sp|A1T066|RL7_PSYIN 50S ribosomal protein L7/L12 OS=Psychromonas ingrahamii (strain 37) GN=rplL PE=3 SV=1 53 181 1.0E-07
sp|B7JWT5|RL7_CYAP8 50S ribosomal protein L7/L12 OS=Cyanothece sp. (strain PCC 8801) GN=rplL PE=3 SV=1 53 181 1.0E-07
sp|A9VNB3|RL7_BACWK 50S ribosomal protein L7/L12 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplL PE=3 SV=1 53 181 1.0E-07
sp|Q8KTP9|RL7_TREPR 50S ribosomal protein L7/L12 OS=Tremblaya princeps GN=rplL PE=3 SV=1 53 177 1.0E-07
sp|B9E8Q7|RL7_MACCJ 50S ribosomal protein L7/L12 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplL PE=3 SV=1 53 181 1.0E-07
sp|Q5N3N6|RL7_SYNP6 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplL PE=3 SV=1 48 181 1.0E-07
sp|Q31QK6|RL7_SYNE7 50S ribosomal protein L7/L12 OS=Synechococcus elongatus (strain PCC 7942) GN=rplL PE=3 SV=1 48 181 1.0E-07
sp|Q5L407|RL7_GEOKA 50S ribosomal protein L7/L12 OS=Geobacillus kaustophilus (strain HTA426) GN=rplL PE=3 SV=1 53 181 1.0E-07
sp|Q01VB0|RL7_SOLUE 50S ribosomal protein L7/L12 OS=Solibacter usitatus (strain Ellin6076) GN=rplL PE=3 SV=1 54 181 1.0E-07
sp|A8YTF2|RL7_LACH4 50S ribosomal protein L7/L12 OS=Lactobacillus helveticus (strain DPC 4571) GN=rplL PE=3 SV=1 127 181 1.0E-07
sp|Q49V50|RL7_STAS1 50S ribosomal protein L7/L12 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplL PE=3 SV=1 53 181 1.0E-07
sp|A6LPQ3|RL7_CLOB8 50S ribosomal protein L7/L12 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplL PE=3 SV=1 111 177 2.0E-07
sp|Q5FM12|RL7_LACAC 50S ribosomal protein L7/L12 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rplL PE=3 SV=1 121 181 2.0E-07
sp|Q8XHR7|RL7_CLOPE 50S ribosomal protein L7/L12 OS=Clostridium perfringens (strain 13 / Type A) GN=rplL PE=3 SV=1 111 181 2.0E-07
sp|A0L5W5|RL7_MAGMM 50S ribosomal protein L7/L12 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rplL PE=3 SV=1 53 181 2.0E-07
sp|B7KIR5|RL7_CYAP7 50S ribosomal protein L7/L12 OS=Cyanothece sp. (strain PCC 7424) GN=rplL PE=3 SV=1 83 181 2.0E-07
sp|B3QZG9|RL7_PHYMT 50S ribosomal protein L7/L12 OS=Phytoplasma mali (strain AT) GN=rplL PE=3 SV=1 53 182 2.0E-07
sp|A5FIJ2|RL7_FLAJ1 50S ribosomal protein L7/L12 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rplL PE=3 SV=1 53 181 2.0E-07
sp|Q8YLJ5|RL7_NOSS1 50S ribosomal protein L7/L12 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplL PE=3 SV=3 53 181 2.0E-07
sp|Q0SQD5|RL7_CLOPS 50S ribosomal protein L7/L12 OS=Clostridium perfringens (strain SM101 / Type A) GN=rplL PE=3 SV=1 111 181 2.0E-07
sp|Q0TMN7|RL7_CLOP1 50S ribosomal protein L7/L12 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rplL PE=3 SV=1 111 181 2.0E-07
sp|Q3AGT2|RL7_SYNSC 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain CC9605) GN=rplL PE=3 SV=1 112 181 2.0E-07
sp|A1REA6|RL7_SHESW 50S ribosomal protein L7/L12 OS=Shewanella sp. (strain W3-18-1) GN=rplL PE=3 SV=1 53 181 2.0E-07
sp|A4YBZ1|RL7_SHEPC 50S ribosomal protein L7/L12 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplL PE=3 SV=1 53 181 2.0E-07
sp|Q8EK75|RL7_SHEON 50S ribosomal protein L7/L12 OS=Shewanella oneidensis (strain MR-1) GN=rplL PE=3 SV=1 53 181 2.0E-07
sp|B9KFG6|RL7_CAMLR 50S ribosomal protein L7/L12 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rplL PE=3 SV=1 54 181 2.0E-07
sp|Q6MJ06|RL7_BDEBA 50S ribosomal protein L7/L12 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rplL PE=3 SV=1 53 181 2.0E-07
sp|A5N4N8|RL7_CLOK5 50S ribosomal protein L7/L12 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplL PE=3 SV=1 111 181 2.0E-07
sp|B9DYA0|RL7_CLOK1 50S ribosomal protein L7/L12 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplL PE=3 SV=1 111 181 2.0E-07
sp|A9H3S4|RL7_GLUDA 50S ribosomal protein L7/L12 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplL PE=3 SV=1 51 181 2.0E-07
sp|Q119S9|RL7_TRIEI 50S ribosomal protein L7/L12 OS=Trichodesmium erythraeum (strain IMS101) GN=rplL PE=3 SV=1 48 181 2.0E-07
sp|B3QYL3|RL7_CHLT3 50S ribosomal protein L7/L12 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rplL PE=3 SV=1 51 177 2.0E-07
sp|B2JA77|RL7_NOSP7 50S ribosomal protein L7/L12 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rplL PE=3 SV=1 53 181 2.0E-07
sp|Q6GJC8|RL7_STAAR 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain MRSA252) GN=rplL PE=3 SV=1 53 181 2.0E-07
sp|A8F973|RL7_BACP2 50S ribosomal protein L7/L12 OS=Bacillus pumilus (strain SAFR-032) GN=rplL PE=3 SV=1 111 181 2.0E-07
sp|Q8ETZ0|RL7_OCEIH 50S ribosomal protein L7/L12 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplL PE=3 SV=1 111 181 2.0E-07
sp|Q65PB7|RL7_BACLD 50S ribosomal protein L7/L12 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplL PE=3 SV=1 111 181 2.0E-07
sp|B1I1M6|RL7_DESAP 50S ribosomal protein L7/L12 OS=Desulforudis audaxviator (strain MP104C) GN=rplL PE=3 SV=1 50 181 2.0E-07
sp|Q9TLZ9|RK12_CYACA 50S ribosomal protein L12, chloroplastic OS=Cyanidium caldarium GN=rpl12 PE=3 SV=1 107 181 2.0E-07
sp|A0PXT7|RL7_CLONN 50S ribosomal protein L7/L12 OS=Clostridium novyi (strain NT) GN=rplL PE=3 SV=1 123 181 2.0E-07
sp|P66062|RL7_STAAW 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain MW2) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|A8YZN8|RL7_STAAT 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|Q6GBU7|RL7_STAAS 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain MSSA476) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|P99154|RL7_STAAN 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain N315) GN=rplL PE=1 SV=1 53 181 3.0E-07
sp|P66061|RL7_STAAM 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|Q5HID5|RL7_STAAC 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain COL) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|A5IQ94|RL7_STAA9 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain JH9) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|P48860|RL7_STAA8 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplL PE=3 SV=2 53 181 3.0E-07
sp|Q2FJA0|RL7_STAA3 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain USA300) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|A6TZ17|RL7_STAA2 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain JH1) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|A7WYW4|RL7_STAA1 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|Q1J0P3|RL7_DEIGD 50S ribosomal protein L7/L12 OS=Deinococcus geothermalis (strain DSM 11300) GN=rplL PE=3 SV=1 54 181 3.0E-07
sp|P41188|RL7_BUCAP 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplL PE=3 SV=2 53 181 3.0E-07
sp|Q2RFN8|RL7_MOOTA 50S ribosomal protein L7/L12 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplL PE=3 SV=1 50 181 3.0E-07
sp|B7J1W2|RL7_BORBZ 50S ribosomal protein L7/L12 OS=Borrelia burgdorferi (strain ZS7) GN=rplL PE=3 SV=1 111 181 3.0E-07
sp|O51351|RL7_BORBU 50S ribosomal protein L7/L12 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rplL PE=3 SV=1 111 181 3.0E-07
sp|Q492B8|RL7_BLOPB 50S ribosomal protein L7/L12 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplL PE=3 SV=1 53 181 3.0E-07
sp|Q8CTT1|RL7_STAES 50S ribosomal protein L7/L12 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplL PE=3 SV=1 53 181 4.0E-07
sp|Q5HRL2|RL7_STAEQ 50S ribosomal protein L7/L12 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplL PE=3 SV=1 53 181 4.0E-07
sp|Q6AP79|RL7_DESPS 50S ribosomal protein L7/L12 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplL PE=3 SV=1 112 177 4.0E-07
sp|B8HVL2|RL7_CYAP4 50S ribosomal protein L7/L12 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplL PE=3 SV=1 111 181 4.0E-07
sp|A6TWJ1|RL7_ALKMQ 50S ribosomal protein L7/L12 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rplL PE=3 SV=1 111 181 4.0E-07
sp|B2V7M1|RL7_SULSY 50S ribosomal protein L7/L12 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rplL PE=3 SV=1 53 181 5.0E-07
sp|Q3ILQ0|RL7_PSEHT 50S ribosomal protein L7/L12 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplL PE=3 SV=1 53 181 5.0E-07
sp|P02397|RL7_RHOSH 50S ribosomal protein L7/L12 OS=Rhodobacter sphaeroides GN=rplL PE=1 SV=2 53 181 5.0E-07
sp|Q28UX8|RL7_JANSC 50S ribosomal protein L7/L12 OS=Jannaschia sp. (strain CCS1) GN=rplL PE=3 SV=1 53 181 5.0E-07
sp|Q15YB2|RL7_PSEA6 50S ribosomal protein L7/L12 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplL PE=3 SV=1 112 181 5.0E-07
sp|A6QEJ2|RL7_STAAE 50S ribosomal protein L7/L12 OS=Staphylococcus aureus (strain Newman) GN=rplL PE=3 SV=1 53 181 5.0E-07
sp|C0Q9Y0|RL7_DESAH 50S ribosomal protein L7/L12 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rplL PE=3 SV=1 53 181 6.0E-07
sp|P56345|RK12_CHLVU 50S ribosomal protein L12, chloroplastic OS=Chlorella vulgaris GN=rpl12 PE=3 SV=1 48 181 6.0E-07
sp|Q98QS2|RL7_MYCPU 50S ribosomal protein L7/L12 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rplL PE=3 SV=1 111 166 7.0E-07
sp|Q1LSX8|RL7_BAUCH 50S ribosomal protein L7/L12 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplL PE=3 SV=1 53 181 7.0E-07
sp|P44348|RL7_HAEIN 50S ribosomal protein L7/L12 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplL PE=3 SV=2 53 181 7.0E-07
sp|A5UHD2|RL7_HAEIG 50S ribosomal protein L7/L12 OS=Haemophilus influenzae (strain PittGG) GN=rplL PE=3 SV=1 53 181 7.0E-07
sp|A5UE95|RL7_HAEIE 50S ribosomal protein L7/L12 OS=Haemophilus influenzae (strain PittEE) GN=rplL PE=3 SV=1 53 181 7.0E-07
sp|Q4QMS6|RL7_HAEI8 50S ribosomal protein L7/L12 OS=Haemophilus influenzae (strain 86-028NP) GN=rplL PE=3 SV=1 53 181 7.0E-07
sp|B7MRB2|RL7_ECO81 50S ribosomal protein L7/L12 OS=Escherichia coli O81 (strain ED1a) GN=rplL PE=3 SV=1 53 181 7.0E-07
sp|P05392|RL7_GEOSE 50S ribosomal protein L7/L12 OS=Geobacillus stearothermophilus GN=rplL PE=1 SV=1 53 181 8.0E-07
sp|Q9AAU7|RL7_CAUCR 50S ribosomal protein L7/L12 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplL PE=3 SV=1 50 181 8.0E-07
sp|B8GZW2|RL7_CAUCN 50S ribosomal protein L7/L12 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplL PE=3 SV=1 50 181 8.0E-07
sp|B3ETZ1|RL7_AMOA5 50S ribosomal protein L7/L12 OS=Amoebophilus asiaticus (strain 5a2) GN=rplL PE=3 SV=1 108 181 8.0E-07
sp|B9L7J5|RL7_NAUPA 50S ribosomal protein L7/L12 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rplL PE=3 SV=1 53 181 9.0E-07
sp|Q2EEW8|RK12_HELSJ 50S ribosomal protein L12, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=rpl12 PE=3 SV=1 48 181 9.0E-07
sp|P02394|RL7_BACSU 50S ribosomal protein L7/L12 OS=Bacillus subtilis (strain 168) GN=rplL PE=1 SV=4 111 181 1.0E-06
sp|A7Z0M7|RL7_BACMF 50S ribosomal protein L7/L12 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplL PE=3 SV=1 111 181 1.0E-06
sp|Q1MPU3|RL7_LAWIP 50S ribosomal protein L7/L12 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplL PE=3 SV=1 53 181 1.0E-06
sp|B8D0B5|RL7_HALOH 50S ribosomal protein L7/L12 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplL PE=3 SV=1 111 181 1.0E-06
sp|B9KL82|RL7_RHOSK 50S ribosomal protein L7/L12 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplL PE=3 SV=1 53 181 1.0E-06
sp|Q3J5T1|RL7_RHOS4 50S ribosomal protein L7/L12 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplL PE=3 SV=1 53 181 1.0E-06
sp|B1XJG9|RL7_SYNP2 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplL PE=3 SV=1 53 181 1.0E-06
sp|Q88YW7|RL7_LACPL 50S ribosomal protein L7/L12 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplL PE=3 SV=1 127 181 1.0E-06
sp|A9KJL7|RL7_CLOPH 50S ribosomal protein L7/L12 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rplL PE=3 SV=1 112 181 1.0E-06
sp|Q18CE7|RL7_PEPD6 50S ribosomal protein L7/L12 OS=Peptoclostridium difficile (strain 630) GN=rplL PE=3 SV=1 51 181 1.0E-06
sp|C5CGE0|RL7_KOSOT 50S ribosomal protein L7/L12 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplL PE=3 SV=1 53 181 1.0E-06
sp|A4WVL7|RL7_RHOS5 50S ribosomal protein L7/L12 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplL PE=3 SV=1 53 181 1.0E-06
sp|B8FEU2|RL7_DESAA 50S ribosomal protein L7/L12 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplL PE=3 SV=1 53 181 1.0E-06
sp|Q03ST6|RL7_LACBA 50S ribosomal protein L7/L12 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rplL PE=3 SV=1 112 181 2.0E-06
sp|A1VYJ3|RL7_CAMJJ 50S ribosomal protein L7/L12 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rplL PE=3 SV=1 53 181 2.0E-06
sp|A8FKR2|RL7_CAMJ8 50S ribosomal protein L7/L12 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rplL PE=3 SV=1 53 181 2.0E-06
sp|Q9PI32|RL7_CAMJE 50S ribosomal protein L7/L12 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rplL PE=3 SV=1 53 181 2.0E-06
sp|B6ENR4|RL7_ALISL 50S ribosomal protein L7/L12 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplL PE=3 SV=1 124 181 2.0E-06
sp|Q089R2|RL7_SHEFN 50S ribosomal protein L7/L12 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplL PE=3 SV=1 53 181 2.0E-06
sp|Q2S1Q4|RL7_SALRD 50S ribosomal protein L7/L12 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplL PE=3 SV=1 50 182 2.0E-06
sp|P0A0W9|RL7_NEISI 50S ribosomal protein L7/L12 OS=Neisseria sicca GN=rplL PE=3 SV=1 53 181 2.0E-06
sp|P0A0W8|RL7_NEILA 50S ribosomal protein L7/L12 OS=Neisseria lactamica GN=rplL PE=3 SV=1 53 181 2.0E-06
sp|Q5HVZ0|RL7_CAMJR 50S ribosomal protein L7/L12 OS=Campylobacter jejuni (strain RM1221) GN=rplL PE=3 SV=1 53 181 2.0E-06
sp|Q9F5M1|RL7_NEIPE 50S ribosomal protein L7/L12 OS=Neisseria perflava GN=rplL PE=3 SV=1 53 181 2.0E-06
sp|Q82T74|RL7_NITEU 50S ribosomal protein L7/L12 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplL PE=3 SV=1 52 177 2.0E-06
sp|C0QWX5|RL7_BRAHW 50S ribosomal protein L7/L12 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rplL PE=3 SV=1 53 164 2.0E-06
sp|A1JIH9|RL7_YERE8 50S ribosomal protein L7/L12 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplL PE=3 SV=1 53 181 2.0E-06
sp|A1WVD0|RL7_HALHL 50S ribosomal protein L7/L12 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplL PE=3 SV=1 53 181 3.0E-06
sp|E6MUA0|RL7_NEIMH 50S ribosomal protein L7/L12 OS=Neisseria meningitidis serogroup B / serotype 15 (strain H44/76) GN=rplL PE=1 SV=1 53 181 3.0E-06
sp|A1KRG5|RL7_NEIMF 50S ribosomal protein L7/L12 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplL PE=3 SV=1 53 181 3.0E-06
sp|P0A0X1|RL7_NEIMB 50S ribosomal protein L7/L12 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplL PE=3 SV=2 53 181 3.0E-06
sp|P0A0X0|RL7_NEIMA 50S ribosomal protein L7/L12 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplL PE=3 SV=2 53 181 3.0E-06
sp|A9M3X5|RL7_NEIM0 50S ribosomal protein L7/L12 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplL PE=3 SV=1 53 181 3.0E-06
sp|Q39Y14|RL7_GEOMG 50S ribosomal protein L7/L12 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplL PE=3 SV=1 52 181 3.0E-06
sp|Q89B19|RL7_BUCBP 50S ribosomal protein L7/L12 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplL PE=3 SV=1 53 181 3.0E-06
sp|Q748Y5|RL7_GEOSL 50S ribosomal protein L7/L12 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rplL PE=3 SV=1 52 181 3.0E-06
sp|Q3J8Q6|RL7_NITOC 50S ribosomal protein L7/L12 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplL PE=3 SV=1 53 181 3.0E-06
sp|Q7MA57|RL7_WOLSU 50S ribosomal protein L7/L12 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rplL PE=3 SV=1 53 181 3.0E-06
sp|Q6DAN1|RL7_PECAS 50S ribosomal protein L7/L12 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplL PE=3 SV=1 111 181 4.0E-06
sp|Q2LQ88|RL7_SYNAS 50S ribosomal protein L7/L12 OS=Syntrophus aciditrophicus (strain SB) GN=rplL PE=3 SV=2 53 181 4.0E-06
sp|A9R0H7|RL7_YERPG 50S ribosomal protein L7/L12 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplL PE=3 SV=1 53 181 4.0E-06
sp|B8J1A7|RL7_DESDA 50S ribosomal protein L7/L12 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplL PE=3 SV=1 53 181 4.0E-06
sp|A5GWJ9|RL7_SYNR3 50S ribosomal protein L7/L12 OS=Synechococcus sp. (strain RCC307) GN=rplL PE=3 SV=1 112 181 4.0E-06
sp|A6Q6I1|RL7_SULNB 50S ribosomal protein L7/L12 OS=Sulfurovum sp. (strain NBC37-1) GN=rplL PE=3 SV=1 54 177 4.0E-06
sp|B2UQY3|RL7_AKKM8 50S ribosomal protein L7/L12 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rplL PE=3 SV=1 51 181 4.0E-06
sp|Q830Q8|RL7_ENTFA 50S ribosomal protein L7/L12 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplL PE=3 SV=1 111 181 4.0E-06
sp|A6Q1M2|RL7_NITSB 50S ribosomal protein L7/L12 OS=Nitratiruptor sp. (strain SB155-2) GN=rplL PE=3 SV=1 54 181 4.0E-06
sp|C4K4F2|RL7_HAMD5 50S ribosomal protein L7/L12 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplL PE=3 SV=1 112 181 4.0E-06
sp|A5D5H9|RL7_PELTS 50S ribosomal protein L7/L12 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rplL PE=3 SV=1 50 181 4.0E-06
sp|Q5WLS2|RL7_BACSK 50S ribosomal protein L7/L12 OS=Bacillus clausii (strain KSM-K16) GN=rplL PE=3 SV=1 53 181 5.0E-06
sp|Q9Z9A1|RL7_CHLPN 50S ribosomal protein L7/L12 OS=Chlamydia pneumoniae GN=rplL PE=3 SV=3 54 177 5.0E-06
sp|Q3SLQ7|RL7_THIDA 50S ribosomal protein L7/L12 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplL PE=3 SV=1 52 181 5.0E-06
sp|Q0ANP2|RL7_MARMM 50S ribosomal protein L7/L12 OS=Maricaulis maris (strain MCS10) GN=rplL PE=3 SV=1 127 181 6.0E-06
sp|A7H4Q6|RL7_CAMJD 50S ribosomal protein L7/L12 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rplL PE=3 SV=1 53 181 6.0E-06
sp|C1DAQ9|RL7_LARHH 50S ribosomal protein L7/L12 OS=Laribacter hongkongensis (strain HLHK9) GN=rplL PE=3 SV=1 53 177 6.0E-06
sp|A0M3Z0|RL7_GRAFK 50S ribosomal protein L7/L12 OS=Gramella forsetii (strain KT0803) GN=rplL PE=3 SV=1 124 181 6.0E-06
sp|Q4FLL1|RL7_PELUB 50S ribosomal protein L7/L12 OS=Pelagibacter ubique (strain HTCC1062) GN=rplL PE=3 SV=1 49 181 6.0E-06
sp|Q7NQE5|RL7_CHRVO 50S ribosomal protein L7/L12 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplL PE=3 SV=1 53 177 7.0E-06
sp|Q048U5|RL7_LACDB 50S ribosomal protein L7/L12 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rplL PE=3 SV=1 112 181 8.0E-06
sp|Q1G905|RL7_LACDA 50S ribosomal protein L7/L12 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rplL PE=3 SV=1 112 181 8.0E-06
sp|Q2YB06|RL7_NITMU 50S ribosomal protein L7/L12 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplL PE=3 SV=1 52 177 8.0E-06
sp|Q4A7A8|RL7_MYCH7 50S ribosomal protein L7/L12 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rplL PE=3 SV=1 53 182 8.0E-06
sp|B1L936|RL7_THESQ 50S ribosomal protein L7/L12 OS=Thermotoga sp. (strain RQ2) GN=rplL PE=3 SV=1 51 181 9.0E-06
sp|A5IJW4|RL7_THEP1 50S ribosomal protein L7/L12 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplL PE=3 SV=1 51 181 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3292
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4932
Ophiocordyceps australis map64 (Brazil) OphauB2|770
Ophiocordyceps camponoti-floridani Ophcf2|04517
Ophiocordyceps camponoti-rufipedis Ophun1|5634 (this protein)
Ophiocordyceps kimflemingae Ophio5|184
Ophiocordyceps subramaniannii Hirsu2|606

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5634
MARSCQCAARSFSRQLRLLSPATRCTQTLRIASTTRRFNSTEAAAVASPKVAQLVEQISQLTLLETADLVSSLKS
KLNIPDMPMGGFAAAAAPAPAAAVEEPEDAAPAAAEKTMFTLKMQSFDAGSKAKVIKEVKALLGLSLVESKKFVE
SVPKMMKENVSKEEGEGIVAKMKELGAVVSLE*
Coding >Ophun1|5634
ATGGCCAGATCCTGTCAATGCGCAGCGCGGAGCTTCTCCCGTCAGCTGCGGTTACTCAGCCCAGCGACGAGATGT
ACACAGACGCTACGGATCGCCTCGACGACAAGACGCTTCAACTCGACCGAAGCCGCGGCGGTGGCGAGCCCCAAG
GTCGCACAGCTCGTCGAGCAAATCAGTCAACTGACGCTCCTGGAGACAGCAGACCTCGTCTCCAGCCTCAAGAGC
AAGCTCAACATCCCCGACATGCCCATGGGTGGCTTCGCTGCTGCCGCTGCCCCCGCTCCCGCCGCTGCCGTGGAG
GAGCCCGAGGACGCAGCTCCGGCTGCGGCTGAGAAGACGATGTTTACGCTCAAGATGCAGTCTTTTGACGCGGGG
TCCAAGGCAAAGGTCATCAAGGAGGTCAAGGCTCTCTTGGGCTTGAGTCTGGTGGAGAGCAAGAAGTTTGTCGAG
AGTGTGCCCAAGATGATGAAGGAGAATGTCTCCAAGGAGGAGGGTGAGGGCATCGTTGCCAAGATGAAAGAGCTG
GGCGCCGTTGTGTCGTTGGAGTGA
Transcript >Ophun1|5634
ATGGCCAGATCCTGTCAATGCGCAGCGCGGAGCTTCTCCCGTCAGCTGCGGTTACTCAGCCCAGCGACGAGATGT
ACACAGACGCTACGGATCGCCTCGACGACAAGACGCTTCAACTCGACCGAAGCCGCGGCGGTGGCGAGCCCCAAG
GTCGCACAGCTCGTCGAGCAAATCAGTCAACTGACGCTCCTGGAGACAGCAGACCTCGTCTCCAGCCTCAAGAGC
AAGCTCAACATCCCCGACATGCCCATGGGTGGCTTCGCTGCTGCCGCTGCCCCCGCTCCCGCCGCTGCCGTGGAG
GAGCCCGAGGACGCAGCTCCGGCTGCGGCTGAGAAGACGATGTTTACGCTCAAGATGCAGTCTTTTGACGCGGGG
TCCAAGGCAAAGGTCATCAAGGAGGTCAAGGCTCTCTTGGGCTTGAGTCTGGTGGAGAGCAAGAAGTTTGTCGAG
AGTGTGCCCAAGATGATGAAGGAGAATGTCTCCAAGGAGGAGGGTGAGGGCATCGTTGCCAAGATGAAAGAGCTG
GGCGCCGTTGTGTCGTTGGAGTGA
Gene >Ophun1|5634
ATGGCCAGATCCTGTCAATGCGCAGCGCGGAGCTTCTCCCGTCAGCTGCGGTTACTCAGCCCAGCGACGAGATGT
ACACAGACGCTACGGATCGCCTCGACGACAAGACGCTTCAACTCGACCGAAGCCGCGGCGGTGGCGAGCCCCAAG
GTCGCACAGCTCGTCGAGCAAATCAGTCAACTGACGCTCCTGGAGACAGCAGACCTCGTCTCCAGCCTCAAGGTC
AGTGGCGCGGAAGCCTTACGGGCGCAGGTTCCTATCCGCGCGCTGACTCGGCCATAGAGCAAGCTCAACATCCCC
GACATGCCCATGGGTGGCTTCGCTGCTGCCGCTGCCCCCGCTCCCGCCGCTGCCGTGGAGGAGCCCGAGGACGCA
GCTCCGGCTGCGGCTGAGAAGACGATGTTTACGCTCAAGATGCAGTCTTTTGACGCGGGGTCCAAGGCAAAGGTC
ATCAAGGAGGTCAAGGCTCTCTTGGGCTTGAGTCTGGTGGAGAGCAAGAAGTTTGTCGAGAGTGTGCCCAAGATG
ATGAAGGAGAATGTCTCCAAGGAGGAGGGTGAGGGCATCGTTGCCAAGATGAAAGAGCTGGGCGCCGTTGTGTCG
TTGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail