Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5632
Gene name
LocationContig_569:6698..11353
Strand-
Gene length (bp)4655
Transcript length (bp)3831
Coding sequence length (bp)3831
Protein length (aa) 1277

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10433 MMS1_N Mono-functional DNA-alkylating methyl methanesulfonate N-term 8.3E-113 73 591
PF03178 CPSF_A CPSF A subunit region 2.6E-54 805 1109
PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region 1.9E-07 1154 1190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M0V3|DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana GN=DDB1A PE=1 SV=1 3 1115 4.0E-124
sp|O49552|DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana GN=DDB1B PE=2 SV=2 3 1115 9.0E-124
sp|Q6QNU4|DDB1_SOLLC DNA damage-binding protein 1 OS=Solanum lycopersicum GN=DDB1 PE=1 SV=1 3 1115 5.0E-119
sp|Q6E7D1|DDB1_SOLCE DNA damage-binding protein 1 OS=Solanum cheesmaniae GN=DDB1 PE=3 SV=1 3 1115 1.0E-118
sp|Q3U1J4|DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus GN=Ddb1 PE=1 SV=2 3 1111 8.0E-109
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M0V3|DDB1A_ARATH DNA damage-binding protein 1a OS=Arabidopsis thaliana GN=DDB1A PE=1 SV=1 3 1115 4.0E-124
sp|O49552|DDB1B_ARATH DNA damage-binding protein 1b OS=Arabidopsis thaliana GN=DDB1B PE=2 SV=2 3 1115 9.0E-124
sp|Q6QNU4|DDB1_SOLLC DNA damage-binding protein 1 OS=Solanum lycopersicum GN=DDB1 PE=1 SV=1 3 1115 5.0E-119
sp|Q6E7D1|DDB1_SOLCE DNA damage-binding protein 1 OS=Solanum cheesmaniae GN=DDB1 PE=3 SV=1 3 1115 1.0E-118
sp|Q3U1J4|DDB1_MOUSE DNA damage-binding protein 1 OS=Mus musculus GN=Ddb1 PE=1 SV=2 3 1111 8.0E-109
sp|A1A4K3|DDB1_BOVIN DNA damage-binding protein 1 OS=Bos taurus GN=DDB1 PE=1 SV=1 3 1111 3.0E-108
sp|P33194|DDB1_CHLAE DNA damage-binding protein 1 OS=Chlorocebus aethiops GN=DDB1 PE=1 SV=1 3 1111 4.0E-108
sp|Q16531|DDB1_HUMAN DNA damage-binding protein 1 OS=Homo sapiens GN=DDB1 PE=1 SV=1 3 1111 1.0E-107
sp|Q5R649|DDB1_PONAB DNA damage-binding protein 1 OS=Pongo abelii GN=DDB1 PE=2 SV=1 3 1111 1.0E-107
sp|Q805F9|DDB1_CHICK DNA damage-binding protein 1 OS=Gallus gallus GN=DDB1 PE=1 SV=1 3 1111 1.0E-107
sp|Q6P6Z0|DDB1_XENLA DNA damage-binding protein 1 OS=Xenopus laevis GN=ddb1 PE=2 SV=1 3 1111 3.0E-105
sp|Q9ESW0|DDB1_RAT DNA damage-binding protein 1 OS=Rattus norvegicus GN=Ddb1 PE=1 SV=1 3 1111 3.0E-104
sp|Q9XYZ5|DDB1_DROME DNA damage-binding protein 1 OS=Drosophila melanogaster GN=pic PE=1 SV=1 3 1111 1.0E-87
sp|O13807|DDB1_SCHPO DNA damage-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ddb1 PE=1 SV=1 1 1109 6.0E-83
sp|B0M0P5|DDB1_DICDI DNA damage-binding protein 1 OS=Dictyostelium discoideum GN=repE PE=1 SV=1 3 1108 3.0E-82
sp|P07056|UCRI_NEUCR Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06606 PE=3 SV=1 1118 1260 1.0E-61
sp|Q21554|DDB1_CAEEL DNA damage-binding protein 1 OS=Caenorhabditis elegans GN=ddb-1 PE=1 SV=2 1 1116 4.0E-50
sp|Q09154|UCRI_SCHPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rip1 PE=2 SV=2 1125 1260 2.0E-47
sp|P08067|UCRI_YEAST Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIP1 PE=1 SV=1 1159 1260 1.0E-41
sp|Q69BK5|UCRI_PANTR Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Pan troglodytes GN=UQCRFS1 PE=3 SV=1 1095 1260 8.0E-32
sp|Q69BK6|UCRI_PANPA Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Pan paniscus GN=UQCRFS1 PE=3 SV=1 1095 1260 8.0E-32
sp|Q69BK3|UCRI_PONPY Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Pongo pygmaeus GN=UQCRFS1 PE=3 SV=1 1140 1260 8.0E-32
sp|Q69BK4|UCRI_GORGO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Gorilla gorilla gorilla GN=UQCRFS1 PE=3 SV=1 1095 1260 9.0E-32
sp|P47985|UCRI_HUMAN Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens GN=UQCRFS1 PE=1 SV=2 1140 1260 9.0E-32
sp|Q69BJ7|UCRI_SAISC Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saimiri sciureus GN=UQCRFS1 PE=3 SV=1 1140 1260 1.0E-31
sp|Q69BJ8|UCRI_LAGLA Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Lagothrix lagotricha GN=UQCRFS1 PE=3 SV=1 1140 1260 2.0E-31
sp|Q69BJ6|UCRI_SYMSY Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Symphalangus syndactylus GN=UQCRFS1 PE=3 SV=1 1140 1260 2.0E-31
sp|Q5ZLR5|UCRI_CHICK Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Gallus gallus GN=UQCRFS1 PE=1 SV=1 1140 1260 2.0E-31
sp|Q69BK0|UCRI_COLPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Colobus polykomos GN=UQCRFS1 PE=3 SV=1 1140 1260 3.0E-31
sp|Q69BK2|UCRI_THEGE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Theropithecus gelada GN=UQCRFS1 PE=3 SV=1 1095 1260 3.0E-31
sp|P0C7P4|UCRIL_HUMAN Putative cytochrome b-c1 complex subunit Rieske-like protein 1 OS=Homo sapiens GN=UQCRFS1P1 PE=5 SV=1 1140 1260 4.0E-31
sp|Q69BJ9|UCRI_AOTAZ Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Aotus azarae GN=UQCRFS1 PE=3 SV=1 1140 1260 4.0E-31
sp|Q69BK1|UCRI_CHLAE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Chlorocebus aethiops GN=UQCRFS1 PE=3 SV=1 1140 1260 1.0E-30
sp|Q9CR68|UCRI_MOUSE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Mus musculus GN=Uqcrfs1 PE=1 SV=1 1140 1260 5.0E-30
sp|P20788|UCRI_RAT Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Rattus norvegicus GN=Uqcrfs1 PE=1 SV=2 1140 1260 2.0E-29
sp|P13272|UCRI_BOVIN Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Bos taurus GN=UQCRFS1 PE=1 SV=3 1140 1260 2.0E-29
sp|P37841|UCRI_SOLTU Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Solanum tuberosum GN=FES1 PE=1 SV=1 1151 1260 8.0E-26
sp|P51133|UCRI3_TOBAC Cytochrome b-c1 complex subunit Rieske-3, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 1151 1260 1.0E-25
sp|P51134|UCRI4_TOBAC Cytochrome b-c1 complex subunit Rieske-4, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 1151 1260 1.0E-25
sp|P51135|UCRI5_TOBAC Cytochrome b-c1 complex subunit Rieske-5, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 1151 1260 1.0E-25
sp|P49729|UCRI1_TOBAC Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (Fragment) OS=Nicotiana tabacum PE=2 SV=1 1151 1260 1.0E-25
sp|P51132|UCRI2_TOBAC Cytochrome b-c1 complex subunit Rieske-2, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 1151 1260 1.0E-25
sp|P49727|UCRI_MAIZE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Zea mays PE=2 SV=1 1151 1260 3.0E-25
sp|P23136|UCRI_RHORU Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rhodospirillum rubrum GN=petA PE=1 SV=2 1161 1260 6.0E-25
sp|Q4UKR6|UCRI_RICFE Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=petA PE=3 SV=1 1161 1260 2.0E-17
sp|Q92IR2|UCRI_RICCN Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=petA PE=3 SV=1 1161 1260 3.0E-16
sp|P51130|UCRI_BRADU Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=petA PE=2 SV=1 1181 1260 2.0E-15
sp|Q1RIA5|UCRI_RICBR Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia bellii (strain RML369-C) GN=petA PE=3 SV=1 1161 1260 5.0E-15
sp|P81380|UCRI_BLAVI Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Blastochloris viridis GN=petA PE=3 SV=2 1181 1272 8.0E-14
sp|D5ANZ2|UCRI_RHOCB Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=petA PE=3 SV=1 1161 1260 1.0E-12
sp|Q9ZDQ5|UCRI_RICPR Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia prowazekii (strain Madrid E) GN=petA PE=3 SV=1 1184 1260 1.0E-12
sp|P05417|UCRI_PARDE Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Paracoccus denitrificans GN=petA PE=1 SV=1 1182 1260 2.0E-12
sp|P0CY48|UCRI_RHOCA Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rhodobacter capsulatus GN=petA PE=1 SV=1 1161 1260 2.0E-12
sp|Q68XA0|UCRI_RICTY Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=petA PE=3 SV=1 1184 1260 5.0E-12
sp|O31214|UCRI_ALLVD Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=petA PE=3 SV=2 1144 1260 1.0E-08
sp|Q02762|UCRI_RHOSH Ubiquinol-cytochrome c reductase iron-sulfur subunit OS=Rhodobacter sphaeroides GN=petA PE=1 SV=1 1182 1260 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008121 ubiquinol-cytochrome-c reductase activity Yes
GO:0005634 nucleus Yes
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0043231 intracellular membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0043227 membrane-bounded organelle No
GO:0003824 catalytic activity No
GO:0008324 cation transmembrane transporter activity No
GO:0097159 organic cyclic compound binding No
GO:0015453 oxidoreduction-driven active transmembrane transporter activity No
GO:0043229 intracellular organelle No
GO:0043226 organelle No
GO:0022804 active transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0009055 electron transfer activity No
GO:0003674 molecular_function No
GO:0022853 active ion transmembrane transporter activity No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No
GO:0016679 oxidoreductase activity, acting on diphenols and related substances as donors No
GO:0015078 proton transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5632
MAYVAPVHKPTSIRHALRIRFLSPDHEDLVLAKANRLEIWRVSGDGMVLLHTKLIYGTISMMQRLQPRDSDTDLL
FIGTDRLQYFNLSWDPDTNQLDTVEQAIEDVAEPFMRHAQSQNKCLVDPSGKFMAMHLWEGVFNVFRLPARKGNT
NKLVALETVRLTELWIKSSTFLHSRTGHPMVALLYREHEDRDEARIAVYRLTKDDRGDDVSAFDPKKDRELDEVI
QDPFASMLIPVPVAEEKRYHVRNNDKARAHLGGVLVVGETLLTYFDTLTYLGVSSALKEPKIYVAWADYDGIQYF
LADDYGRMDILTIRTTVEPTGVVVTGMDVTPMTFADGTKRTSRAYKLVYLGNNILFLASHHGDSQLLRIDIVSGT
MVLLKTLSNNSPIMDFAIMDMGNREGDLQLGGAFSSGQARIVAGCGAYGDGSLRSIRSGVGLEDEGMLDEFQGTR
GLFTLKSFGAPNHDTIVLSFIAETRVLRFDAKGGIEEVYEFQGLAFNQETLLAANIPTGQVLQITPNSVRLLDPE
SGIALSTWDVPNGGTITAASANSTWALVAVNGTSLLSLNLLSNLTAITSDAACCPTTGQPDQISCLYVTREPMDL
GVVGWWSGGSISVVDPKSLKPIHGEPLRQTEDSASVPRGLALVQLHPPDVSGPTLLVAMEDGNVVTFNVRIDQFA
LSGRKSVTLGSSPARLHVLPQDDGICNVFATTEHSSLIYSAEGRIVYSATTADDATYVARFDSEAFPDSMVLSTD
EHVRLCHLDKERLTHVKTLPMHETVRRVAYSPGLKAFGLGCIKKELVGNEETITSTFKLVDEIIFQPLGKPFVLD
ASATLEMVECVIRAELPDSAGTPAERFIVGTSSISDETSVESETQGRILVLGVSEDRQVYQIVSQKLKGACRCLG
VMGHDIVAGLSKTVVVYSYTEDTKASGTLQKLAAYRPATFPVDLDISGNMIGIVDLMQSLSIVEYTAPLDGAKAK
LEERARHYQPAWATSVCHLDDDRWLEADAQGNVMVLRRNLEGATDQDRSRLEVTSEMSLGEQINRIRRLYVSPSE
NAVVHPRAFFGSVEGTLYLYGDISPKYQDLLLTFQSKLKDYIYAPGNTDFDAWRAFRNQAREGEAPYRSTARATF
TSPLRATDSEKGSAVPDFGKYVSGKGEGMNKLVSYFMVGAMGAMTAAGAKSTVQEFLVNMSASADVLAMAKVEVD
LNAIPEGKNVIIKWRGKPVFIRHRTSSEIEQANKVDVASLRDPQTDDDRVQRPEWLVMLGESPLVIFQGNWNVLK
Y*
Coding >Ophun1|5632
ATGGCGTACGTCGCACCGGTCCACAAGCCGACCAGCATCCGCCACGCTCTGCGCATCAGGTTTCTGTCCCCGGAT
CACGAGGACCTCGTCCTGGCAAAGGCGAATCGACTAGAGATATGGCGCGTCTCCGGCGATGGCATGGTGCTGTTG
CACACGAAGCTCATCTACGGCACCATATCTATGATGCAGAGACTACAGCCCCGGGACTCGGACACTGACCTCCTC
TTTATCGGGACCGACAGGCTGCAGTACTTCAACCTCTCCTGGGACCCCGACACAAACCAGCTTGACACGGTCGAG
CAGGCCATAGAAGACGTCGCCGAACCCTTTATGCGCCATGCCCAGAGTCAAAACAAGTGTCTCGTCGATCCTTCG
GGCAAGTTTATGGCCATGCATCTCTGGGAGGGCGTCTTCAACGTCTTCCGCCTGCCCGCCCGCAAGGGAAACACA
AACAAGCTCGTCGCTCTCGAAACTGTCCGATTGACGGAGCTGTGGATAAAGTCGAGCACGTTTCTGCACAGTCGC
ACCGGTCACCCGATGGTGGCCTTGCTTTACAGAGAGCACGAGGACAGGGATGAGGCCCGCATCGCCGTCTACCGG
CTGACCAAAGACGACCGAGGCGACGACGTCTCCGCCTTTGACCCTAAGAAGGACAGAGAGCTCGACGAGGTTATC
CAAGACCCTTTTGCTTCCATGTTGATCCCGGTGCCCGTGGCCGAGGAGAAGAGATATCACGTCCGCAATAACGAC
AAGGCCCGGGCCCATCTCGGCGGCGTCTTGGTCGTTGGCGAGACGCTTCTCACGTATTTTGATACCCTCACCTAT
CTAGGTGTTTCGTCGGCCCTCAAGGAGCCAAAGATCTATGTTGCCTGGGCCGACTACGACGGCATTCAATACTTC
CTGGCCGACGATTATGGTCGCATGGACATCTTGACAATCAGGACCACCGTGGAACCGACCGGTGTCGTCGTCACC
GGCATGGATGTTACCCCCATGACATTTGCCGACGGCACGAAGCGCACATCACGAGCCTACAAGCTTGTTTATCTG
GGTAACAACATCCTATTCCTGGCTTCGCACCACGGCGACTCGCAGCTGTTGCGCATCGACATCGTCTCTGGCACC
ATGGTCCTACTCAAGACACTATCCAACAACTCTCCCATCATGGACTTTGCCATCATGGATATGGGCAACAGAGAA
GGCGATCTTCAGTTGGGCGGCGCCTTCTCGTCTGGCCAGGCGAGGATCGTCGCAGGATGCGGCGCATACGGGGAC
GGGAGTTTGCGCAGTATACGGAGTGGCGTCGGACTCGAAGACGAGGGTATGTTGGATGAGTTTCAGGGAACAAGG
GGACTCTTTACCCTCAAATCATTCGGCGCGCCAAATCACGACACCATTGTACTGTCGTTTATTGCCGAGACGAGG
GTCCTGAGGTTTGATGCCAAAGGCGGCATAGAAGAAGTTTACGAGTTCCAGGGCCTGGCGTTCAACCAGGAGACG
CTCTTGGCGGCGAACATACCGACCGGCCAAGTACTTCAGATCACGCCGAACTCTGTCCGGCTGCTGGATCCCGAG
AGCGGCATCGCGCTCAGTACATGGGATGTGCCAAACGGCGGCACCATCACGGCGGCATCCGCGAATTCCACGTGG
GCTCTGGTCGCTGTCAACGGCACCTCGCTCTTGTCCCTGAACCTGCTGAGCAATCTCACGGCCATAACCAGCGAC
GCTGCCTGTTGCCCTACCACGGGGCAGCCGGACCAGATATCATGTCTCTATGTGACGCGGGAACCCATGGATCTG
GGCGTGGTTGGTTGGTGGTCCGGCGGCTCCATCTCCGTCGTCGACCCAAAGTCCCTGAAGCCCATCCATGGTGAG
CCCCTGAGGCAGACCGAGGACAGTGCTTCGGTTCCGCGAGGCCTGGCATTGGTCCAACTGCACCCGCCGGACGTT
TCCGGACCGACCCTTCTCGTGGCGATGGAGGACGGCAACGTGGTGACGTTCAACGTACGGATCGACCAATTTGCG
TTGTCGGGTCGCAAAAGCGTCACTCTCGGCAGCAGCCCGGCCAGGTTGCATGTCCTGCCGCAAGACGACGGCATC
TGCAACGTGTTTGCGACGACGGAGCATTCGAGCCTCATCTACAGCGCCGAAGGCAGGATCGTCTATTCGGCGACG
ACGGCAGACGATGCCACGTACGTGGCTCGTTTCGACTCTGAGGCCTTTCCCGACTCGATGGTGCTGTCGACGGAC
GAGCACGTGAGACTCTGCCACCTCGACAAGGAGCGACTCACACACGTCAAGACGCTCCCGATGCACGAAACGGTG
CGAAGGGTGGCTTATTCGCCGGGGCTCAAGGCCTTTGGTCTCGGCTGCATCAAAAAGGAGCTGGTGGGCAACGAA
GAGACCATTACAAGCACGTTCAAGCTTGTCGACGAAATCATATTCCAGCCGCTTGGAAAGCCATTCGTTCTAGAC
GCCTCGGCCACTCTCGAAATGGTCGAGTGCGTGATCCGGGCGGAATTGCCGGACAGCGCCGGTACGCCAGCAGAA
CGCTTCATCGTCGGGACAAGCTCCATCTCGGACGAGACGTCGGTAGAGAGCGAGACGCAGGGTCGCATTCTCGTG
CTCGGAGTGAGTGAGGATCGGCAGGTGTATCAGATCGTGTCACAAAAGCTCAAGGGCGCGTGTCGCTGCCTCGGC
GTCATGGGCCACGACATCGTCGCCGGCCTGTCCAAGACGGTCGTCGTTTACAGCTACACGGAAGATACGAAGGCA
TCGGGAACGCTGCAGAAGCTCGCTGCATATCGGCCGGCTACCTTTCCGGTTGACTTGGATATATCAGGCAACATG
ATAGGCATCGTCGACCTCATGCAGTCGCTGTCGATTGTGGAATATACGGCGCCGCTGGACGGGGCCAAGGCCAAG
CTGGAAGAGCGAGCGAGACACTATCAGCCGGCCTGGGCGACCTCTGTGTGCCATCTGGATGACGACAGGTGGCTC
GAGGCGGACGCGCAGGGCAACGTAATGGTCTTGAGGCGGAACCTGGAGGGGGCGACGGACCAGGACAGGAGTCGG
CTCGAGGTGACGAGCGAGATGAGCCTGGGAGAGCAGATCAATCGGATCCGGAGGCTTTACGTGTCTCCGTCCGAG
AATGCCGTGGTGCACCCGAGGGCATTTTTCGGATCGGTCGAGGGCACGCTCTACCTCTACGGCGACATCTCGCCC
AAGTACCAGGACCTGCTTCTGACGTTTCAGTCGAAGCTGAAGGATTACATCTACGCGCCGGGCAACACGGACTTT
GACGCCTGGCGGGCCTTTCGCAACCAGGCGCGGGAGGGGGAGGCGCCGTACCGCAGCACCGCCCGCGCGACCTTT
ACCAGTCCCCTGCGCGCAACCGACTCGGAAAAGGGCAGCGCGGTGCCGGACTTTGGGAAATATGTCTCCGGCAAG
GGCGAGGGCATGAACAAGCTGGTCTCGTACTTTATGGTGGGAGCCATGGGCGCCATGACGGCCGCGGGGGCCAAG
AGTACGGTTCAGGAGTTCTTGGTTAACATGTCTGCTTCGGCGGATGTGTTGGCCATGGCAAAGGTTGAGGTTGAT
CTCAACGCCATTCCCGAGGGCAAGAACGTCATCATCAAATGGCGCGGCAAACCCGTCTTCATCCGCCACCGCACC
TCTTCCGAAATCGAACAAGCCAACAAAGTCGACGTCGCGAGCCTTCGAGACCCGCAGACGGATGACGACCGCGTC
CAGCGGCCTGAATGGCTCGTCATGCTCGGTGAGAGCCCGCTCGTCATCTTCCAAGGGAATTGGAACGTTTTGAAA
TATTGA
Transcript >Ophun1|5632
ATGGCGTACGTCGCACCGGTCCACAAGCCGACCAGCATCCGCCACGCTCTGCGCATCAGGTTTCTGTCCCCGGAT
CACGAGGACCTCGTCCTGGCAAAGGCGAATCGACTAGAGATATGGCGCGTCTCCGGCGATGGCATGGTGCTGTTG
CACACGAAGCTCATCTACGGCACCATATCTATGATGCAGAGACTACAGCCCCGGGACTCGGACACTGACCTCCTC
TTTATCGGGACCGACAGGCTGCAGTACTTCAACCTCTCCTGGGACCCCGACACAAACCAGCTTGACACGGTCGAG
CAGGCCATAGAAGACGTCGCCGAACCCTTTATGCGCCATGCCCAGAGTCAAAACAAGTGTCTCGTCGATCCTTCG
GGCAAGTTTATGGCCATGCATCTCTGGGAGGGCGTCTTCAACGTCTTCCGCCTGCCCGCCCGCAAGGGAAACACA
AACAAGCTCGTCGCTCTCGAAACTGTCCGATTGACGGAGCTGTGGATAAAGTCGAGCACGTTTCTGCACAGTCGC
ACCGGTCACCCGATGGTGGCCTTGCTTTACAGAGAGCACGAGGACAGGGATGAGGCCCGCATCGCCGTCTACCGG
CTGACCAAAGACGACCGAGGCGACGACGTCTCCGCCTTTGACCCTAAGAAGGACAGAGAGCTCGACGAGGTTATC
CAAGACCCTTTTGCTTCCATGTTGATCCCGGTGCCCGTGGCCGAGGAGAAGAGATATCACGTCCGCAATAACGAC
AAGGCCCGGGCCCATCTCGGCGGCGTCTTGGTCGTTGGCGAGACGCTTCTCACGTATTTTGATACCCTCACCTAT
CTAGGTGTTTCGTCGGCCCTCAAGGAGCCAAAGATCTATGTTGCCTGGGCCGACTACGACGGCATTCAATACTTC
CTGGCCGACGATTATGGTCGCATGGACATCTTGACAATCAGGACCACCGTGGAACCGACCGGTGTCGTCGTCACC
GGCATGGATGTTACCCCCATGACATTTGCCGACGGCACGAAGCGCACATCACGAGCCTACAAGCTTGTTTATCTG
GGTAACAACATCCTATTCCTGGCTTCGCACCACGGCGACTCGCAGCTGTTGCGCATCGACATCGTCTCTGGCACC
ATGGTCCTACTCAAGACACTATCCAACAACTCTCCCATCATGGACTTTGCCATCATGGATATGGGCAACAGAGAA
GGCGATCTTCAGTTGGGCGGCGCCTTCTCGTCTGGCCAGGCGAGGATCGTCGCAGGATGCGGCGCATACGGGGAC
GGGAGTTTGCGCAGTATACGGAGTGGCGTCGGACTCGAAGACGAGGGTATGTTGGATGAGTTTCAGGGAACAAGG
GGACTCTTTACCCTCAAATCATTCGGCGCGCCAAATCACGACACCATTGTACTGTCGTTTATTGCCGAGACGAGG
GTCCTGAGGTTTGATGCCAAAGGCGGCATAGAAGAAGTTTACGAGTTCCAGGGCCTGGCGTTCAACCAGGAGACG
CTCTTGGCGGCGAACATACCGACCGGCCAAGTACTTCAGATCACGCCGAACTCTGTCCGGCTGCTGGATCCCGAG
AGCGGCATCGCGCTCAGTACATGGGATGTGCCAAACGGCGGCACCATCACGGCGGCATCCGCGAATTCCACGTGG
GCTCTGGTCGCTGTCAACGGCACCTCGCTCTTGTCCCTGAACCTGCTGAGCAATCTCACGGCCATAACCAGCGAC
GCTGCCTGTTGCCCTACCACGGGGCAGCCGGACCAGATATCATGTCTCTATGTGACGCGGGAACCCATGGATCTG
GGCGTGGTTGGTTGGTGGTCCGGCGGCTCCATCTCCGTCGTCGACCCAAAGTCCCTGAAGCCCATCCATGGTGAG
CCCCTGAGGCAGACCGAGGACAGTGCTTCGGTTCCGCGAGGCCTGGCATTGGTCCAACTGCACCCGCCGGACGTT
TCCGGACCGACCCTTCTCGTGGCGATGGAGGACGGCAACGTGGTGACGTTCAACGTACGGATCGACCAATTTGCG
TTGTCGGGTCGCAAAAGCGTCACTCTCGGCAGCAGCCCGGCCAGGTTGCATGTCCTGCCGCAAGACGACGGCATC
TGCAACGTGTTTGCGACGACGGAGCATTCGAGCCTCATCTACAGCGCCGAAGGCAGGATCGTCTATTCGGCGACG
ACGGCAGACGATGCCACGTACGTGGCTCGTTTCGACTCTGAGGCCTTTCCCGACTCGATGGTGCTGTCGACGGAC
GAGCACGTGAGACTCTGCCACCTCGACAAGGAGCGACTCACACACGTCAAGACGCTCCCGATGCACGAAACGGTG
CGAAGGGTGGCTTATTCGCCGGGGCTCAAGGCCTTTGGTCTCGGCTGCATCAAAAAGGAGCTGGTGGGCAACGAA
GAGACCATTACAAGCACGTTCAAGCTTGTCGACGAAATCATATTCCAGCCGCTTGGAAAGCCATTCGTTCTAGAC
GCCTCGGCCACTCTCGAAATGGTCGAGTGCGTGATCCGGGCGGAATTGCCGGACAGCGCCGGTACGCCAGCAGAA
CGCTTCATCGTCGGGACAAGCTCCATCTCGGACGAGACGTCGGTAGAGAGCGAGACGCAGGGTCGCATTCTCGTG
CTCGGAGTGAGTGAGGATCGGCAGGTGTATCAGATCGTGTCACAAAAGCTCAAGGGCGCGTGTCGCTGCCTCGGC
GTCATGGGCCACGACATCGTCGCCGGCCTGTCCAAGACGGTCGTCGTTTACAGCTACACGGAAGATACGAAGGCA
TCGGGAACGCTGCAGAAGCTCGCTGCATATCGGCCGGCTACCTTTCCGGTTGACTTGGATATATCAGGCAACATG
ATAGGCATCGTCGACCTCATGCAGTCGCTGTCGATTGTGGAATATACGGCGCCGCTGGACGGGGCCAAGGCCAAG
CTGGAAGAGCGAGCGAGACACTATCAGCCGGCCTGGGCGACCTCTGTGTGCCATCTGGATGACGACAGGTGGCTC
GAGGCGGACGCGCAGGGCAACGTAATGGTCTTGAGGCGGAACCTGGAGGGGGCGACGGACCAGGACAGGAGTCGG
CTCGAGGTGACGAGCGAGATGAGCCTGGGAGAGCAGATCAATCGGATCCGGAGGCTTTACGTGTCTCCGTCCGAG
AATGCCGTGGTGCACCCGAGGGCATTTTTCGGATCGGTCGAGGGCACGCTCTACCTCTACGGCGACATCTCGCCC
AAGTACCAGGACCTGCTTCTGACGTTTCAGTCGAAGCTGAAGGATTACATCTACGCGCCGGGCAACACGGACTTT
GACGCCTGGCGGGCCTTTCGCAACCAGGCGCGGGAGGGGGAGGCGCCGTACCGCAGCACCGCCCGCGCGACCTTT
ACCAGTCCCCTGCGCGCAACCGACTCGGAAAAGGGCAGCGCGGTGCCGGACTTTGGGAAATATGTCTCCGGCAAG
GGCGAGGGCATGAACAAGCTGGTCTCGTACTTTATGGTGGGAGCCATGGGCGCCATGACGGCCGCGGGGGCCAAG
AGTACGGTTCAGGAGTTCTTGGTTAACATGTCTGCTTCGGCGGATGTGTTGGCCATGGCAAAGGTTGAGGTTGAT
CTCAACGCCATTCCCGAGGGCAAGAACGTCATCATCAAATGGCGCGGCAAACCCGTCTTCATCCGCCACCGCACC
TCTTCCGAAATCGAACAAGCCAACAAAGTCGACGTCGCGAGCCTTCGAGACCCGCAGACGGATGACGACCGCGTC
CAGCGGCCTGAATGGCTCGTCATGCTCGGTGAGAGCCCGCTCGTCATCTTCCAAGGGAATTGGAACGTTTTGAAA
TATTGA
Gene >Ophun1|5632
ATGGCGTACGTCGCACCGGTCCACAAGCCGACCAGCATCCGCCACGCTCTGCGCATCAGGTTTCTGTCCCCGGAT
CACGAGGACCTCGTCCTGGCGTATGTCTCCGCCTCTCCCCTCAGACCAAAGCTGACGTCCCGGCAGAAAGGCGAA
TCGACTAGAGATATGGCGCGTCTCCGGCGATGGCATGGTGCTGTTGCACACGAAGCTCATCTACGGCACCATATC
TATGATGCAGAGACTACAGCCCCGGGACTCGGACACTGACCTCCTCTTTATCGGGACCGACAGGCTGCAGTACTT
CAACCTCTCCTGGGACCCCGACACAAACCAGCTTGACACGGTCGAGCAGGCCATAGAAGACGTCGCCGAACCCTT
TATGCGCCATGCCCAGAGTCAAAACAAGTGTCTCGTCGATCCTTCGGGCAAGTTTATGGCCATGCATCTCTGGGA
GGGCGTCTTCAACGTCTTCCGCCTGCCCGCCCGCAAGGGAAACACAAACAAGCTCGTCGCTCTCGAAACTGTCCG
ATTGACGGAGCTGTGGATAAAGTCGAGCACGTTTCTGCACAGTCGCACCGGTCACCCGATGGTGGCCTTGCTTTA
CAGAGAGCACGAGGACAGGGATGAGGCCCGCATCGCCGTCTACCGGCTGACCAAAGACGACCGAGGCGACGACGT
CTCCGCCTTTGACCCTAAGAAGGACAGAGAGCTCGACGAGGTTATCCAAGACCCTTTTGCTTCCATGTTGATCCC
GGTGCCCGTGGCCGAGGAGAAGAGATATCACGTCCGCAATAACGACAAGGCCCGGGCCCATCTCGGCGGCGTCTT
GGTCGTTGGCGAGACGCTTCTCACGTATTTTGATACCCTCACCTATCTAGGTGTTTCGTCGGCCCTCAAGGAGCC
AAAGATCTATGTTGCCTGGGCCGACTACGACGGCATTCAATACTTCCTGGCCGACGATTATGGTCGCATGGACAT
CTTGACAATCAGGACCACCGTGGAACCGACCGGTGTCGTCGTCACCGGCATGGATGTTACCCCCATGACATTTGC
CGACGGCACGAAGCGCACATCACGAGCCTACAAGCTTGTTTATCTGGGTAACAACATCCTATTCCTGGCTTCGCA
CCACGGCGACTCGCAGCTGTTGCGCATCGACATCGTCTCTGGCACCATGGTCCTACTCAAGACACTATCCAACAA
CTCTCCCATCATGGACTTTGCCATCATGGATATGGGCAACAGAGAAGGCGATCTTCAGTTGGGCGGCGCCTTCTC
GTCTGGCCAGGCGAGGATCGTCGCAGGATGCGGCGCATACGGGGACGGGAGTTTGCGCAGTATACGGAGTGGCGT
CGGACTCGAAGACGAGGGTATGTTGGATGAGTTTCAGGGAACAAGGGGACTCTTTACCCTCAAATCATTCGGCGC
GCCAAATCACGACACCATTGTACTGTCGTTTATTGCCGAGACGAGGGTCCTGAGGTTTGATGCCAAAGGCGGCAT
AGAAGAAGTTTACGAGTTCCAGGGCCTGGCGTTCAACCAGGAGACGCTCTTGGCGGCGAACATACCGACCGGCCA
AGTACTTCAGATCACGCCGAACTCTGTCCGGCTGCTGGATCCCGAGAGCGGCATCGCGCTCAGTACATGGGATGT
GCCAAACGGCGGCACCATCACGGCGGCATCCGCGAATTCCACGTGGGCTCTGGTCGCTGTCAACGGCACCTCGCT
CTTGTCCCTGAACCTGCTGAGCAATCTCACGGCCATAACCAGCGACGCTGCCTGTTGCCCTACCACGGGGCAGCC
GGACCAGATATCATGTCTCTATGTGACGCGGGAACCCATGGATCTGGGCGTGGTTGGTTGGTGGTCCGGCGGCTC
CATCTCCGTCGTCGACCCAAAGTCCCTGAAGCCCATCCATGGTGAGCCCCTGAGGCAGACCGAGGACAGTGCTTC
GGTTCCGCGAGGCCTGGCATTGGTCCAACTGCACCCGCCGGACGTTTCCGGACCGACCCTTCTCGTGGCGATGGA
GGACGGCAACGTGGTGACGTTCAACGTACGGATCGACCAATTTGCGTTGTCGGGTCGCAAAAGCGTCACTCTCGG
CAGCAGCCCGGCCAGGTTGCATGTCCTGCCGCAAGACGACGGCATCTGCAACGTGTTTGCGACGACGGAGCATTC
GAGCCTCATCTACAGCGCCGAAGGCAGGATCGTCTATTCGGCGACGACGGCAGACGATGCCACGTACGTGGCTCG
TTTCGACTCTGAGGCCTTTCCCGACTCGATGGTGCTGTCGACGGACGAGCACGTGAGACTCTGCCACCTCGACAA
GGAGCGACTCACACACGTCAAGACGCTCCCGATGCACGAAACGGTGCGAAGGGTGGCTTATTCGCCGGGGCTCAA
GGCCTTTGGTCTCGGCTGCATCAAAAAGGAGCTGGTGGGCAACGAAGAGACCATTACAAGCACGTTCAAGCTTGT
CGACGAAATCATATTCCAGCCGCTTGGAAAGCCATTCGTTCTAGACGCCTCGGCCACTCTCGAAATGGTCGAGTG
CGTGATCCGGGCGGAATTGCCGGACAGCGCCGGTACGCCAGCAGAACGCTTCATCGTCGGGACAAGCTCCATCTC
GGACGAGACGTCGGTAGAGAGCGAGACGCAGGGTCGCATTCTCGTGCTCGGAGTGAGTGAGGATCGGCAGGTGTA
TCAGATCGTGTCACAAAAGCTCAAGGGCGCGTGTCGCTGCCTCGGCGTCATGGGCCACGACATCGTCGCCGGCCT
GTCCAAGACGGTCGTCGTTTACAGCTACACGGAAGATACGAAGGCATCGGGAACGCTGCAGAAGCTCGCTGCATA
TCGGCCGGCTACCTTTCCGGTTGACTTGGATATATCAGGCAACATGATAGGCATCGTCGACCTCATGCAGTCGCT
GTCGATTGTGGAATATACGGCGCCGCTGGACGGGGCCAAGGCCAAGCTGGAAGAGCGAGCGAGACACTATCAGCC
GGCCTGGGCGACCTCTGTGTGCCATCTGGATGACGACAGGTGGCTCGAGGCGGACGCGCAGGGCAACGTAATGGT
CTTGAGGCGGAACCTGGAGGGGGCGACGGACCAGGACAGGAGTCGGCTCGAGGTGACGAGCGAGATGAGCCTGGG
AGAGCAGATCAATCGGATCCGGAGGCTTTACGTGTCTCCGTCCGAGAATGCCGTGGTGCACCCGAGGGCATTTTT
CGGATCGGTAAGTCGAACAACGAACCGGGCCGGACTAAGCGACGGCTGACGATAGTTGACAGGTCGAGGGCACGC
TCTACCTCTACGGCGACATCTCGCCCAAGTACCAGGACCTGCTTCTGACGTTTCAGTCGAAGCTGAAGGATTACA
TCTACGCGCCGGGCAACACGGACTTTGACGCCTGGCGGGCCTTTCGCAACCAGGCGCGGGAGGGGGAGGCGCCGT
ACCGGTTCGTGGACGGGGAGATGATTGAGCGGTTCCTCGATCTGGACGAGGGGAAACAGGAACTTGTTTGTGAGG
GTCTTGGGCCTGGCGTGGAGGATTTAAGGAACTTGGTGGAGGAGCTGAGGCGGATGCACTGAGTGGTGTTGGGAT
TGTGTATCTAGATGGTATTACCTAGAAAGGTGGCGAGTTGCGGTGGATCAAGTGAGCCAATTCTTAAGCAGTTGA
TGATGTGAGGAATATATTTACAGAGAGGTGCCGTGTTATGTTCTAGCAATGATTCAATCGTGTCTGATATCTGCT
TGATCCGTCAGTGACGGCATCCAATCCGCCAGCCAGCGCCAAAGCCCCACCAACCAATCAGCAGCCCCCAATTTC
CGAACCACATCCAATAAGGCCAACCTCACCTCAGCAACCCAAACCCACACCTCCATCCAAGCTCCCAGCTCCAAC
CTCAACCTCAACCTCAACCTCATCCGCACGACGATCCAGCATCAACACACGCGCCCACCCACACAATGGCAACGC
TCCAATCCGCCAGCCGCGCCATCCGCCTCTCCCACCCTCTCCGCCGTCCATCACCACCGCTCCTCCGCCTCGTCC
GCCACAGCAGCACCGCCCGCGCGACCTTTACCAGTCCCCTGCGCGCAACCGACTCGGAAAAGGGCAGCGCGGTGC
CGGACTTTGGGAAATATGTCTCCGGCAAGGGCGAGGGCATGAACAAGCTGGTCTCGTACTTTATGGTGGGAGCCA
TGGGCGCCATGACGGCCGCGGGGGCCAAGAGTACGGTTCAGGGTGAGGAGTTTTCCCCCGGGGTTTGTGAACTTG
GGGGGCTGATGGGGTTTTAGAGTTCTTGGTTAACATGTCTGCTTCGGCGGATGTGTTGGCCATGGCAAAGGTTGA
GGTTGATCTCAACGCCATTCCCGAGGGCAAGAACGTGAGCTTTCCCGCTTCTTTTCATCGACTCACCCCCCCTTC
TTGATGCTGAGGATTGGGCGGCACAGGTCATCATCAAATGGCGCGGCAAACCCGTCTTCATCCGCCACCGCACCT
CTTCCGAAATCGAACAAGCCAACAAAGTCGACGTCGCGAGCCTTCGAGACCCGCAGACGGATGACGACCGCGTCC
AGCGGCCTGAATGGCTCGTCATGCTCGGTGAGAGCCCGCTCGTCATCTTCCAAGGGAATTGGAACGTTTTGAAAT
ATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail