Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5620
Gene name
LocationContig_566:9752..10362
Strand-
Gene length (bp)610
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02221 E1_DerP2_DerF2 ML domain 2.8E-27 31 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q52FS9|NPC2_MAGO7 Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NPC2 PE=3 SV=2 1 157 6.0E-48
sp|O94183|NPC2_ASPOR Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pltp PE=1 SV=1 1 158 3.0E-47
sp|Q7RZ85|NPC2_NEUCR Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-2 PE=3 SV=1 1 156 1.0E-46
sp|Q4X136|NPC2_ASPFU Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=npc2 PE=3 SV=2 1 152 4.0E-40
sp|Q5B0Q1|NPC2_EMENI Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=npc2 PE=3 SV=1 20 152 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q52FS9|NPC2_MAGO7 Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NPC2 PE=3 SV=2 1 157 6.0E-48
sp|O94183|NPC2_ASPOR Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pltp PE=1 SV=1 1 158 3.0E-47
sp|Q7RZ85|NPC2_NEUCR Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=npc-2 PE=3 SV=1 1 156 1.0E-46
sp|Q4X136|NPC2_ASPFU Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=npc2 PE=3 SV=2 1 152 4.0E-40
sp|Q5B0Q1|NPC2_EMENI Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=npc2 PE=3 SV=1 20 152 2.0E-38
sp|Q6CHU5|NPC2_YARLI Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NPC2 PE=3 SV=1 14 159 6.0E-38
sp|Q5A8A2|NPC2_CANAL Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NPC2 PE=3 SV=1 26 156 2.0E-37
sp|Q6BV42|NPC2_DEBHA Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NPC2 PE=3 SV=1 22 156 2.0E-35
sp|D4AYQ6|NPC2_ARTBC Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01325 PE=1 SV=1 25 157 3.0E-34
sp|Q756Q3|NPC2_ASHGO Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NPC2 PE=3 SV=1 22 156 9.0E-31
sp|Q6CNE0|NPC2_KLULA Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NPC2 PE=3 SV=1 26 156 5.0E-30
sp|Q12408|NPC2_YEAST Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPC2 PE=1 SV=1 28 156 1.0E-27
sp|Q9C0X9|NPC2_SCHPO Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npc2 PE=3 SV=1 23 163 1.0E-26
sp|Q6FNB1|NPC2_CANGA Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NPC2 PE=3 SV=1 21 156 2.0E-26
sp|Q4P580|NPC2_USTMA Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NPC2 PE=3 SV=1 42 160 2.0E-24
sp|P0CP28|NPC2_CRYNJ Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NPC2 PE=3 SV=1 39 156 5.0E-22
sp|P0CP29|NPC2_CRYNB Phosphatidylglycerol/phosphatidylinositol transfer protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NPC2 PE=3 SV=1 39 156 5.0E-22
sp|Q54SZ8|NPC22_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein 2 OS=Dictyostelium discoideum GN=DDB_G0282109 PE=3 SV=1 46 156 2.0E-14
sp|Q54SZ9|Y2107_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282107 OS=Dictyostelium discoideum GN=DDB_G0282107 PE=3 SV=1 42 154 1.0E-12
sp|Q54YD2|Y8295_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0278295 OS=Dictyostelium discoideum GN=DDB_G0278295 PE=2 SV=1 42 156 4.0E-11
sp|Q54SW1|Y2179_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 OS=Dictyostelium discoideum GN=DDB_G0282179 PE=3 SV=2 29 151 1.0E-10
sp|Q54MV4|Y8563_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0285639 OS=Dictyostelium discoideum GN=DDB_G0285639 PE=3 SV=1 41 157 2.0E-09
sp|Q55BL4|NPC21_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein 1 OS=Dictyostelium discoideum GN=DDB_G0270454 PE=3 SV=1 35 159 3.0E-09
sp|Q54KP7|NPC23_DICDI Putative phosphatidylglycerol/phosphatidylinositol transfer protein 3 OS=Dictyostelium discoideum GN=DDB_G0287185 PE=3 SV=1 35 159 4.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999758

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup877
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6655
Ophiocordyceps australis map64 (Brazil) OphauB2|5947
Ophiocordyceps camponoti-floridani Ophcf2|03971
Ophiocordyceps camponoti-rufipedis Ophun1|5620 (this protein)
Ophiocordyceps kimflemingae Ophio5|2925
Ophiocordyceps subramaniannii Hirsu2|5086
Ophiocordyceps subramaniannii Hirsu2|7767

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5620
MRFFSAVALLSACLASAATVGESHQVPGGSPLQFCEGPIVRDFVDIKSVELSPNPPQAGKNLTINAHGTVHKDIV
EGAYVRLNVKWGLITLINTVQDLCEQTSHIDLKCPIKAGDMTIEKSVALPMAIPDGTYNVKAEVFSKDDSHITCL
TASVTFHGSRLFNIEL*
Coding >Ophun1|5620
ATGAGGTTCTTCTCCGCTGTCGCTCTCCTGTCCGCCTGCCTGGCGTCGGCGGCCACTGTTGGCGAGAGTCACCAG
GTTCCAGGCGGCTCTCCCCTGCAGTTCTGCGAGGGGCCTATTGTCAGAGACTTTGTCGACATCAAGAGCGTCGAG
CTCAGTCCTAACCCTCCTCAAGCTGGCAAGAACCTGACCATCAACGCTCACGGAACCGTCCACAAGGACATCGTC
GAGGGTGCCTACGTGCGCCTCAACGTCAAGTGGGGTCTCATCACCCTCATCAACACGGTGCAGGATCTCTGCGAG
CAGACGAGCCACATCGATCTCAAGTGTCCAATCAAGGCTGGCGACATGACGATCGAGAAGTCGGTTGCGCTACCG
ATGGCGATTCCCGATGGCACATACAACGTCAAGGCCGAGGTGTTTTCCAAAGACGATAGCCACATCACCTGCTTG
ACCGCCAGCGTTACCTTTCACGGAAGCAGATTATTCAACATCGAGCTTTAG
Transcript >Ophun1|5620
ATGAGGTTCTTCTCCGCTGTCGCTCTCCTGTCCGCCTGCCTGGCGTCGGCGGCCACTGTTGGCGAGAGTCACCAG
GTTCCAGGCGGCTCTCCCCTGCAGTTCTGCGAGGGGCCTATTGTCAGAGACTTTGTCGACATCAAGAGCGTCGAG
CTCAGTCCTAACCCTCCTCAAGCTGGCAAGAACCTGACCATCAACGCTCACGGAACCGTCCACAAGGACATCGTC
GAGGGTGCCTACGTGCGCCTCAACGTCAAGTGGGGTCTCATCACCCTCATCAACACGGTGCAGGATCTCTGCGAG
CAGACGAGCCACATCGATCTCAAGTGTCCAATCAAGGCTGGCGACATGACGATCGAGAAGTCGGTTGCGCTACCG
ATGGCGATTCCCGATGGCACATACAACGTCAAGGCCGAGGTGTTTTCCAAAGACGATAGCCACATCACCTGCTTG
ACCGCCAGCGTTACCTTTCACGGAAGCAGATTATTCAACATCGAGCTTTAG
Gene >Ophun1|5620
ATGAGGTTCTTCTCCGCTGTCGCTCTCCTGTCCGCCTGCCTGGCGTCGGCGGCCACTGTTGGCGAGAGTCACCAG
GTTCCAGGCGGCTCTCCCCTGCAGTTCTGCGAGGGGCCTATTGTCAGAGACTTTGTCGACATCAAGAGCGTCGAG
CTCAGTCCTAACCCTCCTCAAGCGTAAGTCGGACCTCTGATTCAAGTATGACATCGCAGATCGCTGACTATTTGC
TCTCCAGTGGCAAGAACCTGACCATCAACGCTCACGGAACCGTCCACAAGGACATCGTCGAGGGTGCCTACGTGC
GCCTCAACGTCAAGTGGGGTCTCATCACCCTCATCAACACGGTGCAGGATCTCTGCGAGCAGACGAGCCACATCG
ATCTCAAGTGTCCAATCAAGGCTGGCGACATGACGATCGAGAAGTCGGTTGCGCTACCGATGGCGATTCCCGATG
TACGTGGCCTGCTGCTATCACTCATGACATCAGACTGACTTGCTGGTAGGGCACATACAACGTCAAGGCCGAGGT
GTTTTCCAAAGACGATAGCCACATCACCTGCTTGACCGCCAGCGTTACCTTTCACGGAAGCAGATTATTCAACAT
CGAGCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail