Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5610
Gene name
LocationContig_563:3620..5690
Strand-
Gene length (bp)2070
Transcript length (bp)2070
Coding sequence length (bp)2070
Protein length (aa) 690

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09362 DUF1996 Domain of unknown function (DUF1996) 2.5E-62 38 300
PF01822 WSC WSC domain 2.3E-17 577 656

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 557 676 2.0E-12
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 576 676 3.0E-12
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 535 663 8.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 576 676 8.0E-12
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 543 687 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 557 676 2.0E-12
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 576 676 3.0E-12
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 535 663 8.0E-12
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 576 676 8.0E-12
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 543 687 1.0E-10
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 509 663 5.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 577 663 8.0E-10
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 553 663 1.0E-09
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 577 663 3.0E-09
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 577 670 6.0E-09
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 576 666 1.0E-08
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 548 664 3.0E-07
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 567 663 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.998569

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2558
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2354
Ophiocordyceps australis map64 (Brazil) OphauB2|5163
Ophiocordyceps camponoti-floridani Ophcf2|06513
Ophiocordyceps camponoti-rufipedis Ophun1|5610 (this protein)
Ophiocordyceps kimflemingae Ophio5|6612
Ophiocordyceps subramaniannii Hirsu2|3803

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5610
MKPLLLTTALAALATAKDARSFAVLRFTNKQLTKGRMDPIRSPGKTGAHVHHVLGGSGFSTSSTGKDLLESKCST
AKVKGDNSNYWFPSLYFRDAATGKLEGVELFYANAYYFFEATNDEIKAFPTGLSIVSGDIDARSAPVGGSVTNLD
ASKGPINAVKWTCPRRDNLYNPPSWPAGSDGSLAGIGDPVNKGEGVGFPDVDCDGFASPLRADIHFPSCYDPAVG
LTDYKHNMVFPSDAGNGKMDCPKGHIHVPHLFLEVYWDTPAFKGRWEQGKGKQPFVLSNGDATGFSLHADFMAGW
DEKVLQHVIDTCDAGTAGMDKCPGLPLGLNEADCTVESVVKERVDGVLDALPGDNGIAGWSYGRTRVTSSAVGSG
TEAPVASSGYSSGFESGSRATSSGAGYETEVPVASSGHSAGSKSESPMTSSGAGYETEAPATSSGHSSGFHSESP
ATSSGSRSASASEYPPPANSDPSTPRKPTRYQLPVKQVVSASTSPSSSAIGYHVPSRGPSRHYTNSTTAEPTASH
PIGSAITMPATSEACVTKTVTVRQTVTVTNRAPPSAITNRPSTNSTVNGYRYAGCFKDSSSRILNGVIRADVGAV
SNAKCVDYCRAAGYGLAGTEYGGQCYCGSRLGTSDRLDDGRCDMACEGDAADICGGSWALSVYGRVNATEAKMQR
HLYDHVRRRRSLYH*
Coding >Ophun1|5610
ATGAAGCCCCTCCTCCTCACCACCGCCCTCGCCGCCCTCGCCACCGCAAAAGACGCCCGCTCCTTCGCCGTCCTG
CGCTTCACCAACAAGCAGCTCACCAAAGGACGAATGGATCCCATCCGCTCGCCCGGCAAGACGGGCGCTCACGTG
CACCACGTCCTCGGCGGGAGCGGCTTCAGCACCTCGTCTACGGGCAAGGACCTGCTCGAGTCCAAGTGCAGCACT
GCCAAGGTCAAGGGCGACAACAGCAACTACTGGTTTCCGTCGTTGTACTTTCGAGATGCGGCGACGGGGAAGCTT
GAGGGGGTGGAACTGTTTTACGCCAATGCTTATTACTTCTTTGAGGCGACGAATGATGAGATTAAGGCTTTTCCT
ACGGGGCTTAGCATCGTTAGTGGTGATATCGATGCCAGGTCTGCGCCTGTGGGGGGGAGTGTCACCAATTTGGAT
GCGTCAAAGGGGCCGATTAACGCGGTGAAATGGACGTGTCCTCGTCGGGATAACCTCTACAACCCTCCTTCTTGG
CCAGCTGGTTCGGACGGAAGCCTGGCCGGCATTGGGGATCCCGTCAACAAGGGCGAGGGCGTTGGCTTCCCGGAT
GTCGACTGCGATGGCTTCGCTTCGCCGCTTCGGGCGGACATTCACTTCCCGTCTTGCTACGATCCTGCCGTTGGA
CTGACGGATTACAAGCACAACATGGTCTTCCCGAGCGATGCGGGAAACGGAAAGATGGACTGTCCCAAGGGCCAC
ATCCACGTGCCCCATCTCTTCCTCGAGGTCTACTGGGACACACCGGCTTTCAAGGGCCGGTGGGAGCAGGGCAAG
GGCAAGCAGCCGTTTGTGCTGTCCAACGGGGACGCCACGGGCTTCAGTCTGCACGCTGACTTTATGGCTGGGTGG
GATGAGAAGGTGCTGCAGCATGTTATCGATACGTGTGATGCTGGCACGGCGGGGATGGATAAGTGTCCCGGGTTG
CCGTTGGGGTTGAATGAGGCGGATTGTACGGTTGAGTCGGTGGTTAAGGAGAGGGTTGATGGGGTGCTTGATGCG
TTGCCGGGGGATAATGGCATTGCTGGCTGGTCTTATGGGCGGACTCGGGTGACGTCTTCGGCGGTGGGATCGGGG
ACGGAGGCTCCGGTGGCTTCTTCGGGGTATAGCTCCGGGTTCGAGTCTGGGTCTCGGGCGACTTCTTCGGGTGCG
GGCTACGAGACCGAGGTTCCGGTGGCTTCTTCCGGACACAGCGCCGGGTCCAAGTCCGAGTCGCCGATGACTTCT
TCCGGTGCGGGCTACGAGACCGAAGCTCCGGCGACGTCTTCCGGTCACAGCTCCGGCTTCCACTCCGAGTCTCCG
GCAACTTCTTCCGGCTCCCGCTCCGCCTCCGCCTCCGAATACCCGCCGCCCGCCAACTCCGATCCCTCCACCCCC
CGGAAGCCGACCCGGTACCAGCTGCCGGTCAAGCAAGTGGTCAGCGCCTCGACGTCGCCCTCTTCCTCCGCCATC
GGCTACCACGTGCCGTCTCGAGGACCATCCCGTCACTACACCAACTCGACAACGGCCGAACCGACCGCCTCGCAC
CCGATCGGATCCGCCATCACGATGCCGGCCACATCCGAAGCCTGCGTCACCAAGACGGTCACGGTCAGACAGACG
GTCACGGTAACCAACAGGGCGCCCCCTTCAGCCATCACCAACCGACCGTCGACCAACTCAACCGTCAACGGCTAC
AGATACGCCGGCTGCTTCAAAGACTCGTCCTCGCGTATCCTCAACGGCGTCATCCGCGCCGACGTCGGAGCCGTC
AGCAACGCAAAGTGCGTCGACTACTGCCGGGCCGCGGGCTACGGCCTGGCCGGGACCGAGTATGGCGGCCAGTGC
TACTGCGGCAGCCGGCTCGGGACCTCGGACCGGCTCGATGACGGCCGCTGCGACATGGCTTGCGAGGGAGACGCC
GCTGACATCTGTGGCGGTAGCTGGGCGCTGTCTGTCTATGGCAGGGTGAACGCCACCGAGGCCAAGATGCAGCGC
CATCTGTACGACCATGTCAGGAGGCGTCGCAGCCTGTATCATTAG
Transcript >Ophun1|5610
ATGAAGCCCCTCCTCCTCACCACCGCCCTCGCCGCCCTCGCCACCGCAAAAGACGCCCGCTCCTTCGCCGTCCTG
CGCTTCACCAACAAGCAGCTCACCAAAGGACGAATGGATCCCATCCGCTCGCCCGGCAAGACGGGCGCTCACGTG
CACCACGTCCTCGGCGGGAGCGGCTTCAGCACCTCGTCTACGGGCAAGGACCTGCTCGAGTCCAAGTGCAGCACT
GCCAAGGTCAAGGGCGACAACAGCAACTACTGGTTTCCGTCGTTGTACTTTCGAGATGCGGCGACGGGGAAGCTT
GAGGGGGTGGAACTGTTTTACGCCAATGCTTATTACTTCTTTGAGGCGACGAATGATGAGATTAAGGCTTTTCCT
ACGGGGCTTAGCATCGTTAGTGGTGATATCGATGCCAGGTCTGCGCCTGTGGGGGGGAGTGTCACCAATTTGGAT
GCGTCAAAGGGGCCGATTAACGCGGTGAAATGGACGTGTCCTCGTCGGGATAACCTCTACAACCCTCCTTCTTGG
CCAGCTGGTTCGGACGGAAGCCTGGCCGGCATTGGGGATCCCGTCAACAAGGGCGAGGGCGTTGGCTTCCCGGAT
GTCGACTGCGATGGCTTCGCTTCGCCGCTTCGGGCGGACATTCACTTCCCGTCTTGCTACGATCCTGCCGTTGGA
CTGACGGATTACAAGCACAACATGGTCTTCCCGAGCGATGCGGGAAACGGAAAGATGGACTGTCCCAAGGGCCAC
ATCCACGTGCCCCATCTCTTCCTCGAGGTCTACTGGGACACACCGGCTTTCAAGGGCCGGTGGGAGCAGGGCAAG
GGCAAGCAGCCGTTTGTGCTGTCCAACGGGGACGCCACGGGCTTCAGTCTGCACGCTGACTTTATGGCTGGGTGG
GATGAGAAGGTGCTGCAGCATGTTATCGATACGTGTGATGCTGGCACGGCGGGGATGGATAAGTGTCCCGGGTTG
CCGTTGGGGTTGAATGAGGCGGATTGTACGGTTGAGTCGGTGGTTAAGGAGAGGGTTGATGGGGTGCTTGATGCG
TTGCCGGGGGATAATGGCATTGCTGGCTGGTCTTATGGGCGGACTCGGGTGACGTCTTCGGCGGTGGGATCGGGG
ACGGAGGCTCCGGTGGCTTCTTCGGGGTATAGCTCCGGGTTCGAGTCTGGGTCTCGGGCGACTTCTTCGGGTGCG
GGCTACGAGACCGAGGTTCCGGTGGCTTCTTCCGGACACAGCGCCGGGTCCAAGTCCGAGTCGCCGATGACTTCT
TCCGGTGCGGGCTACGAGACCGAAGCTCCGGCGACGTCTTCCGGTCACAGCTCCGGCTTCCACTCCGAGTCTCCG
GCAACTTCTTCCGGCTCCCGCTCCGCCTCCGCCTCCGAATACCCGCCGCCCGCCAACTCCGATCCCTCCACCCCC
CGGAAGCCGACCCGGTACCAGCTGCCGGTCAAGCAAGTGGTCAGCGCCTCGACGTCGCCCTCTTCCTCCGCCATC
GGCTACCACGTGCCGTCTCGAGGACCATCCCGTCACTACACCAACTCGACAACGGCCGAACCGACCGCCTCGCAC
CCGATCGGATCCGCCATCACGATGCCGGCCACATCCGAAGCCTGCGTCACCAAGACGGTCACGGTCAGACAGACG
GTCACGGTAACCAACAGGGCGCCCCCTTCAGCCATCACCAACCGACCGTCGACCAACTCAACCGTCAACGGCTAC
AGATACGCCGGCTGCTTCAAAGACTCGTCCTCGCGTATCCTCAACGGCGTCATCCGCGCCGACGTCGGAGCCGTC
AGCAACGCAAAGTGCGTCGACTACTGCCGGGCCGCGGGCTACGGCCTGGCCGGGACCGAGTATGGCGGCCAGTGC
TACTGCGGCAGCCGGCTCGGGACCTCGGACCGGCTCGATGACGGCCGCTGCGACATGGCTTGCGAGGGAGACGCC
GCTGACATCTGTGGCGGTAGCTGGGCGCTGTCTGTCTATGGCAGGGTGAACGCCACCGAGGCCAAGATGCAGCGC
CATCTGTACGACCATGTCAGGAGGCGTCGCAGCCTGTATCATTAG
Gene >Ophun1|5610
ATGAAGCCCCTCCTCCTCACCACCGCCCTCGCCGCCCTCGCCACCGCAAAAGACGCCCGCTCCTTCGCCGTCCTG
CGCTTCACCAACAAGCAGCTCACCAAAGGACGAATGGATCCCATCCGCTCGCCCGGCAAGACGGGCGCTCACGTG
CACCACGTCCTCGGCGGGAGCGGCTTCAGCACCTCGTCTACGGGCAAGGACCTGCTCGAGTCCAAGTGCAGCACT
GCCAAGGTCAAGGGCGACAACAGCAACTACTGGTTTCCGTCGTTGTACTTTCGAGATGCGGCGACGGGGAAGCTT
GAGGGGGTGGAACTGTTTTACGCCAATGCTTATTACTTCTTTGAGGCGACGAATGATGAGATTAAGGCTTTTCCT
ACGGGGCTTAGCATCGTTAGTGGTGATATCGATGCCAGGTCTGCGCCTGTGGGGGGGAGTGTCACCAATTTGGAT
GCGTCAAAGGGGCCGATTAACGCGGTGAAATGGACGTGTCCTCGTCGGGATAACCTCTACAACCCTCCTTCTTGG
CCAGCTGGTTCGGACGGAAGCCTGGCCGGCATTGGGGATCCCGTCAACAAGGGCGAGGGCGTTGGCTTCCCGGAT
GTCGACTGCGATGGCTTCGCTTCGCCGCTTCGGGCGGACATTCACTTCCCGTCTTGCTACGATCCTGCCGTTGGA
CTGACGGATTACAAGCACAACATGGTCTTCCCGAGCGATGCGGGAAACGGAAAGATGGACTGTCCCAAGGGCCAC
ATCCACGTGCCCCATCTCTTCCTCGAGGTCTACTGGGACACACCGGCTTTCAAGGGCCGGTGGGAGCAGGGCAAG
GGCAAGCAGCCGTTTGTGCTGTCCAACGGGGACGCCACGGGCTTCAGTCTGCACGCTGACTTTATGGCTGGGTGG
GATGAGAAGGTGCTGCAGCATGTTATCGATACGTGTGATGCTGGCACGGCGGGGATGGATAAGTGTCCCGGGTTG
CCGTTGGGGTTGAATGAGGCGGATTGTACGGTTGAGTCGGTGGTTAAGGAGAGGGTTGATGGGGTGCTTGATGCG
TTGCCGGGGGATAATGGCATTGCTGGCTGGTCTTATGGGCGGACTCGGGTGACGTCTTCGGCGGTGGGATCGGGG
ACGGAGGCTCCGGTGGCTTCTTCGGGGTATAGCTCCGGGTTCGAGTCTGGGTCTCGGGCGACTTCTTCGGGTGCG
GGCTACGAGACCGAGGTTCCGGTGGCTTCTTCCGGACACAGCGCCGGGTCCAAGTCCGAGTCGCCGATGACTTCT
TCCGGTGCGGGCTACGAGACCGAAGCTCCGGCGACGTCTTCCGGTCACAGCTCCGGCTTCCACTCCGAGTCTCCG
GCAACTTCTTCCGGCTCCCGCTCCGCCTCCGCCTCCGAATACCCGCCGCCCGCCAACTCCGATCCCTCCACCCCC
CGGAAGCCGACCCGGTACCAGCTGCCGGTCAAGCAAGTGGTCAGCGCCTCGACGTCGCCCTCTTCCTCCGCCATC
GGCTACCACGTGCCGTCTCGAGGACCATCCCGTCACTACACCAACTCGACAACGGCCGAACCGACCGCCTCGCAC
CCGATCGGATCCGCCATCACGATGCCGGCCACATCCGAAGCCTGCGTCACCAAGACGGTCACGGTCAGACAGACG
GTCACGGTAACCAACAGGGCGCCCCCTTCAGCCATCACCAACCGACCGTCGACCAACTCAACCGTCAACGGCTAC
AGATACGCCGGCTGCTTCAAAGACTCGTCCTCGCGTATCCTCAACGGCGTCATCCGCGCCGACGTCGGAGCCGTC
AGCAACGCAAAGTGCGTCGACTACTGCCGGGCCGCGGGCTACGGCCTGGCCGGGACCGAGTATGGCGGCCAGTGC
TACTGCGGCAGCCGGCTCGGGACCTCGGACCGGCTCGATGACGGCCGCTGCGACATGGCTTGCGAGGGAGACGCC
GCTGACATCTGTGGCGGTAGCTGGGCGCTGTCTGTCTATGGCAGGGTGAACGCCACCGAGGCCAAGATGCAGCGC
CATCTGTACGACCATGTCAGGAGGCGTCGCAGCCTGTATCATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail