Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5633
Gene name
LocationContig_57:265..15415
Strand-
Gene length (bp)15150
Transcript length (bp)14457
Coding sequence length (bp)14457
Protein length (aa) 4819

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07728 AAA_5 AAA domain (dynein-related subfamily) 4.5E-20 310 433
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.4E-05 643 688
PF07728 AAA_5 AAA domain (dynein-related subfamily) 2.5E-06 800 898
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.2E-19 1089 1224
PF07728 AAA_5 AAA domain (dynein-related subfamily) 8.2E-07 1380 1429
PF07728 AAA_5 AAA domain (dynein-related subfamily) 7.7E-14 1477 1579
PF07728 AAA_5 AAA domain (dynein-related subfamily) 5.2E-18 1761 1899
PF17867 AAA_lid_7 Midasin AAA lid domain 2.0E-21 460 575
PF17867 AAA_lid_7 Midasin AAA lid domain 1.3E-13 1236 1331
PF17867 AAA_lid_7 Midasin AAA lid domain 1.0E-11 1911 2007
PF17865 AAA_lid_5 Midasin AAA lid domain 7.0E-31 912 1016
PF07726 AAA_3 ATPase family associated with various cellular activities (AAA) 6.5E-09 1761 1900
PF00004 AAA ATPase family associated with various cellular activities (AAA) 2.7E-04 1761 1796

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 34 2319 0.0E+00
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 269 2304 0.0E+00
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 297 2129 0.0E+00
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 257 2305 0.0E+00
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 285 2306 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 34 2319 0.0E+00
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 269 2304 0.0E+00
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 297 2129 0.0E+00
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 257 2305 0.0E+00
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 285 2306 0.0E+00
sp|Q12019|MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDN1 PE=1 SV=1 3221 4805 6.0E-173
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 3218 4800 3.0E-156
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 3561 4795 1.0E-68
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 3835 4804 1.0E-60
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 278 923 2.0E-45
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 4041 4756 8.0E-38
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 1751 2372 5.0E-29
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 292 926 3.0E-25
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 265 903 4.0E-25
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 3223 3719 5.0E-25
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 3219 3501 1.0E-21
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 288 692 3.0E-21
sp|Q4L6B6|Y1500_STAHJ Uncharacterized protein SH1500 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1500 PE=3 SV=1 1072 1328 2.0E-17
sp|Q2FH29|Y1302_STAA3 Uncharacterized protein SAUSA300_1302 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1302 PE=3 SV=1 1089 1285 3.0E-17
sp|Q5HG10|Y1445_STAAC Uncharacterized protein SACOL1445 OS=Staphylococcus aureus (strain COL) GN=SACOL1445 PE=3 SV=1 1089 1285 4.0E-17
sp|Q7A0W8|Y1299_STAAW Uncharacterized protein MW1299 OS=Staphylococcus aureus (strain MW2) GN=MW1299 PE=3 SV=1 1089 1285 4.0E-17
sp|Q2YY09|Y1265_STAAB Uncharacterized protein SAB1265c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1265c PE=3 SV=1 1089 1285 4.0E-17
sp|Q6GGZ9|Y1421_STAAR Uncharacterized protein SAR1421 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1421 PE=3 SV=1 1089 1285 4.0E-17
sp|Q7A5N7|Y1241_STAAN Uncharacterized protein SA1241 OS=Staphylococcus aureus (strain N315) GN=SA1241 PE=3 SV=1 1089 1285 4.0E-17
sp|Q2G2J8|Y1413_STAA8 Uncharacterized protein SAOUHSC_01413 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01413 PE=3 SV=1 1089 1285 4.0E-17
sp|Q6G9F2|Y1352_STAAS Uncharacterized protein SAS1352 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1352 PE=3 SV=1 1089 1285 4.0E-17
sp|Q99U78|Y1409_STAAM Uncharacterized protein SAV1409 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1409 PE=3 SV=1 1089 1285 4.0E-17
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 1089 1328 2.0E-16
sp|Q5HPD3|Y979_STAEQ Uncharacterized protein SERP0979 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0979 PE=3 SV=1 1089 1328 8.0E-16
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 1089 1328 1.0E-15
sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum GN=DDB_G0290685 PE=2 SV=2 4010 4545 5.0E-14
sp|O31850|YOJN_BACSU Uncharacterized protein YojN OS=Bacillus subtilis (strain 168) GN=yojN PE=3 SV=1 1089 1328 5.0E-14
sp|Q51481|NIRQ_PSEAE Denitrification regulatory protein NirQ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nirQ PE=2 SV=1 1068 1268 6.0E-14
sp|Q95WA4|SWP2_ENCIN Spore wall protein 2 OS=Encephalitozoon intestinalis GN=SWP2 PE=1 SV=1 3985 4388 5.0E-13
sp|Q02441|NIRQ_PSEST Denitrification regulatory protein NirQ OS=Pseudomonas stutzeri GN=nirQ PE=2 SV=1 1087 1241 9.0E-13
sp|Q7A5N7|Y1241_STAAN Uncharacterized protein SA1241 OS=Staphylococcus aureus (strain N315) GN=SA1241 PE=3 SV=1 1759 1913 1.0E-12
sp|Q2YY09|Y1265_STAAB Uncharacterized protein SAB1265c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1265c PE=3 SV=1 1759 1913 1.0E-12
sp|Q7A0W8|Y1299_STAAW Uncharacterized protein MW1299 OS=Staphylococcus aureus (strain MW2) GN=MW1299 PE=3 SV=1 1759 1913 1.0E-12
sp|Q6G9F2|Y1352_STAAS Uncharacterized protein SAS1352 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1352 PE=3 SV=1 1759 1913 1.0E-12
sp|Q2G2J8|Y1413_STAA8 Uncharacterized protein SAOUHSC_01413 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_01413 PE=3 SV=1 1759 1913 1.0E-12
sp|Q6GGZ9|Y1421_STAAR Uncharacterized protein SAR1421 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1421 PE=3 SV=1 1759 1913 1.0E-12
sp|Q5HG10|Y1445_STAAC Uncharacterized protein SACOL1445 OS=Staphylococcus aureus (strain COL) GN=SACOL1445 PE=3 SV=1 1759 1913 1.0E-12
sp|Q2FH29|Y1302_STAA3 Uncharacterized protein SAUSA300_1302 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1302 PE=3 SV=1 1759 1913 1.0E-12
sp|Q99U78|Y1409_STAAM Uncharacterized protein SAV1409 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1409 PE=3 SV=1 1759 1913 1.0E-12
sp|Q5HPD3|Y979_STAEQ Uncharacterized protein SERP0979 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0979 PE=3 SV=1 1755 1915 2.0E-12
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 1755 1915 4.0E-12
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 2214 2304 4.0E-12
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 1755 1905 5.0E-12
sp|Q4L6B6|Y1500_STAHJ Uncharacterized protein SH1500 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1500 PE=3 SV=1 1759 1913 1.0E-11
sp|Q51664|NORQ_PARDP Protein NorQ OS=Paracoccus denitrificans (strain Pd 1222) GN=norQ PE=3 SV=2 1087 1234 2.0E-11
sp|Q95WA4|SWP2_ENCIN Spore wall protein 2 OS=Encephalitozoon intestinalis GN=SWP2 PE=1 SV=1 4010 4548 2.0E-11
sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum GN=DDB_G0290685 PE=2 SV=2 4010 4537 4.0E-11
sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum GN=DDB_G0290685 PE=2 SV=2 4009 4392 5.0E-11
sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum GN=DDB_G0290685 PE=2 SV=2 4009 4386 1.0E-10
sp|Q51858|CBBQ_HYDTE Protein CbbQ OS=Hydrogenophilus thermoluteolus GN=cbbQ PE=3 SV=1 1750 1940 2.0E-10
sp|Q51858|CBBQ_HYDTE Protein CbbQ OS=Hydrogenophilus thermoluteolus GN=cbbQ PE=3 SV=1 1081 1238 2.0E-10
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 2070 2301 4.0E-10
sp|O31850|YOJN_BACSU Uncharacterized protein YojN OS=Bacillus subtilis (strain 168) GN=yojN PE=3 SV=1 1752 1913 6.0E-10
sp|O94248|MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdn1 PE=1 SV=1 2218 2308 8.0E-10
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 2218 2308 2.0E-09
sp|Q51481|NIRQ_PSEAE Denitrification regulatory protein NirQ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nirQ PE=2 SV=1 1753 1905 2.0E-09
sp|Q51664|NORQ_PARDP Protein NorQ OS=Paracoccus denitrificans (strain Pd 1222) GN=norQ PE=3 SV=2 1760 1905 3.0E-09
sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 2209 2309 2.0E-08
sp|Q02441|NIRQ_PSEST Denitrification regulatory protein NirQ OS=Pseudomonas stutzeri GN=nirQ PE=2 SV=1 1753 1905 2.0E-08
sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum GN=DDB_G0290685 PE=2 SV=2 4056 4545 3.0E-08
sp|Q869L3|MDN1_DICDI Midasin OS=Dictyostelium discoideum GN=mdn1 PE=3 SV=2 1479 1643 4.0E-08
sp|Q8CC88|VWA8_MOUSE von Willebrand factor A domain-containing protein 8 OS=Mus musculus GN=Vwa8 PE=1 SV=2 1495 1907 5.0E-08
sp|P29933|COBS_PSEDE Aerobic cobaltochelatase subunit CobS OS=Pseudomonas denitrificans GN=cobS PE=1 SV=1 1089 1332 7.0E-08
sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum GN=DDB_G0290685 PE=2 SV=2 4052 4544 1.0E-07
sp|Q51858|CBBQ_HYDTE Protein CbbQ OS=Hydrogenophilus thermoluteolus GN=cbbQ PE=3 SV=1 309 435 2.0E-07
sp|Q8T5T1|MDN1_GIAIN Midasin OS=Giardia intestinalis GN=MDN1 PE=3 SV=1 3234 3501 5.0E-07
sp|Q54G14|Y0266_DICDI Uncharacterized protein DDB_G0290685 OS=Dictyostelium discoideum GN=DDB_G0290685 PE=2 SV=2 4009 4392 6.0E-07
sp|Q51664|NORQ_PARDP Protein NorQ OS=Paracoccus denitrificans (strain Pd 1222) GN=norQ PE=3 SV=2 309 407 9.0E-07
sp|Q49XL1|Y1341_STAS1 Uncharacterized protein SSP1341 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1341 PE=3 SV=2 1375 1657 2.0E-06
sp|Q2FH29|Y1302_STAA3 Uncharacterized protein SAUSA300_1302 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1302 PE=3 SV=1 1486 1627 2.0E-06
sp|P29933|COBS_PSEDE Aerobic cobaltochelatase subunit CobS OS=Pseudomonas denitrificans GN=cobS PE=1 SV=1 1734 1880 4.0E-06
sp|Q8CP85|Y1092_STAES Uncharacterized protein SE_1092 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1092 PE=3 SV=1 1375 1657 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5633
MRETIDVSRQTRSLLEDPVALQQLPPNLLEIIRQPSPTDLLDAVADAALRPSLTERIFVHFEDVFPDICARWTLR
GASPVQQLHATAALARILPFAPYLADFLGYPSTKTAGVEVDGQDPIGRIPLALIQIDILERRGVCEEDELLCLIT
LWRLLNFDFPIRSLVQLDFIKRQFESGCLAIRYVAIRIYCQLMRASDQRLEALIVEHCGRDKAILGHLDGVPIDF
GFLSLYEASRAQRVVALREDVKRRNHGSSQEPRLHTLTTLVVPFGNAMLPRLCGSERVPRTLVMTNTTTQHLQGL
ASMLREPDPILLRGPSGAGKSAMVHEVAKQLGKYDDMVTLHLNEQTDAKTLIGLYSTNSKPGNFEWRPGVLTTAV
REGRWVLIEDLDRAPIEVMSILLPLIERRELLLPSRGVTYPAPRDFRLFATIRTASAMDDGESLPNLVGMRLWKS
LYVTPQTAEELENVILHMYPILRKFLPGILAVYQRLSRVAGSLSFMSRGRSVVDRQISLRDLLKWCRRLEDGLVG
AGSVSGDEPISEATRDCMFMDALDCFVGSCPDASLGKELAYAIAEEMHISRDRAEHYLCANIPILDDGDAMLGIG
RARLRKNSLSRRLSRSKRPFASTTHAKRLLEQIARAVKLEEPILLVGETGIGKTTVVQQLAESLGHKLIAVNLSQ
QSEAGDLLGGFKPVNARSLATPLKEEFEALFAATGISASKNEKYLGQIGKSFAKGQWSRVSKLWREATQMFDSIC
EQYRRMSSPSHDDDAHPAKRRKTMSKLEALEKLRPRWSEFSRKLDRFDMQEWGVSGNVAFSFIEGNLVKAIRNGD
WVLLDEINLASPDTLETIADLLTGPDERPSILLAETGDLEKIVAHSNFRIFGAMNPATDVGKRDLPVGIRSRFTE
LYVRSPDADHKDLLTIVKAYLGSSSGEMDRAADDMTRLYLNTKRMAEEKRLVDGANEVPHFSLRTLTRVLSYVTS
IAPFYGLRRALYEGFSMGFLTLLDRESESMLLPLIHHHLLDKHGNPQSLLSQTPQHAKDGRRYVRFRNQNRDRQY
WLLQGEQTPIERQDYIITPFVERNLLNLVRATSTRQFPILIQGPTSAGKTSMIEYLANFSGNTFVRINNHEHTDL
QEYLGTYVSGPDGQLRFEEGLLVQAMRKGYWIVLDELNLAPTEVLEALNRLLDDNRELLVPETQEVVRPHDNFIL
FATQNPPGLYGGRKVLSRAFRNRFLELHFDDIPEDELEHILQQRCRNTSPPDCRRIVNVYKELSRLRQSSRLFES
KDSFATLRDLFRWALRDANTRYEIAVHGIMLLAERVRNDEERSAVKEVIEKIFNIKIDPDELYSETVAPELKRLV
GAPNSQDVVWTHAMRRLYVLVCRALQNNEPVLLVGETGCGKTTVCQMLAEAAGKQLAIVNAHQNTETGDLIGSQR
PNRNRGAVLDALSNDLGFILETLGLDVPNSVEERLQAYRALHPTSLTKLPSELIERVSANEAKSKVLFQWYDGAL
VEAMREGYLFLLDEISLADDSVLERLNSVLEPQRTLLLAEKGIDNPTVVACDGFQFLATMNPGGDFGKKELSPAL
RNRFTEIWVPPLSESRDIQTIVQTKLLDGRKHLADIMVRFATWFGQTFRPMATTPISVRELLAWVQFINSSDAAD
PVESLVHGASAIFIDSIGASPSAMVTTDPKAIHLQRQECLQMIGDIAGCNALEVHGANPELIITPDSLIIGNFSV
PRCSISVSDAGFAFQAPTTRLNAMRIVRALQTRKPILLEGNPGVGKTSLVAAISQACGRPLTRINLSDQTDLMDL
FGTDMPVEGEEAGNFAWRDAPFLQAMQKGEWVLLDEMNLASQSVLEGLNACLDHRGEIYVSELDQVFRRHPDFRL
FAAQNPHHQGGGRKGLPASFVNRFIVVYADVFQDEDLKLIAAHNFPGVNAENAGLIIDFVSQLDHKLSVERAFGL
QGGPWEFNLRDVLRWLDLLDCNRSREVRVDDFLQIIVRQRFRTQEDRDQVDRLFGQLAGRKPRMHSLYHDVNSSF
SQVGQTTVPRNPEYQPERLSSLDTVAILPELESVMMCVEKKMPCILSGPSGSGKSALLKYAAALAGKSLVVFPLN
ADTDTMDLVGGFEQADPLRDLNSTLRCLCRRLQEVESRSAPAEMPTQAFECVNLLENYFLHGDDARHVDATLRLV
DAILGHVERLREVDASIGSWLDKARERLREQAISIKPMFKWLDGVIVEALETGQWLVLDHANLCNASVLDRLNSL
LEPNGFLCVNECCDPEGNPKMVRPHPEFRVFLTVDPSYGELSRAMRNRAIEVNLSSRPTPRDPCFDRISEVESGL
WRLRNVNDFCERLSSESCTALTPAGECLSVRDVALLPRFLEGLPCGDERSQPSLQVVTELMGFLRSPAGSSDLQR
IENLYSTLPEASQSLASHQPIHALINPYILELLPSSKAAEWAGLRLDHLRAVYDIEKMFERQCGGAHSAKPWLLT
RLQRSSIRDRVTAVAKDSTVQLCWFITAALKALRNHLAIDFGSQRSHLCRFVIHWLVHTIGLSSEMTFSEARFQA
HLKLAAEYLKPQTEALGDLQNSEFSTKLLRLIKDNFSSGFELSTGLSMERLWLVFRIAPFPDETVFQRSMGLVRL
ADRFDAIRWKASASILDLAKAHETFEQAYAIVRSGRGCADELVSDLTTAIGSLESHIGDREANLEPFFAREFEYV
RQLSLLFSPADGQSTQGSSLAVLSGAATKANMTFAIAEGPAAVLQSVDRLACQDSHVWDGKLAASVWLKLRHLDT
VKLGSLSLLESELPVLGRCISGLGSEIASDPLIKLNELLWQLLSEVFVAHEPQLGELVASARLLAVKHLDSASSV
TRTGLGGGSSPFDDILGQIKMDYLRQISRDNLIPAVVGIAAAEHDADERAHYSALAWMQFSIGLVKLYVPDRAFD
PQLRLLVEHEFFEGLQMRLREKVSALRSFQRFFTGQDTSRRIELLEEEILESERPRGDCRPVHRPDVSELDRLHV
ECSNVLKLVTRSGIPSLFRQLGSSSSAEETSGLLQFMEQNVQSLVHRFSSQFEAYQDVTSTISNALRCLLLGISL
CGAATASRLQTSTSQLVNATPFFGGRRWDARIGQQCRKSFEYLSLMSAAVAVEGVDGLSVDSRESIFECFHSFYD
DWCDRLEADRKTEEARTSLYRFCGSLEDEEEVDEKEFNELFPTYDGEEGSVMKPSTEKVATLDTTCTTEKTVNFY
ADPNLSEARKLVSLTQRIKTRFRELQGVDEIGHMQPLADVVESCERLLDQVHAEPLAKLIPKVEQLHALVYEWQF
GGWASRVHAVLPLHDALTETIIRWRRLELATWSTLFDMEEEKCRNDAYSWWFVAYQVVVAGSLPMMDSPSELREY
ATSLVRNLEGYLSSSFVGQFRTRVALLRQLSSHLRLLTREHPTLAVIYEAVQNFVDYFARFEVAADAAIRDGRGP
IEKKMKEVLLLASWKDTNINALRESARKSHLKLFRLVRKFRGVLGQDMKAIVDKGLPSETFVSNQVNGKVQAAGV
PDVQVESVNEMLPNWLKNHRRLANVTTTVCVLDKIADGLEATDKATGVVDDFVSSLLASMAELQRETPKVMSDES
KDQVKHLKTRKRKLLADTLRDLRTMGVRHNLPQNKLAVQGSLAIILATMTPVDASRLAGMAEADYLLHQVLDLAP
KARAAAEGHSEDLTSPEVARCVGLVEGMVEFCLSQRDSIGLASKPLSSLQATAEDFRRLGNSEKLGRLCRRTQHE
NWRGLLPWLGQILRFAAKLVQAQARLAQGDVTEVVQRLGEWAARVDAHLVVADDLGQLPAQVISEAHVRLEAAVA
KDMESLRSDIEDLGRQRPELSFILQQVDVWTRIDSQQMDTPNSLVELKTWADAVSTLVDSLLVAVESAKRTASAW
DTDVDKAGWLRRHSDLVWASVQQLHMADVDKAARRCVELMQHIDVDDSAISEAATSIIRLASPVLDSFLDLCRQC
VDRGVDLHRATAHMASRLTRAFTQMASQGFCTPQEKSNESGDSGQLESGTGLGDGQGAEDISKDIQADEDLTELA
QEKNEGEKEEIEDEKDAVDMADEELEGELGSVNGEQDDEDGSQKGEDGEDDVEEEAGEVDDLDPTAVDEKMWDGD
DEKAEKDQQGNKAAGREEEDEMMAPEEAEGEEEEQDAKDGKAEEQEGEDEPDAEEEGVTAQDEMNRQDQNVEDKD
ALELPEEMDLDFDDKASVSSEEGLDAMSMAEEEQVCEDEAKDEEMGDDEVKDEEMKDAADPETGEESDAEAEGKM
GGEDEVEDEVKPESEPEPEQANDDEAPVSADTAQADAEHAAPSDVKSSGRDPTADQKNSDEAFKAEAAQQDGGEM
GDSAADRDASAGNQGATSRSKEIPEEGEQGDKEEQDETRGSNPFRKLGDALEKWHRQQAEIQGARPDDAKQVDGD
DESKEQGRLEFEHVQDDEDAGDTQAMGTAREDEVIPLDESMAIDEDVTDGQGKAMETEKDDEGPEADEIDEKGMD
DIELHDEQGLDGKTGDAGDEHRSGPDIRQGNFNKEDEREVTEQDETEEPIQPSPTQAEREPRDLDECRRQWTELE
RKTQGLSQSLTSQLRLILVPTQATKMSGSFRTGKRLNIKRIIPYVASGYKRDKIWMRRSVPTKRQYQVLLCVDDS
KSMGETQAGPLALEALVMVTRSLAMLEVGEVGVVGFGTGVTVAHELGRPLVGEAGARTLREFGFHQERTDMVLLL
RRTMEMLRLARAQQQSSRSELWQLALILSDGLTPSSAHETMRRLLRTATEERVMVVFVVIDGGGGVLDLKEARVD
VVVPDWPHKAITIKSPST*
Coding >Ophun1|5633
ATGAGAGAGACCATCGACGTCTCGCGGCAGACGAGATCCCTTCTGGAGGATCCGGTTGCGTTGCAGCAACTTCCA
CCGAATTTACTAGAGATTATTCGGCAACCATCGCCGACGGACCTACTGGATGCCGTTGCAGACGCAGCACTGAGG
CCGTCACTTACAGAAAGAATCTTTGTTCATTTTGAAGACGTCTTTCCTGATATTTGCGCGCGATGGACTCTCAGG
GGCGCATCACCTGTACAGCAACTGCACGCCACCGCCGCTTTGGCGAGAATCTTACCCTTTGCCCCGTATCTGGCC
GACTTTCTCGGATACCCTAGCACCAAGACCGCGGGTGTAGAAGTTGATGGCCAAGATCCGATAGGTCGTATTCCT
CTGGCGCTGATTCAAATTGATATCCTCGAGCGAAGGGGCGTGTGTGAGGAGGACGAGCTGCTATGTCTCATCACG
CTGTGGAGGCTGTTGAACTTCGACTTTCCCATCCGTTCTTTGGTGCAGCTGGACTTTATCAAGCGTCAATTCGAG
AGCGGCTGTCTGGCTATCCGATACGTCGCGATCCGCATCTACTGCCAGCTGATGCGTGCGTCTGATCAGCGGCTT
GAGGCTCTCATCGTCGAGCACTGTGGACGGGACAAGGCTATTCTCGGTCATCTCGACGGCGTGCCAATAGACTTT
GGGTTCTTGTCCTTGTATGAGGCTTCACGAGCTCAGCGCGTTGTTGCTTTGAGAGAAGATGTGAAACGACGCAAT
CACGGTTCCAGTCAAGAACCGCGTCTACATACACTCACTACACTTGTTGTGCCTTTCGGAAACGCCATGCTTCCC
CGGCTCTGCGGAAGCGAGAGAGTGCCGAGAACCCTGGTGATGACGAACACAACTACACAGCATCTCCAAGGCCTG
GCATCGATGCTGCGAGAGCCGGATCCGATTCTACTCCGTGGTCCGTCGGGTGCTGGGAAAAGCGCCATGGTTCAT
GAAGTTGCGAAACAGCTTGGAAAGTACGACGACATGGTCACGCTGCATCTCAACGAGCAGACTGATGCCAAGACG
CTCATCGGCCTTTACTCGACCAACTCGAAGCCGGGGAACTTCGAATGGCGCCCGGGTGTACTGACCACGGCCGTC
CGTGAAGGAAGATGGGTGCTCATCGAGGACCTGGATCGAGCACCAATCGAGGTCATGAGCATCCTGCTTCCCCTG
ATCGAGCGACGAGAGTTGCTTTTGCCTTCTCGCGGGGTGACATATCCGGCCCCTCGTGACTTTCGTCTCTTTGCA
ACGATCCGGACCGCTTCAGCCATGGATGACGGAGAAAGCCTGCCGAATCTGGTCGGGATGCGACTGTGGAAGTCT
CTCTACGTCACGCCTCAGACAGCCGAGGAGCTGGAAAACGTCATCCTTCATATGTATCCGATTCTGCGGAAATTC
CTACCGGGCATACTCGCCGTGTACCAACGGCTTTCACGGGTGGCGGGAAGCCTTTCCTTCATGTCCCGGGGCAGA
AGCGTCGTCGACCGACAGATCAGCCTGAGGGATCTTCTCAAATGGTGTCGACGACTCGAGGATGGTCTTGTTGGG
GCGGGATCTGTGTCCGGCGATGAGCCCATCAGTGAAGCTACCAGAGACTGCATGTTCATGGACGCGCTGGACTGT
TTCGTGGGGAGCTGCCCAGACGCGTCGCTCGGAAAGGAGCTTGCGTATGCCATTGCTGAAGAGATGCATATATCC
AGAGACAGGGCTGAGCACTACCTTTGCGCCAATATACCTATTTTGGACGATGGTGATGCCATGCTCGGTATTGGT
AGGGCCCGGCTGCGGAAGAATTCATTGTCACGTCGGCTTTCGAGGTCCAAGAGGCCGTTTGCCAGCACAACCCAC
GCCAAGAGACTGCTAGAGCAGATTGCCAGGGCAGTCAAGCTGGAAGAGCCGATCCTCCTCGTCGGTGAGACGGGC
ATCGGAAAAACGACGGTGGTTCAGCAGCTTGCAGAGTCGCTGGGCCACAAACTCATTGCCGTGAATCTCTCGCAG
CAGAGTGAGGCGGGTGATCTTCTCGGAGGTTTCAAGCCCGTCAACGCGCGAAGCCTAGCTACACCCCTGAAGGAA
GAGTTCGAGGCGCTATTCGCGGCAACCGGCATCTCTGCGTCAAAGAATGAAAAGTACCTGGGACAGATCGGCAAG
TCGTTCGCCAAAGGGCAGTGGTCCAGGGTGTCGAAGCTTTGGAGAGAGGCGACGCAAATGTTTGACAGCATCTGC
GAGCAATATCGACGGATGAGCTCCCCGAGTCACGATGACGATGCGCACCCGGCGAAGCGCCGCAAGACGATGTCT
AAGCTTGAGGCCTTGGAGAAGTTGAGGCCGCGATGGTCTGAGTTTTCTCGCAAGCTCGATAGGTTCGATATGCAG
GAATGGGGTGTGTCTGGAAATGTTGCGTTCTCTTTTATCGAGGGCAACTTGGTCAAGGCTATTCGGAACGGTGAC
TGGGTGCTCTTGGATGAGATCAATCTTGCTTCGCCAGACACGCTGGAAACCATTGCCGATCTCCTGACTGGTCCA
GACGAGCGGCCCTCCATCTTACTTGCGGAAACGGGCGATCTCGAGAAAATCGTGGCACATTCCAATTTTCGCATC
TTTGGCGCCATGAATCCTGCAACTGACGTGGGGAAGCGGGATTTGCCCGTGGGCATCAGATCACGGTTCACGGAG
CTCTACGTCAGGAGCCCCGACGCCGACCACAAGGATCTGCTCACCATTGTCAAGGCGTATCTGGGCAGCAGCAGC
GGCGAGATGGACCGGGCGGCCGACGACATGACACGGCTGTACCTCAACACGAAGCGAATGGCGGAAGAGAAGCGG
CTGGTCGACGGAGCCAACGAGGTTCCTCATTTCAGCTTGCGGACGCTGACCCGGGTTTTGAGCTATGTCACCTCG
ATTGCGCCGTTCTATGGCCTTCGTCGTGCTTTGTATGAGGGCTTCTCCATGGGTTTCCTCACGCTGCTGGACAGG
GAGTCCGAGTCGATGCTGCTTCCTCTCATTCATCATCATCTCCTCGATAAGCATGGGAATCCCCAGTCGCTACTC
TCGCAGACACCGCAGCATGCAAAGGACGGGAGACGATACGTCAGGTTCCGGAATCAGAACCGGGATCGCCAGTAC
TGGCTATTGCAAGGCGAGCAGACCCCGATTGAAAGACAGGACTACATCATTACTCCGTTCGTGGAGCGGAACCTC
CTGAACTTGGTTCGAGCGACATCGACCAGGCAATTCCCGATTCTAATACAGGGACCGACGTCTGCCGGCAAAACG
AGCATGATTGAGTATCTGGCCAACTTTAGTGGAAACACCTTTGTCCGCATCAACAACCACGAACACACCGACCTC
CAGGAGTACCTTGGCACGTACGTCTCGGGACCGGACGGCCAGTTGCGTTTTGAAGAAGGTCTTCTCGTTCAGGCC
ATGCGAAAAGGCTACTGGATTGTACTGGACGAGCTCAACCTGGCGCCAACGGAAGTTTTAGAGGCCTTGAATCGT
CTGCTGGATGACAACCGCGAGCTGCTCGTTCCCGAGACCCAAGAGGTTGTCAGACCCCATGACAATTTCATCCTG
TTCGCTACGCAGAATCCGCCGGGTCTTTATGGCGGTCGCAAAGTTCTCTCTCGAGCGTTTCGCAACAGGTTCCTG
GAGCTGCACTTTGACGATATCCCCGAGGATGAGCTGGAGCACATTCTGCAACAACGGTGCCGCAACACTTCACCG
CCGGATTGTCGGCGAATCGTCAACGTTTACAAGGAACTCTCCAGGCTCCGTCAGTCGAGCCGTCTTTTTGAGTCA
AAGGACAGCTTCGCGACTTTGAGAGACCTCTTTCGCTGGGCGCTGAGAGACGCAAACACCAGATACGAGATTGCC
GTTCATGGGATCATGCTGCTGGCAGAGAGGGTTCGCAACGACGAGGAGCGGTCGGCTGTCAAGGAAGTCATCGAA
AAGATTTTCAACATCAAGATTGACCCCGACGAACTCTACTCAGAAACGGTTGCCCCTGAGCTCAAGCGCTTGGTT
GGCGCCCCTAACAGCCAGGACGTGGTTTGGACACATGCCATGCGGCGTCTTTATGTCTTGGTCTGCAGGGCTCTT
CAGAACAATGAACCGGTTCTCCTCGTTGGTGAGACCGGCTGTGGCAAGACTACCGTCTGTCAGATGCTTGCCGAG
GCTGCTGGAAAGCAGCTTGCCATTGTCAACGCGCATCAAAACACGGAGACGGGCGACCTTATAGGCTCGCAGAGA
CCGAATCGGAATCGTGGCGCCGTTCTTGATGCCTTGAGTAACGACCTTGGGTTTATCTTGGAGACGCTCGGGCTG
GACGTTCCCAACTCGGTCGAGGAAAGACTTCAAGCATATCGCGCTCTGCATCCTACGTCACTCACCAAGCTTCCT
TCAGAACTCATCGAACGAGTCTCGGCAAATGAGGCGAAATCCAAGGTTCTTTTCCAGTGGTACGACGGAGCCTTA
GTTGAGGCCATGCGAGAAGGATACTTGTTCCTCCTTGACGAGATTTCACTCGCGGATGACTCGGTCTTGGAGAGA
CTCAACTCAGTTCTCGAGCCCCAGAGGACGCTTCTTTTGGCCGAGAAGGGCATCGATAACCCTACCGTCGTGGCG
TGTGATGGGTTTCAGTTCCTCGCGACCATGAACCCTGGTGGCGACTTTGGAAAGAAAGAGCTTTCACCTGCCCTG
CGTAACCGCTTTACGGAGATCTGGGTTCCGCCGCTGTCGGAGAGCCGCGATATACAAACCATTGTGCAGACGAAA
TTACTTGATGGACGGAAACATCTTGCGGATATCATGGTCCGTTTCGCAACGTGGTTTGGACAGACGTTTCGACCT
ATGGCAACGACGCCCATCTCGGTGCGAGAGCTTCTTGCATGGGTTCAGTTCATCAACTCATCTGATGCGGCCGAT
CCCGTTGAGTCCTTGGTTCATGGAGCGTCTGCGATTTTCATCGACAGTATCGGGGCCAGCCCATCGGCCATGGTT
ACGACTGATCCCAAGGCTATTCACCTGCAGAGACAAGAGTGCCTTCAGATGATTGGTGATATTGCTGGTTGCAAT
GCGCTCGAGGTCCATGGAGCAAACCCCGAGCTCATCATTACCCCCGATTCCTTGATCATCGGCAACTTCAGCGTA
CCCCGGTGCTCAATCAGCGTCAGCGATGCGGGCTTCGCGTTCCAAGCGCCAACGACGAGACTCAACGCCATGAGA
ATCGTGAGAGCCCTTCAGACGCGCAAGCCTATTCTCCTTGAAGGAAACCCTGGCGTCGGCAAGACATCATTAGTG
GCAGCTATATCTCAAGCCTGCGGTCGTCCATTGACACGCATCAACTTGTCGGATCAAACAGACTTGATGGACCTC
TTTGGAACGGATATGCCTGTCGAAGGAGAGGAGGCTGGAAACTTTGCGTGGCGGGATGCACCGTTCTTGCAGGCG
ATGCAAAAGGGCGAATGGGTTCTCCTGGACGAGATGAATCTCGCGTCGCAGTCCGTCTTGGAGGGGCTGAACGCC
TGTCTGGATCATCGGGGAGAGATTTACGTCTCTGAGCTGGACCAGGTATTCAGACGGCATCCCGACTTTAGGCTG
TTTGCCGCTCAGAACCCTCATCATCAAGGCGGGGGCCGCAAGGGCTTGCCAGCCTCCTTTGTGAATCGGTTCATC
GTCGTCTATGCCGATGTTTTTCAAGACGAGGACCTGAAGCTCATCGCGGCTCATAACTTTCCTGGCGTCAACGCC
GAGAACGCTGGCCTCATCATCGACTTCGTCTCTCAGCTTGATCACAAGCTATCTGTTGAGAGAGCTTTTGGACTG
CAAGGCGGGCCCTGGGAGTTCAATTTGCGCGACGTTCTTCGATGGCTGGATTTGCTCGATTGCAATCGTTCGCGG
GAAGTTCGCGTCGATGACTTTCTCCAGATTATCGTTCGTCAACGCTTTCGCACTCAGGAGGATCGAGACCAGGTG
GACAGGCTATTCGGTCAGCTCGCCGGGCGGAAGCCCAGAATGCACTCGCTGTATCACGATGTCAACTCTTCCTTC
AGCCAAGTCGGACAAACTACCGTGCCCAGGAACCCCGAGTATCAGCCTGAAAGGCTTTCGAGCCTGGACACTGTG
GCCATTCTCCCCGAACTGGAGTCTGTGATGATGTGCGTGGAGAAGAAGATGCCCTGCATCCTAAGCGGCCCTTCT
GGCTCTGGGAAGTCTGCTCTTTTGAAATACGCCGCTGCGTTGGCTGGGAAGTCTCTGGTGGTGTTTCCCTTGAAC
GCAGACACCGACACCATGGACCTCGTTGGCGGCTTTGAACAAGCAGATCCACTTCGAGATCTGAACTCGACGTTG
AGATGCCTATGCCGCCGTCTCCAGGAGGTCGAGAGTCGCAGTGCCCCGGCAGAGATGCCTACTCAGGCTTTCGAA
TGCGTGAATCTCCTCGAAAACTACTTCTTGCATGGAGACGATGCTCGTCATGTTGATGCCACGCTGCGTCTTGTT
GATGCCATCTTGGGTCATGTTGAACGTCTCCGCGAGGTTGATGCCAGCATCGGGTCCTGGCTCGACAAGGCGAGG
GAACGACTGAGAGAGCAGGCCATTTCCATCAAGCCAATGTTCAAGTGGCTAGATGGAGTCATCGTCGAAGCTCTT
GAGACGGGGCAGTGGCTCGTACTCGACCACGCTAACCTGTGCAACGCTTCGGTCCTGGACAGACTCAACTCTTTG
CTCGAGCCGAACGGGTTTCTGTGCGTCAACGAGTGTTGCGATCCTGAGGGGAATCCGAAAATGGTCCGGCCTCAT
CCCGAATTCCGGGTATTTCTGACCGTGGACCCGAGTTACGGCGAGCTATCGCGCGCAATGAGGAATCGGGCTATC
GAAGTGAATCTCAGTTCGCGACCTACACCCAGAGATCCTTGCTTCGACAGGATAAGCGAAGTCGAGAGCGGACTG
TGGAGGCTCAGAAACGTCAACGACTTCTGCGAAAGGCTGTCGTCGGAGAGCTGCACTGCGTTGACGCCCGCTGGC
GAGTGTCTGTCTGTCAGAGATGTCGCTCTCCTGCCGCGATTCCTGGAAGGACTGCCGTGTGGCGATGAGCGAAGC
CAGCCGTCTCTGCAAGTCGTGACGGAGTTGATGGGCTTCTTGCGCTCGCCGGCCGGTTCCAGCGATCTTCAAAGA
ATCGAGAATCTCTACTCTACTCTCCCGGAGGCATCACAGTCATTGGCCTCTCATCAGCCCATCCACGCGTTGATC
AATCCTTACATCTTGGAGCTGCTTCCCAGTTCGAAGGCGGCAGAGTGGGCCGGCTTGCGATTAGACCACCTGCGC
GCTGTTTACGATATAGAGAAGATGTTTGAACGGCAATGCGGCGGGGCTCATTCGGCAAAGCCTTGGTTGTTGACG
CGGTTGCAGCGGTCTTCGATCAGAGACCGGGTTACGGCTGTAGCCAAAGACTCGACTGTGCAGCTCTGCTGGTTT
ATTACTGCTGCCTTGAAGGCCTTGCGGAATCATCTGGCCATCGATTTCGGCTCTCAACGTTCTCATCTCTGCCGA
TTCGTCATCCATTGGCTCGTTCACACCATTGGTCTCTCCAGCGAAATGACCTTTAGCGAGGCCAGATTCCAAGCT
CACTTGAAACTGGCGGCCGAATACCTGAAGCCTCAGACCGAAGCCCTGGGCGATCTGCAGAACTCCGAGTTCTCG
ACGAAGCTGCTTCGACTGATCAAGGACAACTTCAGCAGTGGATTCGAACTATCGACAGGACTCAGCATGGAGCGC
CTTTGGCTCGTGTTCCGAATCGCTCCGTTTCCTGACGAGACCGTCTTCCAACGATCTATGGGACTGGTCAGGCTG
GCTGACCGATTTGATGCCATCCGCTGGAAAGCCAGCGCGTCTATACTCGACTTGGCCAAAGCTCACGAGACGTTC
GAACAGGCGTACGCGATTGTGCGGAGTGGACGAGGCTGCGCGGATGAGCTCGTCAGTGACCTGACAACTGCCATC
GGCTCGCTGGAATCCCACATCGGAGACCGGGAGGCCAATCTGGAGCCATTTTTCGCGAGGGAGTTTGAGTATGTC
AGGCAGCTGTCTTTGCTATTCTCTCCCGCCGATGGTCAGAGCACGCAAGGAAGCAGTTTGGCCGTCTTATCTGGC
GCCGCGACCAAAGCCAACATGACGTTTGCCATTGCCGAAGGTCCTGCTGCTGTTCTGCAGTCTGTCGACCGTCTA
GCCTGCCAAGACAGCCATGTTTGGGATGGAAAGCTGGCAGCGTCTGTTTGGCTGAAGCTGCGGCATCTGGACACC
GTTAAGCTTGGTTCACTGTCTCTTCTCGAGTCCGAACTGCCCGTTCTTGGGCGATGCATATCCGGACTCGGAAGT
GAAATCGCATCTGATCCCCTCATCAAGTTGAACGAGCTTCTCTGGCAACTGCTGTCGGAAGTTTTCGTTGCTCAT
GAGCCACAGCTTGGGGAGTTGGTTGCGTCGGCGCGCTTACTGGCAGTGAAGCATCTGGATTCGGCCTCGAGCGTG
ACGCGGACTGGACTGGGCGGCGGTTCTTCCCCCTTTGACGACATTCTCGGCCAGATCAAGATGGACTATCTGCGC
CAAATCTCCAGAGACAATCTTATCCCAGCTGTTGTTGGCATCGCTGCAGCTGAGCATGACGCAGACGAGCGAGCC
CATTACTCGGCTTTGGCTTGGATGCAGTTCAGCATCGGACTGGTGAAGCTATACGTCCCGGACCGCGCCTTTGAT
CCTCAGCTGCGGCTGCTCGTGGAGCACGAGTTCTTTGAAGGCCTTCAGATGCGGTTGAGAGAAAAGGTGTCTGCG
TTGAGATCCTTCCAGCGGTTCTTTACCGGCCAGGATACGAGCAGGCGGATCGAGTTGCTGGAAGAGGAGATCCTG
GAAAGTGAGCGGCCTCGGGGAGACTGTCGGCCTGTGCATCGACCAGACGTGTCCGAGCTCGATAGACTGCACGTG
GAATGCTCAAATGTCCTCAAACTCGTCACTCGAAGTGGAATTCCGTCACTGTTCCGGCAACTTGGTTCCTCGAGC
TCAGCCGAAGAAACCAGCGGGCTTTTGCAGTTCATGGAACAGAACGTTCAGAGCCTGGTGCACCGGTTTTCTTCA
CAGTTCGAGGCATATCAGGACGTTACGAGCACGATATCGAATGCCCTGCGATGTCTGTTGTTAGGGATTTCTCTC
TGTGGTGCAGCTACGGCCAGCAGGTTGCAGACCTCAACGAGCCAACTCGTCAACGCCACTCCTTTCTTCGGCGGG
AGACGATGGGACGCTCGCATAGGACAGCAGTGCAGGAAGAGCTTTGAGTATCTCAGTCTCATGAGCGCCGCTGTT
GCTGTGGAAGGGGTAGATGGCCTATCGGTTGACTCACGCGAGTCCATCTTTGAGTGCTTCCACAGCTTCTACGAT
GACTGGTGCGACAGACTGGAAGCGGATCGCAAGACAGAAGAGGCGAGGACGAGCCTGTATCGGTTCTGCGGCTCG
TTGGAGGACGAAGAAGAGGTGGACGAGAAGGAGTTTAACGAGCTGTTTCCGACGTATGACGGAGAAGAGGGCTCG
GTGATGAAGCCTTCTACTGAGAAGGTGGCCACACTGGACACGACTTGCACCACGGAAAAGACTGTCAACTTTTAC
GCGGATCCCAATCTCTCGGAGGCTCGGAAGCTGGTCTCGCTCACGCAGAGGATCAAGACGCGGTTCAGAGAGCTG
CAAGGCGTGGATGAGATTGGACACATGCAGCCACTGGCCGACGTGGTCGAGTCGTGCGAGAGGTTGCTTGACCAG
GTCCATGCGGAGCCTCTCGCCAAGCTCATACCGAAGGTGGAACAGCTTCACGCTCTTGTCTACGAGTGGCAGTTT
GGCGGATGGGCCAGCAGGGTCCATGCTGTGCTGCCTCTCCACGATGCGCTCACCGAGACAATCATCCGCTGGCGA
CGGCTCGAGCTCGCGACGTGGTCTACCTTGTTTGACATGGAGGAGGAAAAGTGCCGCAACGATGCTTATTCCTGG
TGGTTCGTTGCCTACCAGGTAGTCGTCGCCGGGTCTCTGCCCATGATGGACTCTCCTTCAGAGCTACGGGAGTAT
GCAACGTCGTTGGTGAGAAACCTGGAGGGATATCTTTCGAGTTCCTTTGTCGGCCAGTTCCGGACGCGCGTCGCA
CTGCTTCGACAGCTGTCGAGCCACCTGCGACTCTTGACCAGGGAACATCCGACCTTGGCGGTGATATACGAGGCT
GTTCAGAACTTTGTCGATTACTTTGCGAGGTTTGAGGTGGCAGCTGACGCGGCTATTCGAGACGGACGAGGACCG
ATCGAGAAGAAGATGAAGGAAGTGCTTCTCCTTGCCAGCTGGAAGGATACCAACATCAATGCTCTCCGTGAGAGT
GCCCGCAAGTCTCACCTGAAGCTCTTTAGATTGGTGCGGAAATTTCGTGGTGTCTTGGGTCAGGACATGAAGGCC
ATTGTCGACAAAGGCCTTCCCTCCGAGACGTTTGTGTCGAATCAAGTCAACGGCAAGGTTCAGGCAGCTGGTGTT
CCGGACGTGCAAGTTGAGTCGGTGAACGAGATGCTGCCCAACTGGCTGAAGAATCATCGGCGGCTTGCCAATGTG
ACGACGACGGTGTGTGTTCTGGACAAGATTGCGGACGGCCTGGAGGCTACAGACAAGGCTACGGGGGTCGTCGAC
GATTTCGTGTCGAGCCTGCTGGCTTCGATGGCTGAGCTGCAACGAGAGACGCCCAAGGTTATGAGCGATGAGTCC
AAGGATCAAGTCAAGCACCTCAAGACGAGAAAGCGGAAACTTTTGGCGGATACGCTGAGGGATCTGCGAACGATG
GGGGTCAGACACAACCTCCCTCAGAACAAGCTGGCCGTTCAAGGGTCACTGGCGATTATCCTCGCGACGATGACG
CCTGTTGATGCTTCTCGTCTTGCCGGAATGGCCGAAGCCGACTATCTCCTGCATCAAGTGCTTGATCTCGCACCC
AAAGCCAGGGCTGCGGCAGAAGGGCACTCGGAGGATCTGACGAGCCCCGAGGTCGCTCGATGTGTCGGTCTGGTC
GAGGGAATGGTCGAGTTTTGTCTTTCTCAGCGAGACAGCATCGGCCTGGCGAGCAAGCCCCTTTCTTCGCTGCAG
GCTACTGCGGAAGACTTTCGGCGGTTGGGCAACAGTGAGAAGCTTGGGAGGCTTTGTCGACGCACGCAGCATGAG
AATTGGCGCGGTCTTCTCCCTTGGCTGGGGCAGATTCTACGGTTTGCTGCCAAGCTCGTCCAAGCGCAGGCAAGG
CTGGCACAGGGAGACGTCACTGAAGTGGTCCAGAGGCTTGGGGAATGGGCTGCTCGTGTTGATGCACATCTTGTC
GTTGCTGATGACTTGGGGCAGCTGCCAGCTCAGGTGATTTCCGAGGCACACGTTCGGTTAGAGGCGGCGGTCGCC
AAAGACATGGAGTCTCTTCGGAGTGATATTGAGGATCTTGGACGCCAAAGACCAGAACTGTCGTTTATCCTGCAG
CAAGTGGACGTCTGGACGCGGATCGACAGCCAACAGATGGACACGCCGAACTCGCTGGTCGAGTTGAAGACGTGG
GCGGACGCAGTGTCGACTTTGGTCGATAGTCTGCTGGTTGCTGTTGAAAGCGCCAAGAGGACAGCATCGGCGTGG
GACACCGACGTGGACAAGGCAGGGTGGCTGAGGAGACACAGTGATCTTGTCTGGGCGTCTGTTCAGCAACTTCAT
ATGGCGGATGTTGACAAGGCGGCCCGTCGTTGCGTGGAACTCATGCAGCATATTGACGTGGACGATTCGGCCATC
AGCGAGGCGGCAACGAGCATCATCCGGCTGGCGAGCCCGGTCCTCGACAGCTTCCTGGATCTCTGTCGACAGTGC
GTTGACCGTGGCGTGGACTTGCATCGTGCCACGGCTCACATGGCTTCCCGGTTGACGAGGGCCTTTACGCAGATG
GCTTCTCAGGGATTCTGCACTCCGCAGGAGAAGTCGAACGAGTCGGGCGATTCCGGACAGCTCGAGTCTGGGACT
GGACTGGGTGATGGCCAAGGTGCTGAGGACATAAGCAAAGATATTCAAGCCGACGAGGATCTTACCGAACTGGCG
CAGGAGAAGAACGAAGGCGAAAAGGAGGAGATTGAAGACGAGAAGGATGCAGTTGACATGGCGGATGAGGAGTTG
GAAGGGGAGCTCGGGAGCGTCAATGGAGAGCAAGACGATGAGGACGGATCGCAAAAAGGAGAGGACGGTGAAGAT
GATGTGGAAGAAGAGGCTGGCGAAGTCGATGATCTCGATCCCACAGCCGTGGACGAAAAGATGTGGGACGGAGAC
GATGAGAAAGCCGAAAAGGATCAGCAGGGGAACAAGGCAGCAGGCCGCGAAGAAGAAGACGAGATGATGGCACCG
GAGGAGGCGGAAGGTGAAGAAGAGGAGCAGGATGCAAAAGACGGCAAAGCGGAGGAACAAGAGGGCGAAGACGAG
CCAGATGCCGAGGAGGAGGGTGTGACGGCTCAGGATGAGATGAACCGGCAAGACCAGAACGTGGAGGACAAGGAC
GCGCTGGAGCTGCCGGAGGAGATGGACTTGGATTTTGACGACAAGGCTTCGGTGTCTTCGGAAGAGGGACTGGAT
GCCATGTCGATGGCCGAAGAAGAACAAGTCTGCGAGGACGAGGCCAAGGACGAGGAGATGGGAGATGACGAGGTC
AAGGATGAGGAGATGAAGGACGCGGCGGATCCAGAGACTGGCGAAGAAAGCGATGCAGAGGCGGAGGGCAAGATG
GGCGGTGAAGACGAGGTGGAAGACGAAGTGAAGCCGGAGTCGGAGCCGGAGCCGGAGCAGGCGAACGACGACGAG
GCACCGGTTTCGGCAGACACAGCTCAAGCAGACGCGGAACATGCGGCTCCCAGCGACGTCAAGAGTTCCGGGCGA
GACCCGACGGCCGACCAGAAGAATTCGGATGAGGCATTCAAGGCTGAAGCGGCGCAGCAAGACGGCGGAGAGATG
GGCGACAGTGCAGCGGATCGCGATGCCAGCGCAGGAAACCAGGGAGCAACTTCTCGCTCCAAGGAGATTCCGGAA
GAGGGAGAGCAGGGCGACAAGGAAGAACAAGACGAGACCAGGGGCAGCAACCCTTTCCGGAAGCTGGGAGATGCG
CTGGAGAAGTGGCATCGACAGCAGGCGGAGATTCAGGGCGCGAGGCCGGACGACGCGAAACAAGTCGATGGCGAC
GACGAGTCGAAAGAGCAAGGCCGGCTGGAGTTTGAGCATGTGCAAGACGATGAGGACGCGGGCGATACGCAGGCC
ATGGGCACAGCGCGCGAGGACGAAGTGATTCCTTTGGACGAGTCGATGGCCATTGATGAGGACGTCACAGACGGT
CAGGGCAAAGCAATGGAGACGGAGAAGGATGACGAAGGTCCTGAAGCAGACGAAATTGATGAGAAAGGGATGGAC
GACATTGAGCTTCATGATGAGCAGGGCCTCGACGGCAAGACGGGCGACGCTGGAGATGAGCACAGATCCGGACCC
GACATCAGACAAGGAAACTTCAACAAAGAAGACGAGCGGGAGGTCACCGAGCAGGACGAGACTGAAGAGCCGATA
CAGCCATCACCAACACAAGCCGAAAGAGAGCCCCGAGACCTGGACGAATGCAGAAGACAGTGGACAGAACTAGAG
CGCAAGACCCAGGGTCTCTCCCAGTCACTGACATCGCAACTCCGCCTCATCCTCGTCCCAACACAAGCAACCAAA
ATGTCGGGCTCCTTCCGAACAGGCAAACGCCTCAACATCAAGCGCATAATCCCCTACGTCGCCTCAGGCTACAAG
CGCGACAAGATCTGGATGCGACGGAGCGTCCCGACCAAGCGCCAGTACCAAGTCCTCCTCTGCGTCGACGACAGC
AAGAGCATGGGCGAGACGCAGGCGGGGCCCCTGGCGCTCGAGGCGCTCGTCATGGTGACGCGGTCGCTGGCCATG
CTCGAGGTCGGCGAGGTGGGAGTCGTGGGATTCGGGACGGGGGTCACGGTTGCGCATGAGCTGGGCAGGCCGCTG
GTCGGCGAGGCGGGGGCGAGGACGCTGCGGGAGTTTGGGTTTCATCAGGAGAGGACTGATATGGTGTTGCTGCTG
AGGCGGACCATGGAGATGCTACGACTCGCCCGCGCGCAGCAGCAATCCTCCCGGTCGGAGCTCTGGCAACTGGCC
CTCATCCTCTCCGACGGGCTGACGCCGTCGTCTGCGCACGAGACGATGCGGCGGCTGCTGCGGACGGCGACGGAG
GAGCGGGTCATGGTGGTGTTTGTGGTGATTGACGGGGGGGGCGGGGTGCTGGATCTCAAGGAGGCGAGAGTTGAT
GTGGTTGTCCCTGATTGGCCACACAAAGCCATCACCATCAAGTCCCCCTCCACGTGA
Transcript >Ophun1|5633
ATGAGAGAGACCATCGACGTCTCGCGGCAGACGAGATCCCTTCTGGAGGATCCGGTTGCGTTGCAGCAACTTCCA
CCGAATTTACTAGAGATTATTCGGCAACCATCGCCGACGGACCTACTGGATGCCGTTGCAGACGCAGCACTGAGG
CCGTCACTTACAGAAAGAATCTTTGTTCATTTTGAAGACGTCTTTCCTGATATTTGCGCGCGATGGACTCTCAGG
GGCGCATCACCTGTACAGCAACTGCACGCCACCGCCGCTTTGGCGAGAATCTTACCCTTTGCCCCGTATCTGGCC
GACTTTCTCGGATACCCTAGCACCAAGACCGCGGGTGTAGAAGTTGATGGCCAAGATCCGATAGGTCGTATTCCT
CTGGCGCTGATTCAAATTGATATCCTCGAGCGAAGGGGCGTGTGTGAGGAGGACGAGCTGCTATGTCTCATCACG
CTGTGGAGGCTGTTGAACTTCGACTTTCCCATCCGTTCTTTGGTGCAGCTGGACTTTATCAAGCGTCAATTCGAG
AGCGGCTGTCTGGCTATCCGATACGTCGCGATCCGCATCTACTGCCAGCTGATGCGTGCGTCTGATCAGCGGCTT
GAGGCTCTCATCGTCGAGCACTGTGGACGGGACAAGGCTATTCTCGGTCATCTCGACGGCGTGCCAATAGACTTT
GGGTTCTTGTCCTTGTATGAGGCTTCACGAGCTCAGCGCGTTGTTGCTTTGAGAGAAGATGTGAAACGACGCAAT
CACGGTTCCAGTCAAGAACCGCGTCTACATACACTCACTACACTTGTTGTGCCTTTCGGAAACGCCATGCTTCCC
CGGCTCTGCGGAAGCGAGAGAGTGCCGAGAACCCTGGTGATGACGAACACAACTACACAGCATCTCCAAGGCCTG
GCATCGATGCTGCGAGAGCCGGATCCGATTCTACTCCGTGGTCCGTCGGGTGCTGGGAAAAGCGCCATGGTTCAT
GAAGTTGCGAAACAGCTTGGAAAGTACGACGACATGGTCACGCTGCATCTCAACGAGCAGACTGATGCCAAGACG
CTCATCGGCCTTTACTCGACCAACTCGAAGCCGGGGAACTTCGAATGGCGCCCGGGTGTACTGACCACGGCCGTC
CGTGAAGGAAGATGGGTGCTCATCGAGGACCTGGATCGAGCACCAATCGAGGTCATGAGCATCCTGCTTCCCCTG
ATCGAGCGACGAGAGTTGCTTTTGCCTTCTCGCGGGGTGACATATCCGGCCCCTCGTGACTTTCGTCTCTTTGCA
ACGATCCGGACCGCTTCAGCCATGGATGACGGAGAAAGCCTGCCGAATCTGGTCGGGATGCGACTGTGGAAGTCT
CTCTACGTCACGCCTCAGACAGCCGAGGAGCTGGAAAACGTCATCCTTCATATGTATCCGATTCTGCGGAAATTC
CTACCGGGCATACTCGCCGTGTACCAACGGCTTTCACGGGTGGCGGGAAGCCTTTCCTTCATGTCCCGGGGCAGA
AGCGTCGTCGACCGACAGATCAGCCTGAGGGATCTTCTCAAATGGTGTCGACGACTCGAGGATGGTCTTGTTGGG
GCGGGATCTGTGTCCGGCGATGAGCCCATCAGTGAAGCTACCAGAGACTGCATGTTCATGGACGCGCTGGACTGT
TTCGTGGGGAGCTGCCCAGACGCGTCGCTCGGAAAGGAGCTTGCGTATGCCATTGCTGAAGAGATGCATATATCC
AGAGACAGGGCTGAGCACTACCTTTGCGCCAATATACCTATTTTGGACGATGGTGATGCCATGCTCGGTATTGGT
AGGGCCCGGCTGCGGAAGAATTCATTGTCACGTCGGCTTTCGAGGTCCAAGAGGCCGTTTGCCAGCACAACCCAC
GCCAAGAGACTGCTAGAGCAGATTGCCAGGGCAGTCAAGCTGGAAGAGCCGATCCTCCTCGTCGGTGAGACGGGC
ATCGGAAAAACGACGGTGGTTCAGCAGCTTGCAGAGTCGCTGGGCCACAAACTCATTGCCGTGAATCTCTCGCAG
CAGAGTGAGGCGGGTGATCTTCTCGGAGGTTTCAAGCCCGTCAACGCGCGAAGCCTAGCTACACCCCTGAAGGAA
GAGTTCGAGGCGCTATTCGCGGCAACCGGCATCTCTGCGTCAAAGAATGAAAAGTACCTGGGACAGATCGGCAAG
TCGTTCGCCAAAGGGCAGTGGTCCAGGGTGTCGAAGCTTTGGAGAGAGGCGACGCAAATGTTTGACAGCATCTGC
GAGCAATATCGACGGATGAGCTCCCCGAGTCACGATGACGATGCGCACCCGGCGAAGCGCCGCAAGACGATGTCT
AAGCTTGAGGCCTTGGAGAAGTTGAGGCCGCGATGGTCTGAGTTTTCTCGCAAGCTCGATAGGTTCGATATGCAG
GAATGGGGTGTGTCTGGAAATGTTGCGTTCTCTTTTATCGAGGGCAACTTGGTCAAGGCTATTCGGAACGGTGAC
TGGGTGCTCTTGGATGAGATCAATCTTGCTTCGCCAGACACGCTGGAAACCATTGCCGATCTCCTGACTGGTCCA
GACGAGCGGCCCTCCATCTTACTTGCGGAAACGGGCGATCTCGAGAAAATCGTGGCACATTCCAATTTTCGCATC
TTTGGCGCCATGAATCCTGCAACTGACGTGGGGAAGCGGGATTTGCCCGTGGGCATCAGATCACGGTTCACGGAG
CTCTACGTCAGGAGCCCCGACGCCGACCACAAGGATCTGCTCACCATTGTCAAGGCGTATCTGGGCAGCAGCAGC
GGCGAGATGGACCGGGCGGCCGACGACATGACACGGCTGTACCTCAACACGAAGCGAATGGCGGAAGAGAAGCGG
CTGGTCGACGGAGCCAACGAGGTTCCTCATTTCAGCTTGCGGACGCTGACCCGGGTTTTGAGCTATGTCACCTCG
ATTGCGCCGTTCTATGGCCTTCGTCGTGCTTTGTATGAGGGCTTCTCCATGGGTTTCCTCACGCTGCTGGACAGG
GAGTCCGAGTCGATGCTGCTTCCTCTCATTCATCATCATCTCCTCGATAAGCATGGGAATCCCCAGTCGCTACTC
TCGCAGACACCGCAGCATGCAAAGGACGGGAGACGATACGTCAGGTTCCGGAATCAGAACCGGGATCGCCAGTAC
TGGCTATTGCAAGGCGAGCAGACCCCGATTGAAAGACAGGACTACATCATTACTCCGTTCGTGGAGCGGAACCTC
CTGAACTTGGTTCGAGCGACATCGACCAGGCAATTCCCGATTCTAATACAGGGACCGACGTCTGCCGGCAAAACG
AGCATGATTGAGTATCTGGCCAACTTTAGTGGAAACACCTTTGTCCGCATCAACAACCACGAACACACCGACCTC
CAGGAGTACCTTGGCACGTACGTCTCGGGACCGGACGGCCAGTTGCGTTTTGAAGAAGGTCTTCTCGTTCAGGCC
ATGCGAAAAGGCTACTGGATTGTACTGGACGAGCTCAACCTGGCGCCAACGGAAGTTTTAGAGGCCTTGAATCGT
CTGCTGGATGACAACCGCGAGCTGCTCGTTCCCGAGACCCAAGAGGTTGTCAGACCCCATGACAATTTCATCCTG
TTCGCTACGCAGAATCCGCCGGGTCTTTATGGCGGTCGCAAAGTTCTCTCTCGAGCGTTTCGCAACAGGTTCCTG
GAGCTGCACTTTGACGATATCCCCGAGGATGAGCTGGAGCACATTCTGCAACAACGGTGCCGCAACACTTCACCG
CCGGATTGTCGGCGAATCGTCAACGTTTACAAGGAACTCTCCAGGCTCCGTCAGTCGAGCCGTCTTTTTGAGTCA
AAGGACAGCTTCGCGACTTTGAGAGACCTCTTTCGCTGGGCGCTGAGAGACGCAAACACCAGATACGAGATTGCC
GTTCATGGGATCATGCTGCTGGCAGAGAGGGTTCGCAACGACGAGGAGCGGTCGGCTGTCAAGGAAGTCATCGAA
AAGATTTTCAACATCAAGATTGACCCCGACGAACTCTACTCAGAAACGGTTGCCCCTGAGCTCAAGCGCTTGGTT
GGCGCCCCTAACAGCCAGGACGTGGTTTGGACACATGCCATGCGGCGTCTTTATGTCTTGGTCTGCAGGGCTCTT
CAGAACAATGAACCGGTTCTCCTCGTTGGTGAGACCGGCTGTGGCAAGACTACCGTCTGTCAGATGCTTGCCGAG
GCTGCTGGAAAGCAGCTTGCCATTGTCAACGCGCATCAAAACACGGAGACGGGCGACCTTATAGGCTCGCAGAGA
CCGAATCGGAATCGTGGCGCCGTTCTTGATGCCTTGAGTAACGACCTTGGGTTTATCTTGGAGACGCTCGGGCTG
GACGTTCCCAACTCGGTCGAGGAAAGACTTCAAGCATATCGCGCTCTGCATCCTACGTCACTCACCAAGCTTCCT
TCAGAACTCATCGAACGAGTCTCGGCAAATGAGGCGAAATCCAAGGTTCTTTTCCAGTGGTACGACGGAGCCTTA
GTTGAGGCCATGCGAGAAGGATACTTGTTCCTCCTTGACGAGATTTCACTCGCGGATGACTCGGTCTTGGAGAGA
CTCAACTCAGTTCTCGAGCCCCAGAGGACGCTTCTTTTGGCCGAGAAGGGCATCGATAACCCTACCGTCGTGGCG
TGTGATGGGTTTCAGTTCCTCGCGACCATGAACCCTGGTGGCGACTTTGGAAAGAAAGAGCTTTCACCTGCCCTG
CGTAACCGCTTTACGGAGATCTGGGTTCCGCCGCTGTCGGAGAGCCGCGATATACAAACCATTGTGCAGACGAAA
TTACTTGATGGACGGAAACATCTTGCGGATATCATGGTCCGTTTCGCAACGTGGTTTGGACAGACGTTTCGACCT
ATGGCAACGACGCCCATCTCGGTGCGAGAGCTTCTTGCATGGGTTCAGTTCATCAACTCATCTGATGCGGCCGAT
CCCGTTGAGTCCTTGGTTCATGGAGCGTCTGCGATTTTCATCGACAGTATCGGGGCCAGCCCATCGGCCATGGTT
ACGACTGATCCCAAGGCTATTCACCTGCAGAGACAAGAGTGCCTTCAGATGATTGGTGATATTGCTGGTTGCAAT
GCGCTCGAGGTCCATGGAGCAAACCCCGAGCTCATCATTACCCCCGATTCCTTGATCATCGGCAACTTCAGCGTA
CCCCGGTGCTCAATCAGCGTCAGCGATGCGGGCTTCGCGTTCCAAGCGCCAACGACGAGACTCAACGCCATGAGA
ATCGTGAGAGCCCTTCAGACGCGCAAGCCTATTCTCCTTGAAGGAAACCCTGGCGTCGGCAAGACATCATTAGTG
GCAGCTATATCTCAAGCCTGCGGTCGTCCATTGACACGCATCAACTTGTCGGATCAAACAGACTTGATGGACCTC
TTTGGAACGGATATGCCTGTCGAAGGAGAGGAGGCTGGAAACTTTGCGTGGCGGGATGCACCGTTCTTGCAGGCG
ATGCAAAAGGGCGAATGGGTTCTCCTGGACGAGATGAATCTCGCGTCGCAGTCCGTCTTGGAGGGGCTGAACGCC
TGTCTGGATCATCGGGGAGAGATTTACGTCTCTGAGCTGGACCAGGTATTCAGACGGCATCCCGACTTTAGGCTG
TTTGCCGCTCAGAACCCTCATCATCAAGGCGGGGGCCGCAAGGGCTTGCCAGCCTCCTTTGTGAATCGGTTCATC
GTCGTCTATGCCGATGTTTTTCAAGACGAGGACCTGAAGCTCATCGCGGCTCATAACTTTCCTGGCGTCAACGCC
GAGAACGCTGGCCTCATCATCGACTTCGTCTCTCAGCTTGATCACAAGCTATCTGTTGAGAGAGCTTTTGGACTG
CAAGGCGGGCCCTGGGAGTTCAATTTGCGCGACGTTCTTCGATGGCTGGATTTGCTCGATTGCAATCGTTCGCGG
GAAGTTCGCGTCGATGACTTTCTCCAGATTATCGTTCGTCAACGCTTTCGCACTCAGGAGGATCGAGACCAGGTG
GACAGGCTATTCGGTCAGCTCGCCGGGCGGAAGCCCAGAATGCACTCGCTGTATCACGATGTCAACTCTTCCTTC
AGCCAAGTCGGACAAACTACCGTGCCCAGGAACCCCGAGTATCAGCCTGAAAGGCTTTCGAGCCTGGACACTGTG
GCCATTCTCCCCGAACTGGAGTCTGTGATGATGTGCGTGGAGAAGAAGATGCCCTGCATCCTAAGCGGCCCTTCT
GGCTCTGGGAAGTCTGCTCTTTTGAAATACGCCGCTGCGTTGGCTGGGAAGTCTCTGGTGGTGTTTCCCTTGAAC
GCAGACACCGACACCATGGACCTCGTTGGCGGCTTTGAACAAGCAGATCCACTTCGAGATCTGAACTCGACGTTG
AGATGCCTATGCCGCCGTCTCCAGGAGGTCGAGAGTCGCAGTGCCCCGGCAGAGATGCCTACTCAGGCTTTCGAA
TGCGTGAATCTCCTCGAAAACTACTTCTTGCATGGAGACGATGCTCGTCATGTTGATGCCACGCTGCGTCTTGTT
GATGCCATCTTGGGTCATGTTGAACGTCTCCGCGAGGTTGATGCCAGCATCGGGTCCTGGCTCGACAAGGCGAGG
GAACGACTGAGAGAGCAGGCCATTTCCATCAAGCCAATGTTCAAGTGGCTAGATGGAGTCATCGTCGAAGCTCTT
GAGACGGGGCAGTGGCTCGTACTCGACCACGCTAACCTGTGCAACGCTTCGGTCCTGGACAGACTCAACTCTTTG
CTCGAGCCGAACGGGTTTCTGTGCGTCAACGAGTGTTGCGATCCTGAGGGGAATCCGAAAATGGTCCGGCCTCAT
CCCGAATTCCGGGTATTTCTGACCGTGGACCCGAGTTACGGCGAGCTATCGCGCGCAATGAGGAATCGGGCTATC
GAAGTGAATCTCAGTTCGCGACCTACACCCAGAGATCCTTGCTTCGACAGGATAAGCGAAGTCGAGAGCGGACTG
TGGAGGCTCAGAAACGTCAACGACTTCTGCGAAAGGCTGTCGTCGGAGAGCTGCACTGCGTTGACGCCCGCTGGC
GAGTGTCTGTCTGTCAGAGATGTCGCTCTCCTGCCGCGATTCCTGGAAGGACTGCCGTGTGGCGATGAGCGAAGC
CAGCCGTCTCTGCAAGTCGTGACGGAGTTGATGGGCTTCTTGCGCTCGCCGGCCGGTTCCAGCGATCTTCAAAGA
ATCGAGAATCTCTACTCTACTCTCCCGGAGGCATCACAGTCATTGGCCTCTCATCAGCCCATCCACGCGTTGATC
AATCCTTACATCTTGGAGCTGCTTCCCAGTTCGAAGGCGGCAGAGTGGGCCGGCTTGCGATTAGACCACCTGCGC
GCTGTTTACGATATAGAGAAGATGTTTGAACGGCAATGCGGCGGGGCTCATTCGGCAAAGCCTTGGTTGTTGACG
CGGTTGCAGCGGTCTTCGATCAGAGACCGGGTTACGGCTGTAGCCAAAGACTCGACTGTGCAGCTCTGCTGGTTT
ATTACTGCTGCCTTGAAGGCCTTGCGGAATCATCTGGCCATCGATTTCGGCTCTCAACGTTCTCATCTCTGCCGA
TTCGTCATCCATTGGCTCGTTCACACCATTGGTCTCTCCAGCGAAATGACCTTTAGCGAGGCCAGATTCCAAGCT
CACTTGAAACTGGCGGCCGAATACCTGAAGCCTCAGACCGAAGCCCTGGGCGATCTGCAGAACTCCGAGTTCTCG
ACGAAGCTGCTTCGACTGATCAAGGACAACTTCAGCAGTGGATTCGAACTATCGACAGGACTCAGCATGGAGCGC
CTTTGGCTCGTGTTCCGAATCGCTCCGTTTCCTGACGAGACCGTCTTCCAACGATCTATGGGACTGGTCAGGCTG
GCTGACCGATTTGATGCCATCCGCTGGAAAGCCAGCGCGTCTATACTCGACTTGGCCAAAGCTCACGAGACGTTC
GAACAGGCGTACGCGATTGTGCGGAGTGGACGAGGCTGCGCGGATGAGCTCGTCAGTGACCTGACAACTGCCATC
GGCTCGCTGGAATCCCACATCGGAGACCGGGAGGCCAATCTGGAGCCATTTTTCGCGAGGGAGTTTGAGTATGTC
AGGCAGCTGTCTTTGCTATTCTCTCCCGCCGATGGTCAGAGCACGCAAGGAAGCAGTTTGGCCGTCTTATCTGGC
GCCGCGACCAAAGCCAACATGACGTTTGCCATTGCCGAAGGTCCTGCTGCTGTTCTGCAGTCTGTCGACCGTCTA
GCCTGCCAAGACAGCCATGTTTGGGATGGAAAGCTGGCAGCGTCTGTTTGGCTGAAGCTGCGGCATCTGGACACC
GTTAAGCTTGGTTCACTGTCTCTTCTCGAGTCCGAACTGCCCGTTCTTGGGCGATGCATATCCGGACTCGGAAGT
GAAATCGCATCTGATCCCCTCATCAAGTTGAACGAGCTTCTCTGGCAACTGCTGTCGGAAGTTTTCGTTGCTCAT
GAGCCACAGCTTGGGGAGTTGGTTGCGTCGGCGCGCTTACTGGCAGTGAAGCATCTGGATTCGGCCTCGAGCGTG
ACGCGGACTGGACTGGGCGGCGGTTCTTCCCCCTTTGACGACATTCTCGGCCAGATCAAGATGGACTATCTGCGC
CAAATCTCCAGAGACAATCTTATCCCAGCTGTTGTTGGCATCGCTGCAGCTGAGCATGACGCAGACGAGCGAGCC
CATTACTCGGCTTTGGCTTGGATGCAGTTCAGCATCGGACTGGTGAAGCTATACGTCCCGGACCGCGCCTTTGAT
CCTCAGCTGCGGCTGCTCGTGGAGCACGAGTTCTTTGAAGGCCTTCAGATGCGGTTGAGAGAAAAGGTGTCTGCG
TTGAGATCCTTCCAGCGGTTCTTTACCGGCCAGGATACGAGCAGGCGGATCGAGTTGCTGGAAGAGGAGATCCTG
GAAAGTGAGCGGCCTCGGGGAGACTGTCGGCCTGTGCATCGACCAGACGTGTCCGAGCTCGATAGACTGCACGTG
GAATGCTCAAATGTCCTCAAACTCGTCACTCGAAGTGGAATTCCGTCACTGTTCCGGCAACTTGGTTCCTCGAGC
TCAGCCGAAGAAACCAGCGGGCTTTTGCAGTTCATGGAACAGAACGTTCAGAGCCTGGTGCACCGGTTTTCTTCA
CAGTTCGAGGCATATCAGGACGTTACGAGCACGATATCGAATGCCCTGCGATGTCTGTTGTTAGGGATTTCTCTC
TGTGGTGCAGCTACGGCCAGCAGGTTGCAGACCTCAACGAGCCAACTCGTCAACGCCACTCCTTTCTTCGGCGGG
AGACGATGGGACGCTCGCATAGGACAGCAGTGCAGGAAGAGCTTTGAGTATCTCAGTCTCATGAGCGCCGCTGTT
GCTGTGGAAGGGGTAGATGGCCTATCGGTTGACTCACGCGAGTCCATCTTTGAGTGCTTCCACAGCTTCTACGAT
GACTGGTGCGACAGACTGGAAGCGGATCGCAAGACAGAAGAGGCGAGGACGAGCCTGTATCGGTTCTGCGGCTCG
TTGGAGGACGAAGAAGAGGTGGACGAGAAGGAGTTTAACGAGCTGTTTCCGACGTATGACGGAGAAGAGGGCTCG
GTGATGAAGCCTTCTACTGAGAAGGTGGCCACACTGGACACGACTTGCACCACGGAAAAGACTGTCAACTTTTAC
GCGGATCCCAATCTCTCGGAGGCTCGGAAGCTGGTCTCGCTCACGCAGAGGATCAAGACGCGGTTCAGAGAGCTG
CAAGGCGTGGATGAGATTGGACACATGCAGCCACTGGCCGACGTGGTCGAGTCGTGCGAGAGGTTGCTTGACCAG
GTCCATGCGGAGCCTCTCGCCAAGCTCATACCGAAGGTGGAACAGCTTCACGCTCTTGTCTACGAGTGGCAGTTT
GGCGGATGGGCCAGCAGGGTCCATGCTGTGCTGCCTCTCCACGATGCGCTCACCGAGACAATCATCCGCTGGCGA
CGGCTCGAGCTCGCGACGTGGTCTACCTTGTTTGACATGGAGGAGGAAAAGTGCCGCAACGATGCTTATTCCTGG
TGGTTCGTTGCCTACCAGGTAGTCGTCGCCGGGTCTCTGCCCATGATGGACTCTCCTTCAGAGCTACGGGAGTAT
GCAACGTCGTTGGTGAGAAACCTGGAGGGATATCTTTCGAGTTCCTTTGTCGGCCAGTTCCGGACGCGCGTCGCA
CTGCTTCGACAGCTGTCGAGCCACCTGCGACTCTTGACCAGGGAACATCCGACCTTGGCGGTGATATACGAGGCT
GTTCAGAACTTTGTCGATTACTTTGCGAGGTTTGAGGTGGCAGCTGACGCGGCTATTCGAGACGGACGAGGACCG
ATCGAGAAGAAGATGAAGGAAGTGCTTCTCCTTGCCAGCTGGAAGGATACCAACATCAATGCTCTCCGTGAGAGT
GCCCGCAAGTCTCACCTGAAGCTCTTTAGATTGGTGCGGAAATTTCGTGGTGTCTTGGGTCAGGACATGAAGGCC
ATTGTCGACAAAGGCCTTCCCTCCGAGACGTTTGTGTCGAATCAAGTCAACGGCAAGGTTCAGGCAGCTGGTGTT
CCGGACGTGCAAGTTGAGTCGGTGAACGAGATGCTGCCCAACTGGCTGAAGAATCATCGGCGGCTTGCCAATGTG
ACGACGACGGTGTGTGTTCTGGACAAGATTGCGGACGGCCTGGAGGCTACAGACAAGGCTACGGGGGTCGTCGAC
GATTTCGTGTCGAGCCTGCTGGCTTCGATGGCTGAGCTGCAACGAGAGACGCCCAAGGTTATGAGCGATGAGTCC
AAGGATCAAGTCAAGCACCTCAAGACGAGAAAGCGGAAACTTTTGGCGGATACGCTGAGGGATCTGCGAACGATG
GGGGTCAGACACAACCTCCCTCAGAACAAGCTGGCCGTTCAAGGGTCACTGGCGATTATCCTCGCGACGATGACG
CCTGTTGATGCTTCTCGTCTTGCCGGAATGGCCGAAGCCGACTATCTCCTGCATCAAGTGCTTGATCTCGCACCC
AAAGCCAGGGCTGCGGCAGAAGGGCACTCGGAGGATCTGACGAGCCCCGAGGTCGCTCGATGTGTCGGTCTGGTC
GAGGGAATGGTCGAGTTTTGTCTTTCTCAGCGAGACAGCATCGGCCTGGCGAGCAAGCCCCTTTCTTCGCTGCAG
GCTACTGCGGAAGACTTTCGGCGGTTGGGCAACAGTGAGAAGCTTGGGAGGCTTTGTCGACGCACGCAGCATGAG
AATTGGCGCGGTCTTCTCCCTTGGCTGGGGCAGATTCTACGGTTTGCTGCCAAGCTCGTCCAAGCGCAGGCAAGG
CTGGCACAGGGAGACGTCACTGAAGTGGTCCAGAGGCTTGGGGAATGGGCTGCTCGTGTTGATGCACATCTTGTC
GTTGCTGATGACTTGGGGCAGCTGCCAGCTCAGGTGATTTCCGAGGCACACGTTCGGTTAGAGGCGGCGGTCGCC
AAAGACATGGAGTCTCTTCGGAGTGATATTGAGGATCTTGGACGCCAAAGACCAGAACTGTCGTTTATCCTGCAG
CAAGTGGACGTCTGGACGCGGATCGACAGCCAACAGATGGACACGCCGAACTCGCTGGTCGAGTTGAAGACGTGG
GCGGACGCAGTGTCGACTTTGGTCGATAGTCTGCTGGTTGCTGTTGAAAGCGCCAAGAGGACAGCATCGGCGTGG
GACACCGACGTGGACAAGGCAGGGTGGCTGAGGAGACACAGTGATCTTGTCTGGGCGTCTGTTCAGCAACTTCAT
ATGGCGGATGTTGACAAGGCGGCCCGTCGTTGCGTGGAACTCATGCAGCATATTGACGTGGACGATTCGGCCATC
AGCGAGGCGGCAACGAGCATCATCCGGCTGGCGAGCCCGGTCCTCGACAGCTTCCTGGATCTCTGTCGACAGTGC
GTTGACCGTGGCGTGGACTTGCATCGTGCCACGGCTCACATGGCTTCCCGGTTGACGAGGGCCTTTACGCAGATG
GCTTCTCAGGGATTCTGCACTCCGCAGGAGAAGTCGAACGAGTCGGGCGATTCCGGACAGCTCGAGTCTGGGACT
GGACTGGGTGATGGCCAAGGTGCTGAGGACATAAGCAAAGATATTCAAGCCGACGAGGATCTTACCGAACTGGCG
CAGGAGAAGAACGAAGGCGAAAAGGAGGAGATTGAAGACGAGAAGGATGCAGTTGACATGGCGGATGAGGAGTTG
GAAGGGGAGCTCGGGAGCGTCAATGGAGAGCAAGACGATGAGGACGGATCGCAAAAAGGAGAGGACGGTGAAGAT
GATGTGGAAGAAGAGGCTGGCGAAGTCGATGATCTCGATCCCACAGCCGTGGACGAAAAGATGTGGGACGGAGAC
GATGAGAAAGCCGAAAAGGATCAGCAGGGGAACAAGGCAGCAGGCCGCGAAGAAGAAGACGAGATGATGGCACCG
GAGGAGGCGGAAGGTGAAGAAGAGGAGCAGGATGCAAAAGACGGCAAAGCGGAGGAACAAGAGGGCGAAGACGAG
CCAGATGCCGAGGAGGAGGGTGTGACGGCTCAGGATGAGATGAACCGGCAAGACCAGAACGTGGAGGACAAGGAC
GCGCTGGAGCTGCCGGAGGAGATGGACTTGGATTTTGACGACAAGGCTTCGGTGTCTTCGGAAGAGGGACTGGAT
GCCATGTCGATGGCCGAAGAAGAACAAGTCTGCGAGGACGAGGCCAAGGACGAGGAGATGGGAGATGACGAGGTC
AAGGATGAGGAGATGAAGGACGCGGCGGATCCAGAGACTGGCGAAGAAAGCGATGCAGAGGCGGAGGGCAAGATG
GGCGGTGAAGACGAGGTGGAAGACGAAGTGAAGCCGGAGTCGGAGCCGGAGCCGGAGCAGGCGAACGACGACGAG
GCACCGGTTTCGGCAGACACAGCTCAAGCAGACGCGGAACATGCGGCTCCCAGCGACGTCAAGAGTTCCGGGCGA
GACCCGACGGCCGACCAGAAGAATTCGGATGAGGCATTCAAGGCTGAAGCGGCGCAGCAAGACGGCGGAGAGATG
GGCGACAGTGCAGCGGATCGCGATGCCAGCGCAGGAAACCAGGGAGCAACTTCTCGCTCCAAGGAGATTCCGGAA
GAGGGAGAGCAGGGCGACAAGGAAGAACAAGACGAGACCAGGGGCAGCAACCCTTTCCGGAAGCTGGGAGATGCG
CTGGAGAAGTGGCATCGACAGCAGGCGGAGATTCAGGGCGCGAGGCCGGACGACGCGAAACAAGTCGATGGCGAC
GACGAGTCGAAAGAGCAAGGCCGGCTGGAGTTTGAGCATGTGCAAGACGATGAGGACGCGGGCGATACGCAGGCC
ATGGGCACAGCGCGCGAGGACGAAGTGATTCCTTTGGACGAGTCGATGGCCATTGATGAGGACGTCACAGACGGT
CAGGGCAAAGCAATGGAGACGGAGAAGGATGACGAAGGTCCTGAAGCAGACGAAATTGATGAGAAAGGGATGGAC
GACATTGAGCTTCATGATGAGCAGGGCCTCGACGGCAAGACGGGCGACGCTGGAGATGAGCACAGATCCGGACCC
GACATCAGACAAGGAAACTTCAACAAAGAAGACGAGCGGGAGGTCACCGAGCAGGACGAGACTGAAGAGCCGATA
CAGCCATCACCAACACAAGCCGAAAGAGAGCCCCGAGACCTGGACGAATGCAGAAGACAGTGGACAGAACTAGAG
CGCAAGACCCAGGGTCTCTCCCAGTCACTGACATCGCAACTCCGCCTCATCCTCGTCCCAACACAAGCAACCAAA
ATGTCGGGCTCCTTCCGAACAGGCAAACGCCTCAACATCAAGCGCATAATCCCCTACGTCGCCTCAGGCTACAAG
CGCGACAAGATCTGGATGCGACGGAGCGTCCCGACCAAGCGCCAGTACCAAGTCCTCCTCTGCGTCGACGACAGC
AAGAGCATGGGCGAGACGCAGGCGGGGCCCCTGGCGCTCGAGGCGCTCGTCATGGTGACGCGGTCGCTGGCCATG
CTCGAGGTCGGCGAGGTGGGAGTCGTGGGATTCGGGACGGGGGTCACGGTTGCGCATGAGCTGGGCAGGCCGCTG
GTCGGCGAGGCGGGGGCGAGGACGCTGCGGGAGTTTGGGTTTCATCAGGAGAGGACTGATATGGTGTTGCTGCTG
AGGCGGACCATGGAGATGCTACGACTCGCCCGCGCGCAGCAGCAATCCTCCCGGTCGGAGCTCTGGCAACTGGCC
CTCATCCTCTCCGACGGGCTGACGCCGTCGTCTGCGCACGAGACGATGCGGCGGCTGCTGCGGACGGCGACGGAG
GAGCGGGTCATGGTGGTGTTTGTGGTGATTGACGGGGGGGGCGGGGTGCTGGATCTCAAGGAGGCGAGAGTTGAT
GTGGTTGTCCCTGATTGGCCACACAAAGCCATCACCATCAAGTCCCCCTCCACGTGA
Gene >Ophun1|5633
ATGAGAGAGACCATCGACGTCTCGCGGCAGACGAGATCCCTTCTGGAGGATCCGGTTGCGTTGCAGCAACTTCCA
CCGAATTTACTAGAGATTATTCGGCAACCATCGCCGACGGACCTACTGGATGCCGTTGCAGACGCAGCACTGAGG
CCGTCACTTACAGAAAGAATCTTTGTTCATTTTGAAGACGTCTTTCCTGATATTTGCGCGCGATGGACTCTCAGG
GGCGCATCACCTGTACAGCAACTGCACGCCACCGCCGCTTTGGCGAGAATCTTACCCTTTGCCCCGTATCTGGCC
GACTTTCTCGGATACCCTAGCACCAAGACCGCGGGTGTAGAAGTTGATGGCCAAGATCCGATAGGTCGTATTCCT
CTGGCGCTGATTCAAATTGATATCCTCGAGCGAAGGGGCGTGTGTGAGGAGGACGAGCTGCTATGTCTCATCACG
CTGTGGAGGCTGTTGAACTTCGACTTTCCCATCCGTTCTTTGGTGCAGCTGGACTTTATCAAGCGTCAATTCGAG
AGCGGCTGTCTGGCTATCCGATACGTCGCGATCCGCATCTACTGCCAGCTGATGCGTGCGTCTGATCAGCGGCTT
GAGGCTCTCATCGTCGAGCACTGTGGACGGGACAAGGCTATTCTCGGTCATCTCGACGGCGTGCCAATAGACTTT
GGGTTCTTGTCCTTGTATGAGGCTTCACGAGCTCAGCGCGTTGTTGCTTTGAGAGAAGATGTGAAACGACGCAAT
CACGGTTCCAGTCAAGAACCGCGTCTACATACACTCACTACACTTGTTGTGCCTTTCGGAAACGCCATGCTTCCC
CGGCTCTGCGGAAGCGAGAGAGTGCCGAGAACCCTGGTGATGACGAACACAACTACACAGCATCTCCAAGGCCTG
GCATCGATGCTGCGAGAGCCGGATCCGATTCTACTCCGTGGTCCGTCGGGTGCTGGGAAAAGCGCCATGGTTCAT
GAAGTTGCGAAACAGCTTGGAAAGTACGACGACATGGTCACGCTGCATCTCAACGAGCAGACTGATGCCAAGACG
CTCATCGGCCTTTACTCGACCAACTCGAAGCCGGGGAACTTCGAATGGCGCCCGGGTGTACTGACCACGGCCGTC
CGTGAAGGAAGATGGGTGCTCATCGAGGACCTGGATCGAGCACCAATCGAGGTCATGAGCATCCTGCTTCCCCTG
ATCGAGCGACGAGAGTTGCTTTTGCCTTCTCGCGGGGTGACATATCCGGCCCCTCGTGACTTTCGTCTCTTTGCA
ACGATCCGGACCGCTTCAGCCATGGATGACGGAGAAAGCCTGCCGAATCTGGTCGGGATGCGACTGTGGAAGTCT
CTCTACGTCACGCCTCAGACAGCCGAGGAGCTGGAAAACGTCATCCTTCATATGTATCCGATTCTGCGGAAATTC
CTACCGGGCATACTCGCCGTGTACCAACGGCTTTCACGGGTGGCGGGAAGCCTTTCCTTCATGTCCCGGGGCAGA
AGCGTCGTCGACCGACAGATCAGCCTGAGGGATCTTCTCAAATGGTGTCGACGACTCGAGGATGGTCTTGTTGGG
GCGGGATCTGTGTCCGGCGATGAGCCCATCAGTGAAGCTACCAGAGACTGCATGTTCATGGACGCGCTGGACTGT
TTCGTGGGGAGCTGCCCAGACGCGTCGCTCGGAAAGGAGCTTGCGTATGCCATTGCTGAAGAGATGCATATATCC
AGAGACAGGGCTGAGCACTACCTTTGCGCCAATATACCTATTTTGGACGATGGTGATGCCATGCTCGGTATTGGT
AGGGCCCGGCTGCGGAAGAATTCATTGTCACGTCGGCTTTCGAGGTCCAAGAGGCCGTTTGCCAGCACAACCCAC
GCCAAGAGACTGCTAGAGCAGATTGCCAGGGCAGTCAAGCTGGAAGAGCCGATCCTCCTCGTCGGTGAGACGGGC
ATCGGAAAAACGACGGTGGTTCAGCAGCTTGCAGAGTCGCTGGGCCACAAACTCATTGCCGTGAATCTCTCGCAG
CAGAGTGAGGCGGGTGATCTTCTCGGAGGTTTCAAGCCCGTCAACGCGCGAAGCCTAGCTACACCCCTGAAGGAA
GAGTTCGAGGCGCTATTCGCGGCAACCGGCATCTCTGCGTCAAAGAATGAAAAGTACCTGGGACAGATCGGCAAG
TCGTTCGCCAAAGGGCAGTGGTCCAGGGTGTCGAAGCTTTGGAGAGAGGCGACGCAAATGTTTGACAGCATCTGC
GAGCAATATCGACGGATGAGCTCCCCGAGTCACGATGACGATGCGCACCCGGCGAAGCGCCGCAAGACGATGTCT
AAGCTTGAGGCCTTGGAGAAGTTGAGGCCGCGATGGTCTGAGTTTTCTCGCAAGCTCGATAGGTTCGATATGCAG
GAATGGGGTGTGTCTGGAAATGTTGCGTTCTCTTTTATCGAGGGCAACTTGGTCAAGGCTATTCGGAACGGTGAC
TGGGTGCTCTTGGATGAGATCAATCTTGCTTCGCCAGACACGCTGGAAACCATTGCCGATCTCCTGACTGGTCCA
GACGAGCGGCCCTCCATCTTACTTGCGGAAACGGGCGATCTCGAGAAAATCGTGGCACATTCCAATTTTCGCATC
TTTGGCGCCATGAATCCTGCAACTGACGTGGGGAAGCGGGATTTGCCCGTGGGCATCAGATCACGGTTCACGGAG
CTCTACGTCAGGAGCCCCGACGCCGACCACAAGGATCTGCTCACCATTGTCAAGGCGTATCTGGGCAGCAGCAGC
GGCGAGATGGACCGGGCGGCCGACGACATGACACGGCTGTACCTCAACACGAAGCGAATGGCGGAAGAGAAGCGG
CTGGTCGACGGAGCCAACGAGGTTCCTCATTTCAGCTTGCGGACGCTGACCCGGGTTTTGAGCTATGTCACCTCG
ATTGCGCCGTTCTATGGCCTTCGTCGTGCTTTGTATGAGGGCTTCTCCATGGGTTTCCTCACGCTGCTGGACAGG
GAGTCCGAGTCGATGCTGCTTCCTCTCATTCATCATCATCTCCTCGATAAGCATGGGAATCCCCAGTCGCTACTC
TCGCAGACACCGCAGCATGCAAAGGACGGGAGACGATACGTCAGGTTCCGGAATCAGAACCGGGATCGCCAGTAC
TGGCTATTGCAAGGCGAGCAGACCCCGATTGAAAGACAGGACTACATCATTACTCCGTTCGTGGAGCGGAACCTC
CTGAACTTGGTTCGAGCGACATCGACCAGGCAATTCCCGATTCTAATACAGGGACCGACGTCTGCCGGCAAAACG
AGCATGATTGAGTATCTGGCCAACTTTAGTGGAAACACCTTTGTCCGCATCAACAACCACGAACACACCGACCTC
CAGGAGTACCTTGGCACGTACGTCTCGGGACCGGACGGCCAGTTGCGTTTTGAAGAAGGTCTTCTCGTTCAGGCC
ATGCGAAAAGGCTACTGGATTGTACTGGACGAGCTCAACCTGGCGCCAACGGAAGTTTTAGAGGCCTTGAATCGT
CTGCTGGATGACAACCGCGAGCTGCTCGTTCCCGAGACCCAAGAGGTTGTCAGACCCCATGACAATTTCATCCTG
TTCGCTACGCAGAATCCGCCGGGTCTTTATGGCGGTCGCAAAGTTCTCTCTCGAGCGTTTCGCAACAGGTTCCTG
GAGCTGCACTTTGACGATATCCCCGAGGATGAGCTGGAGCACATTCTGCAACAACGGTGCCGCAACACTTCACCG
CCGGATTGTCGGCGAATCGTCAACGTTTACAAGGAACTCTCCAGGCTCCGTCAGTCGAGCCGTCTTTTTGAGTCA
AAGGACAGCTTCGCGACTTTGAGAGACCTCTTTCGCTGGGCGCTGAGAGACGCAAACACCAGATACGAGATTGCC
GTTCATGGGATCATGCTGCTGGCAGAGAGGGTTCGCAACGACGAGGAGCGGTCGGCTGTCAAGGAAGTCATCGAA
AAGATTTTCAACATCAAGATTGACCCCGACGAACTCTACTCAGAAACGGTTGCCCCTGAGCTCAAGCGCTTGGTT
GGCGCCCCTAACAGCCAGGACGTGGTTTGGACACATGCCATGCGGCGTCTTTATGTCTTGGTCTGCAGGGCTCTT
CAGAACAATGAACCGGTTCTCCTCGTTGGTGAGACCGGCTGTGGCAAGACTACCGTCTGTCAGATGCTTGCCGAG
GCTGCTGGAAAGCAGCTTGCCATTGTCAACGCGCATCAAAACACGGAGACGGGCGACCTTATAGGCTCGCAGAGA
CCGAATCGGAATCGTGGCGCCGTTCTTGATGCCTTGAGTAACGACCTTGGGTTTATCTTGGAGACGCTCGGGCTG
GACGTTCCCAACTCGGTCGAGGAAAGACTTCAAGCATATCGCGCTCTGCATCCTACGTCACTCACCAAGCTTCCT
TCAGAACTCATCGAACGAGTCTCGGCAAATGAGGCGAAATCCAAGGTTCTTTTCCAGTGGTACGACGGAGCCTTA
GTTGAGGCCATGCGAGAAGGATACTTGTTCCTCCTTGACGAGATTTCACTCGCGGATGACTCGGTCTTGGAGAGA
CTCAACTCAGTTCTCGAGCCCCAGAGGACGCTTCTTTTGGCCGAGAAGGGCATCGATAACCCTACCGTCGTGGCG
TGTGATGGGTTTCAGTTCCTCGCGACCATGAACCCTGGTGGCGACTTTGGAAAGAAAGAGCTTTCACCTGCCCTG
CGTAACCGCTTTACGGAGATCTGGGTTCCGCCGCTGTCGGAGAGCCGCGATATACAAACCATTGTGCAGACGAAA
TTACTTGATGGACGGAAACATCTTGCGGATATCATGGTCCGTTTCGCAACGTGGTTTGGACAGACGTTTCGACCT
ATGGCAACGACGCCCATCTCGGTGCGAGAGCTTCTTGCATGGGTTCAGTTCATCAACTCATCTGATGCGGCCGAT
CCCGTTGAGTCCTTGGTTCATGGAGCGTCTGCGATTTTCATCGACAGTATCGGGGCCAGCCCATCGGCCATGGTT
ACGACTGATCCCAAGGCTATTCACCTGCAGAGACAAGAGTGCCTTCAGATGATTGGTGATATTGCTGGTTGCAAT
GCGCTCGAGGTCCATGGAGCAAACCCCGAGCTCATCATTACCCCCGATTCCTTGATCATCGGCAACTTCAGCGTA
CCCCGGTGCTCAATCAGCGTCAGCGATGCGGGCTTCGCGTTCCAAGCGCCAACGACGAGACTCAACGCCATGAGA
ATCGTGAGAGCCCTTCAGACGCGCAAGCCTATTCTCCTTGAAGGAAACCCTGGCGTCGGCAAGACATCATTAGTG
GCAGCTATATCTCAAGCCTGCGGTCGTCCATTGACACGCATCAACTTGTCGGATCAAACAGACTTGATGGACCTC
TTTGGAACGGATATGCCTGTCGAAGGAGAGGAGGCTGGAAACTTTGCGTGGCGGGATGCACCGTTCTTGCAGGCG
ATGCAAAAGGGCGAATGGGTTCTCCTGGACGAGATGAATCTCGCGTCGCAGTCCGTCTTGGAGGGGCTGAACGCC
TGTCTGGATCATCGGGGAGAGATTTACGTCTCTGAGCTGGACCAGGTATTCAGACGGCATCCCGACTTTAGGCTG
TTTGCCGCTCAGAACCCTCATCATCAAGGCGGGGGCCGCAAGGGCTTGCCAGCCTCCTTTGTGAATCGGTTCATC
GTCGTCTATGCCGATGTTTTTCAAGACGAGGACCTGAAGCTCATCGCGGCTCATAACTTTCCTGGCGTCAACGCC
GAGAACGCTGGCCTCATCATCGACTTCGTCTCTCAGCTTGATCACAAGCTATCTGTTGAGAGAGCTTTTGGACTG
CAAGGCGGGCCCTGGGAGTTCAATTTGCGCGACGTTCTTCGATGGCTGGATTTGCTCGATTGCAATCGTTCGCGG
GAAGTTCGCGTCGATGACTTTCTCCAGATTATCGTTCGTCAACGCTTTCGCACTCAGGAGGATCGAGACCAGGTG
GACAGGCTATTCGGTCAGCTCGCCGGGCGGAAGCCCAGAATGCACTCGCTGTATCACGATGTCAACTCTTCCTTC
AGCCAAGTCGGACAAACTACCGTGCCCAGGAACCCCGAGTATCAGCCTGAAAGGCTTTCGAGCCTGGACACTGTG
GCCATTCTCCCCGAACTGGAGTCTGTGATGATGTGCGTGGAGAAGAAGATGCCCTGCATCCTAAGCGGCCCTTCT
GGCTCTGGGAAGTCTGCTCTTTTGAAATACGCCGCTGCGTTGGCTGGGAAGTCTCTGGTGGTGTTTCCCTTGAAC
GCAGACACCGACACCATGGACCTCGTTGGCGGCTTTGAACAAGCAGATCCACTTCGAGATCTGAACTCGACGTTG
AGATGCCTATGCCGCCGTCTCCAGGAGGTCGAGAGTCGCAGTGCCCCGGCAGAGATGCCTACTCAGGCTTTCGAA
TGCGTGAATCTCCTCGAAAACTACTTCTTGCATGGAGACGATGCTCGTCATGTTGATGCCACGCTGCGTCTTGTT
GATGCCATCTTGGGTCATGTTGAACGTCTCCGCGAGGTTGATGCCAGCATCGGGTCCTGGCTCGACAAGGCGAGG
GAACGACTGAGAGAGCAGGCCATTTCCATCAAGCCAATGTTCAAGTGGCTAGATGGAGTCATCGTCGAAGCTCTT
GAGACGGGGCAGTGGCTCGTACTCGACCACGCTAACCTGTGCAACGCTTCGGTCCTGGACAGACTCAACTCTTTG
CTCGAGCCGAACGGGTTTCTGTGCGTCAACGAGTGTTGCGATCCTGAGGGGAATCCGAAAATGGTCCGGCCTCAT
CCCGAATTCCGGGTATTTCTGACCGTGGACCCGAGTTACGGCGAGCTATCGCGCGCAATGAGGAATCGGGCTATC
GAAGTGAATCTCAGTTCGCGACCTACACCCAGAGATCCTTGCTTCGACAGGATAAGCGAAGTCGAGAGCGGACTG
TGGAGGCTCAGAAACGTCAACGACTTCTGCGAAAGGCTGTCGTCGGAGAGCTGCACTGCGTTGACGCCCGCTGGC
GAGTGTCTGTCTGTCAGAGATGTCGCTCTCCTGCCGCGATTCCTGGAAGGACTGCCGTGTGGCGATGAGCGAAGC
CAGCCGTCTCTGCAAGTCGTGACGGAGTTGATGGGCTTCTTGCGCTCGCCGGCCGGTTCCAGCGATCTTCAAAGA
ATCGAGAATCTCTACTCTACTCTCCCGGAGGCATCACAGTCATTGGCCTCTCATCAGGTTAGTCTGTCCCGAGAA
AAGCAATGAAATGCTTCACTGACACTTATAGCCCATCCACGCGTTGATCAATCCTTACATCTTGGAGCTGCTTCC
CAGTTCGAAGGCGGCAGAGTGGGCCGGCTTGCGATTAGACCACCTGCGCGCTGTTTACGATATAGAGAAGATGTT
TGAACGGCAATGCGGCGGGGCTCATTCGGCAAAGCCTTGGTTGTTGACGCGGTTGCAGCGGTCTTCGATCAGAGA
CCGGGTTACGGCTGTAGCCAAAGACTCGACTGTGCAGCTCTGCTGGTTTATTACTGCTGCCTTGAAGGCCTTGCG
GAATCATCTGGCCATCGATTTCGGCTCTGTGAGTTGCTCAGGGGTAAGAATTTCAGTCTTTGCGAATGAACTTGT
ATGGCTAACTCTGGTCAGCAACGTTCTCATCTCTGCCGATTCGTCATCCATTGGCTCGTTCACACCATTGGTCTC
TCCAGCGAAATGACCTTTAGCGAGGCCAGATTCCAAGCTCACTTGAAACTGGCGGCCGAATACCTGAAGCCTCAG
ACCGAAGCCCTGGGCGATCTGCAGAACTCCGAGTTCTCGACGAAGCTGCTTCGACTGATCAAGGACAACTTCAGC
AGTGGATTCGAACTATCGACAGGACTCAGCATGGAGCGCCTTTGGCTCGTGTTCCGAATCGCTCCGTTTCCTGAC
GAGACCGTCTTCCAACGATCTATGGGACTGGTCAGGCTGGCTGACCGATTTGATGCCATCCGCTGGAAAGCCAGC
GCGTCTATACTCGACTTGGCCAAAGCTCACGAGACGTTCGAACAGGCGTACGCGATTGTGCGGAGTGGACGAGGC
TGCGCGGATGAGCTCGTCAGTGACCTGACAACTGCCATCGGCTCGCTGGAATCCCACATCGGAGACCGGGAGGCC
AATCTGGAGCCATTTTTCGCGAGGGAGTTTGAGTATGTCAGGCAGCTGTCTTTGCTATTCTCTCCCGCCGATGGT
CAGAGCACGCAAGGAAGCAGTTTGGCCGTCTTATCTGGCGCCGCGACCAAAGCCAACATGACGTTTGCCATTGCC
GAAGGTCCTGCTGCTGTTCTGCAGTCTGTCGACCGTCTAGCCTGCCAAGACAGCCATGTTTGGGATGGAAAGCTG
GCAGCGTCTGTTTGGCTGAAGCTGCGGCATCTGGACACCGTTAAGCTTGGTTCACTGTCTCTTCTCGAGTCCGAA
CTGCCCGTTCTTGGGCGATGCATATCCGGACTCGGAAGTGAAATCGCATCTGATCCCCTCATCAAGTTGAACGAG
CTTCTCTGGCAACTGCTGTCGGAAGTTTTCGTTGCTCATGAGCCACAGCTTGGGGAGTTGGTTGCGTCGGCGCGC
TTACTGGCAGTGAAGCATCTGGATTCGGCCTCGAGCGTGACGCGGACTGGACTGGGCGGCGGTTCTTCCCCCTTT
GACGACATTCTCGGCCAGATCAAGATGGACTATCTGCGCCAAATCTCCAGAGACAATCTTATCCCAGCTGTTGTT
GGCATCGCTGCAGCTGAGCATGACGCAGACGAGCGAGCCCATTACTCGGCTTTGGCTTGGATGCAGTTCAGCATC
GGACTGGTGAAGCTATACGTCCCGGACCGCGCCTTTGATCCTCAGCTGCGGCTGCTCGTGGAGCACGAGTTCTTT
GAAGGCCTTCAGATGCGGTTGAGAGAAAAGGTGTCTGCGTTGAGATCCTTCCAGCGGTTCTTTACCGGCCAGGAT
ACGAGCAGGCGGATCGAGTTGCTGGAAGAGGAGATCCTGGAAAGTGAGCGGCCTCGGGGAGACTGTCGGCCTGTG
CATCGACCAGACGTGTCCGAGCTCGATAGACTGCACGTGGAATGCTCAAATGTCCTCAAACTCGTCACTCGAAGT
GGAATTCCGTCACTGTTCCGGCAACTTGGTTCCTCGAGCTCAGCCGAAGAAACCAGCGGGCTTTTGCAGTTCATG
GAACAGAACGTTCAGAGCCTGGTGCACCGGTTTTCTTCACAGTTCGAGGCATATCAGGACGTTACGAGCACGATA
TCGAATGCCCTGCGATGTCTGTTGTTAGGGATTTCTCTCTGTGGTGCAGCTACGGCCAGCAGGTTGCAGACCTCA
ACGAGCCAACTCGTCAACGCCACTCCTTTCTTCGGCGGGAGACGATGGGACGCTCGCATAGGACAGCAGTGCAGG
AAGAGCTTTGAGTATCTCAGTCTCATGAGCGCCGCTGTTGCTGTGGAAGGGGTAGATGGCCTATCGGTTGACTCA
CGCGAGTCCATCTTTGAGTGCTTCCACAGCTTCTACGATGACTGGTGCGACAGACTGGAAGCGGATCGCAAGACA
GAAGAGGCGAGGACGAGCCTGTATCGGTTCTGCGGCTCGTTGGAGGACGAAGAAGAGGTGGACGAGAAGGAGTTT
AACGAGCTGTTTCCGACGTATGACGGAGAAGAGGGCTCGGTGATGAAGCCTTCTACGTCGGTGGAGCAAGTCCGC
AACACTTCCTTGAAGGTGGCAGAAGCACATCGAAACATCTTTCTCGACAGACGGGAGCCGATGACGGCAATTCGA
GAAGCTTGTTTGCTTGTTGGTCAACGGGTGGTTGATGAGACTCGGGAATCTTGCAATGTTGACCGGCAAATCAAC
GCAAGGCTGCTAAGCTCCCTGACTCTTCTTTTCAGTGAGAAGGTGGCCACACTGGACACGACTTGCACCACGGAA
AAGACTGTCAACTTTTACGCGGATCCCAATCTCTCGGAGGCTCGGAAGCTGGTCTCGCTCACGCAGAGGATCAAG
ACGCGGTTCAGAGAGCTGCAAGGCGTGGATGAGATTGGACACATGCAGCCACTGGCCGACGTGGTCGAGTCGTGC
GAGAGGTTGCTTGACCAGGTCCATGCGGAGCCTCTCGCCAAGCTCATACCGAAGGTGGAACAGCTTCACGCTCTT
GTCTACGAGTGGCAGTTTGGCGGATGGGCCAGCAGGGTCCATGCTGTGCTGCCTCTCCACGATGCGCTCACCGAG
ACAATCATCCGCTGGCGACGGCTCGAGCTCGCGACGTGGTCTACCTTGTTTGACATGGAGGAGGAAAAGTGCCGC
AACGATGCTTATTCCTGGTGGTTCGTTGCCTACCAGGTAGTCGTCGCCGGGTCTCTGCCCATGATGGACTCTCCT
TCAGAGCTACGGGAGTATGCAACGTCGTTGGTGAGAAACCTGGAGGGATATCTTTCGAGTTCCTTTGTCGGCCAG
TTCCGGACGCGCGTCGCACTGCTTCGACAGCTGTCGAGCCACCTGCGACTCTTGACCAGGGAACATCCGACCTTG
GCGGTGATATACGAGGCTGTTCAGAACTTTGTCGATTACTTTGCGAGGTTTGAGGTGGCAGCTGACGCGGCTATT
CGAGACGGACGAGGACCGATCGAGAAGAAGATGAAGGAAGTGCTTCTCCTTGCCAGCTGGAAGGATACCAACATC
AATGCTCTCCGTGAGAGTGCCCGCAAGTCTCACCTGAAGCTCTTTAGATTGGTGCGGAAATTTCGTGGTGTCTTG
GGTCAGGACATGAAGGCCATTGTCGACAAAGGCCTTCCCTCCGAGACGTTTGTGTCGAATCAAGTCAACGGCAAG
GTTCAGGCAGCTGGTGTTCCGGACGTGCAAGTTGAGTCGGTGAACGAGATGCTGCCCAACTGGCTGAAGAATCAT
CGGCGGCTTGCCAATGTGACGACGACGGTGTGTGTTCTGGACAAGATTGCGGACGGCCTGGAGGCTACAGACAAG
GCTACGGGGGTCGTCGACGATTTCGTGTCGAGCCTGCTGGCTTCGATGGCTGAGCTGCAACGAGAGACGCCCAAG
GTTATGAGCGATGAGTCCAAGGATCAAGTCAAGCACCTCAAGACGAGAAAGCGGAAACTTTTGGCGGATACGCTG
AGGGATCTGCGAACGATGGGGGTCAGACACAACCTCCCTCAGAACAAGCTGGCCGTTCAAGGGTCACTGGCGATT
ATCCTCGCGACGATGACGCCTGTTGATGCTTCTCGTCTTGCCGGAATGGCCGAAGCCGACTATCTCCTGCATCAA
GTGCTTGATCTCGCACCCAAAGCCAGGGCTGCGGCAGAAGGGCACTCGGAGGATCTGACGAGCCCCGAGGTCGCT
CGATGTGTCGGTCTGGTCGAGGGAATGGTCGAGTTTTGTCTTTCTCAGCGAGACAGCATCGGCCTGGCGAGCAAG
CCCCTTTCTTCGCTGCAGGCTACTGCGGAAGACTTTCGGCGGTTGGGCAACAGTGAGAAGCTTGGGAGGCTTTGT
CGACGCACGCAGCATGAGAATTGGCGCGGTCTTCTCCCTTGGCTGGGGCAGATTCTACGGTTTGCTGCCAAGCTC
GTCCAAGCGCAGGCAAGGCTGGCACAGGGAGACGTCACTGAAGTGGTCCAGAGGCTTGGGGAATGGGCTGCTCGT
GTTGATGCACATCTTGTCGTTGCTGATGACTTGGGGCAGCTGCCAGCTCAGGTGATTTCCGAGGCACACGTTCGG
TTAGAGGCGGCGGTCGCCAAAGACATGGAGTCTCTTCGGAGTGATATTGAGGATCTTGGACGCCAAAGACCAGAA
CTGTCGTTTATCCTGCAGCAAGTGGACGTCTGGACGCGGATCGACAGCCAACAGATGGACACGCCGAACTCGCTG
GTCGAGTTGAAGACGTGGGCGGACGCAGTGTCGACTTTGGTCGATAGTCTGCTGGTTGCTGTTGAAAGCGCCAAG
AGGACAGCATCGGCGTGGGACACCGACGTGGACAAGGCAGGGTGGCTGAGGAGACACAGTGATCTTGTCTGGGCG
TCTGTTCAGCAACTTCATATGGCGGATGTTGACAAGGCGGCCCGTCGTTGCGTGGAACTCATGCAGCATATTGAC
GTGGACGATTCGGCCATCAGCGAGGCGGCAACGAGCATCATCCGGCTGGCGAGCCCGGTCCTCGACAGCTTCCTG
GATCTCTGTCGACAGTGCGTTGACCGTGGCGTGGACTTGCATCGTGCCACGGCTCACATGGCTTCCCGGTTGACG
AGGGCCTTTACGCAGATGGCTTCTCAGGGATTCTGCACTCCGCAGGAGAAGTCGAACGAGTCGGGCGATTCCGGA
CAGCTCGAGTCTGGGACTGGACTGGGTGATGGCCAAGGTGCTGAGGACATAAGCAAAGATATTCAAGCCGACGAG
GATCTTACCGAACTGGCGCAGGAGAAGAACGAAGGCGAAAAGGAGGAGATTGAAGACGAGAAGGATGCAGTTGAC
ATGGCGGATGAGGAGTTGGAAGGGGAGCTCGGGAGCGTCAATGGAGAGCAAGACGATGAGGACGGATCGCAAAAA
GGAGAGGACGGTGAAGATGATGTGGAAGAAGAGGCTGGCGAAGTCGATGATCTCGATCCCACAGCCGTGGACGAA
AAGATGTGGGACGGAGACGATGAGAAAGCCGAAAAGGATCAGCAGGGGAACAAGGCAGCAGGCCGCGAAGAAGAA
GACGAGATGATGGCACCGGAGGAGGCGGAAGGTGAAGAAGAGGAGCAGGATGCAAAAGACGGCAAAGCGGAGGAA
CAAGAGGGCGAAGACGAGCCAGATGCCGAGGAGGAGGGTGTGACGGCTCAGGATGAGATGAACCGGCAAGACCAG
AACGTGGAGGACAAGGACGCGCTGGAGCTGCCGGAGGAGATGGACTTGGATTTTGACGACAAGGCTTCGGTGTCT
TCGGAAGAGGGACTGGATGCCATGTCGATGGCCGAAGAAGAACAAGTCTGCGAGGACGAGGCCAAGGACGAGGAG
ATGGGAGATGACGAGGTCAAGGATGAGGAGATGAAGGACGCGGCGGATCCAGAGACTGGCGAAGAAAGCGATGCA
GAGGCGGAGGGCAAGATGGGCGGTGAAGACGAGGTGGAAGACGAAGTGAAGCCGGAGTCGGAGCCGGAGCCGGAG
CAGGCGAACGACGACGAGGCACCGGTTTCGGCAGACACAGCTCAAGCAGACGCGGAACATGCGGCTCCCAGCGAC
GTCAAGAGTTCCGGGCGAGACCCGACGGCCGACCAGAAGAATTCGGATGAGGCATTCAAGGCTGAAGCGGCGCAG
CAAGACGGCGGAGAGATGGGCGACAGTGCAGCGGATCGCGATGCCAGCGCAGGAAACCAGGGAGCAACTTCTCGC
TCCAAGGAGATTCCGGAAGAGGGAGAGCAGGGCGACAAGGAAGAACAAGACGAGACCAGGGGCAGCAACCCTTTC
CGGAAGCTGGGAGATGCGCTGGAGAAGTGGCATCGACAGCAGGCGGAGATTCAGGGCGCGAGGCCGGACGACGCG
AAACAAGTCGATGGCGACGACGAGTCGAAAGAGCAAGGCCGGCTGGAGTTTGAGCATGTGCAAGACGATGAGGAC
GCGGGCGATACGCAGGCCATGGGCACAGCGCGCGAGGACGAAGTGATTCCTTTGGACGAGTCGATGGCCATTGAT
GAGGACGTCACAGACGGTCAGGGCAAAGCAATGGAGACGGAGAAGGATGACGAAGGTCCTGAAGCAGACGAAATT
GATGAGAAAGGGATGGACGACATTGAGCTTCATGATGAGCAGGGCCTCGACGGCAAGACGGGCGACGCTGGAGAT
GAGCACAGATCCGGACCCGACATCAGACAAGGAAACTTCAACAAAGAAGACGAGCGGGAGGTCACCGAGCAGGAC
GAGACTGAAGAGCCGATACAGCCATCACCAACACAAGCCGAAAGAGAGCCCCGAGACCTGGACGAATGCAGAAGA
CAGTGGACAGAACTAGAGCGCAAGACCCAGGGTCTCTCCCAGTCACTGACATCGCAACTCCGCCTCATCCTCGTC
CCAACACAAGCAACCAAAATGTCGGGCTCCTTCCGAACAGGCAAACGCCTCAACATCAAGCGCATAATCCCCTAC
GTCGCCTCAGGCTACAAGCGCGACAAGATCTGGATGCGACGGAGCGTCCCGACCAAGCGCCAGTACCAAGTCCTC
CTCTGCGTCGACGACAGCAAGAGCATGGGCGAGACGCAGGCGGGGCCCCTGGCGCTCGAGGCGCTCGTCATGGTG
ACGCGGTCGCTGGCCATGCTCGAGGTCGGCGAGGTGGGAGTCGTGGGATTCGGGACGGGGGTCACGGTTGCGCAT
GAGCTGGGCAGGCCGCTGGTCGGCGAGGCGGGGGCGAGGACGCTGCGGGAGTTTGGGTTTCATCAGGAGAGGACT
GATATGGTGTTGCTGCTGAGGCGGACCATGGAGATGCTACGACTCGCCCGCGCGCAGCAGCAATCCTCCCGGTCG
GAGCTCTGGCAACTGGCCCTCATCCTCTCCGACGGGCTGACGCCGTCGTCTGCGCACGAGACGATGCGGCGGCTG
CTGCGGACGGCGACGGAGGAGCGGGTCATGGTGGTGTTTGTGGTGATTGACGGGGGGGGCGGGGTGCTGGATCTC
AAGGAGGCGAGGTTTGTGAGGGGGGAGGATGGGGAGAGCTGTGTTGTTGTTGAGCGCTATCTTGATTCCTTTCCG
TTTGCGTTTTATCTGGTGGTCAGGAGGGTGGAGGAGGTTCCGGGGGCGTTGGGGGGGTTGTTGAGGAGTTGGTTT
GCCGAGGTGGGGTAGGCTGCTAATAGTGGGTAGAGTTGTGGTGATGATGGCTCATGTAGTTTTGAACTGGCATTG
ATTGAATCTGGTGAAGAGTTGCAGAGGGTTGAGTGGTTGATGGTGTGAGTTGCGGTTATCCATGTCACATGTGGT
TGTGGCGTAGTGCGAATAGCCCCTGTTGTACGAATACGAGACAGTTGAGCGGTTGTCGAGGCTAGTTGACGTGGT
TCACTATTCAGAGTTGATGTGGTTGTCCCTGATTGGCCACACAAAGCCATCACCATCAAGTCCCCCTCCACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail