Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5590
Gene name
LocationContig_56:36200..37748
Strand+
Gene length (bp)1548
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 3.5E-10 46 240
PF00743 FMO-like Flavin-binding monooxygenase-like 9.1E-11 43 329
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 1.1E-06 124 239
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.8E-05 46 90

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 43 243 1.0E-15
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 25 244 3.0E-15
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 40 446 4.0E-15
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 46 243 4.0E-15
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 40 446 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 43 243 1.0E-15
sp|Q9I3H5|BVMO_PSEAE Baeyer-Villiger monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1538 PE=1 SV=1 25 244 3.0E-15
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 40 446 4.0E-15
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 46 243 4.0E-15
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 40 446 5.0E-15
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 39 243 5.0E-15
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 39 243 5.0E-15
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 39 243 5.0E-15
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 43 243 3.0E-14
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 43 244 4.0E-14
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 43 405 5.0E-13
sp|Q9FVQ0|YUC10_ARATH Probable indole-3-pyruvate monooxygenase YUCCA10 OS=Arabidopsis thaliana GN=YUC10 PE=2 SV=1 44 371 9.0E-13
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 44 358 1.0E-12
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 44 358 1.0E-12
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 44 358 1.0E-12
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 46 243 2.0E-12
sp|Q9FF12|GSXL9_ARATH Flavin-containing monooxygenase FMO GS-OX-like 9 OS=Arabidopsis thaliana GN=At5g07800 PE=2 SV=1 36 245 8.0E-12
sp|Q9LFM5|YUC4_ARATH Probable indole-3-pyruvate monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=1 SV=1 42 367 1.0E-11
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 43 394 2.0E-11
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 35 245 8.0E-11
sp|Q9FKE7|FMO2_ARATH Putative flavin-containing monooxygenase 2 OS=Arabidopsis thaliana GN=FMO2 PE=3 SV=2 43 357 4.0E-10
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 46 370 8.0E-10
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 46 370 1.0E-09
sp|P9WNF7|MYMA_MYCTU Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mymA PE=1 SV=1 44 423 1.0E-09
sp|P9WNF6|MYMA_MYCTO Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mymA PE=3 SV=1 44 423 1.0E-09
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 43 247 1.0E-09
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 46 358 2.0E-09
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 34 239 2.0E-08
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 36 220 4.0E-08
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 44 241 7.0E-08
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 34 237 9.0E-08
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 35 263 2.0E-07
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 40 394 2.0E-07
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 34 237 3.0E-07
sp|Q9SZY8|YUC1_ARATH Probable indole-3-pyruvate monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=1 SV=1 46 357 9.0E-07
sp|Q9FLK4|GSXL8_ARATH Flavin-containing monooxygenase FMO GS-OX-like 8 OS=Arabidopsis thaliana GN=At5g61290 PE=2 SV=1 44 223 1.0E-06
sp|U5S003|BVMO4_DIESD Baeyer-Villiger monooxygenase 4 OS=Dietzia sp. (strain D5) PE=1 SV=1 108 245 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0003674 molecular_function No
GO:0004497 monooxygenase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3435
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6557
Ophiocordyceps australis map64 (Brazil) OphauB2|218
Ophiocordyceps camponoti-floridani Ophcf2|04959
Ophiocordyceps camponoti-rufipedis Ophun1|5590 (this protein)
Ophiocordyceps kimflemingae Ophio5|6109
Ophiocordyceps subramaniannii Hirsu2|6531

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5590
MTTKSQPAFDQPLLLLYQLLQWLISKTLSPNPPPRTSPGSRPRIAVIGAGITGVTAASHICGHGFEAVIFEAGPE
EQLGGIWSRVNDTSGLQIHSLMYRFHPSVSWQQGYPDRDQIVAEVRRLWLRYGLRDKTRFNVRVESVRRSDDGDG
WIVNGLENGRFDGVVVAVGTCGDVKMPALKGIDSFAGPVVHSSQLSARAVDVTDKQVIIVGGGASAVEALEFAVK
HKAARVTVLSRSEKWIIPRHVVVDALLSFNVLGRETRFSWVTEWLLRRFFYGTELEELSPPSDKGFFTDTPMVNS
DLMTLVRDGRARWLRCDIEMLTGRSVIVNHRVRGVPKGGPGHGESVEADVVIMATGFHRPSLSMLPDDCFVEPYQ
CPNWYLQTFPPQHPSVSAINCTFVNAVGTVGNWHIGIYTRILLMFLLDPLTRPSPVWMRRWIDMTRFLKRGAPTA
AFDFFTYLELLWWFVSCICINPFRWKWAVFVFFGLGLRLPRAVARREERLLNSDGYRLRDQGSSF*
Coding >Ophun1|5590
ATGACAACCAAGTCCCAGCCCGCTTTCGATCAGCCCCTTCTCTTACTGTACCAGTTGCTGCAATGGCTGATCAGC
AAGACGCTCTCGCCCAACCCACCCCCCCGGACCTCACCCGGATCTCGGCCCCGCATCGCCGTCATCGGAGCCGGT
ATCACGGGGGTGACGGCGGCGTCTCACATCTGCGGCCACGGCTTTGAGGCCGTCATCTTCGAGGCTGGGCCCGAG
GAACAGCTCGGCGGCATCTGGAGTCGGGTCAACGACACGTCGGGTCTGCAGATTCATAGCCTCATGTATCGCTTT
CATCCGTCCGTCTCGTGGCAGCAGGGGTATCCGGATCGCGATCAGATTGTTGCCGAGGTGAGGCGTTTGTGGCTA
CGGTATGGGCTTAGGGACAAGACGCGCTTTAATGTTCGGGTTGAGAGCGTGAGGCGCAGTGATGATGGCGATGGG
TGGATCGTCAATGGGTTGGAGAATGGACGCTTTGATGGCGTCGTCGTCGCCGTCGGCACATGCGGAGACGTCAAG
ATGCCTGCTTTGAAGGGCATCGACAGCTTTGCAGGGCCCGTCGTCCACTCAAGCCAACTGTCAGCCAGGGCCGTC
GACGTAACAGACAAGCAAGTCATCATCGTCGGCGGCGGAGCCAGCGCCGTTGAAGCTCTCGAATTCGCCGTCAAG
CACAAGGCAGCACGGGTGACGGTGCTTTCGCGATCGGAGAAGTGGATTATTCCGCGACATGTCGTCGTTGACGCG
CTGCTGAGCTTCAACGTTCTCGGTCGCGAGACGCGCTTCTCGTGGGTGACGGAGTGGCTGCTTCGTCGTTTCTTC
TATGGGACTGAGCTGGAGGAGCTCTCGCCTCCTTCGGATAAGGGCTTCTTCACTGATACTCCCATGGTTAATTCG
GACTTGATGACACTTGTGCGGGACGGTCGAGCTCGCTGGCTGAGATGTGACATTGAGATGCTGACGGGACGATCT
GTCATCGTTAACCATCGTGTCAGGGGCGTGCCCAAGGGGGGACCGGGCCACGGCGAGAGTGTCGAGGCAGACGTC
GTCATCATGGCCACGGGCTTCCATCGGCCGTCGCTGTCGATGCTACCGGACGACTGCTTCGTTGAGCCCTATCAG
TGTCCCAACTGGTATCTGCAGACGTTCCCACCCCAGCACCCGTCCGTCTCGGCCATCAACTGCACATTTGTCAAC
GCCGTCGGCACCGTGGGCAACTGGCACATTGGCATCTACACGCGCATCCTGCTCATGTTCCTTCTCGATCCGTTG
ACGAGGCCCAGCCCCGTCTGGATGCGCCGCTGGATCGACATGACGCGCTTCCTCAAGCGTGGAGCGCCGACGGCT
GCCTTTGACTTCTTCACCTACCTCGAGCTGCTGTGGTGGTTCGTCTCCTGCATCTGCATCAACCCGTTTCGCTGG
AAGTGGGCCGTCTTCGTCTTCTTCGGTCTTGGTCTGCGTTTGCCCCGTGCCGTGGCCAGGCGGGAGGAGAGGCTG
CTGAACTCGGACGGCTATCGTCTTCGGGACCAGGGATCGAGCTTCTGA
Transcript >Ophun1|5590
ATGACAACCAAGTCCCAGCCCGCTTTCGATCAGCCCCTTCTCTTACTGTACCAGTTGCTGCAATGGCTGATCAGC
AAGACGCTCTCGCCCAACCCACCCCCCCGGACCTCACCCGGATCTCGGCCCCGCATCGCCGTCATCGGAGCCGGT
ATCACGGGGGTGACGGCGGCGTCTCACATCTGCGGCCACGGCTTTGAGGCCGTCATCTTCGAGGCTGGGCCCGAG
GAACAGCTCGGCGGCATCTGGAGTCGGGTCAACGACACGTCGGGTCTGCAGATTCATAGCCTCATGTATCGCTTT
CATCCGTCCGTCTCGTGGCAGCAGGGGTATCCGGATCGCGATCAGATTGTTGCCGAGGTGAGGCGTTTGTGGCTA
CGGTATGGGCTTAGGGACAAGACGCGCTTTAATGTTCGGGTTGAGAGCGTGAGGCGCAGTGATGATGGCGATGGG
TGGATCGTCAATGGGTTGGAGAATGGACGCTTTGATGGCGTCGTCGTCGCCGTCGGCACATGCGGAGACGTCAAG
ATGCCTGCTTTGAAGGGCATCGACAGCTTTGCAGGGCCCGTCGTCCACTCAAGCCAACTGTCAGCCAGGGCCGTC
GACGTAACAGACAAGCAAGTCATCATCGTCGGCGGCGGAGCCAGCGCCGTTGAAGCTCTCGAATTCGCCGTCAAG
CACAAGGCAGCACGGGTGACGGTGCTTTCGCGATCGGAGAAGTGGATTATTCCGCGACATGTCGTCGTTGACGCG
CTGCTGAGCTTCAACGTTCTCGGTCGCGAGACGCGCTTCTCGTGGGTGACGGAGTGGCTGCTTCGTCGTTTCTTC
TATGGGACTGAGCTGGAGGAGCTCTCGCCTCCTTCGGATAAGGGCTTCTTCACTGATACTCCCATGGTTAATTCG
GACTTGATGACACTTGTGCGGGACGGTCGAGCTCGCTGGCTGAGATGTGACATTGAGATGCTGACGGGACGATCT
GTCATCGTTAACCATCGTGTCAGGGGCGTGCCCAAGGGGGGACCGGGCCACGGCGAGAGTGTCGAGGCAGACGTC
GTCATCATGGCCACGGGCTTCCATCGGCCGTCGCTGTCGATGCTACCGGACGACTGCTTCGTTGAGCCCTATCAG
TGTCCCAACTGGTATCTGCAGACGTTCCCACCCCAGCACCCGTCCGTCTCGGCCATCAACTGCACATTTGTCAAC
GCCGTCGGCACCGTGGGCAACTGGCACATTGGCATCTACACGCGCATCCTGCTCATGTTCCTTCTCGATCCGTTG
ACGAGGCCCAGCCCCGTCTGGATGCGCCGCTGGATCGACATGACGCGCTTCCTCAAGCGTGGAGCGCCGACGGCT
GCCTTTGACTTCTTCACCTACCTCGAGCTGCTGTGGTGGTTCGTCTCCTGCATCTGCATCAACCCGTTTCGCTGG
AAGTGGGCCGTCTTCGTCTTCTTCGGTCTTGGTCTGCGTTTGCCCCGTGCCGTGGCCAGGCGGGAGGAGAGGCTG
CTGAACTCGGACGGCTATCGTCTTCGGGACCAGGGATCGAGCTTCTGA
Gene >Ophun1|5590
ATGACAACCAAGTCCCAGCCCGCTTTCGATCAGCCCCTTCTCTTACTGTACCAGTTGCTGCAATGGCTGATCAGC
AAGACGCTCTCGCCCAACCCACCCCCCCGGACCTCACCCGGATCTCGGCCCCGCATCGCCGTCATCGGAGCCGGT
ATCACGGGGGTGACGGCGGCGTCTCACATCTGCGGCCACGGCTTTGAGGCCGTCATCTTCGAGGCTGGGCCCGAG
GAACAGCTCGGCGGCATCTGGAGTCGGGTCAACGACACGTCGGGTCTGCAGATTCATAGCCTCATGTATCGCTTT
CATCCGTCCGTCTCGTGGCAGCAGGGGTATCCGGATCGCGATCAGATTGTTGCCGAGGTGAGGCGTTTGTGGCTA
CGGTATGGGCTTAGGGACAAGACGCGCTTTAATGTTCGGGTTGAGAGCGTGAGGCGCAGTGATGATGGCGATGGG
TGGATCGTCAATGGGTTGGAGAATGGACGCTTTGATGGCGTCGTCGTCGCCGTCGGCACATGCGGAGACGTCAAG
ATGCCTGCTTTGAAGGGCATCGACAGCTTTGCAGGGCCCGTCGTCCACTCAAGCCAACTGTCAGCCAGGGCCGTC
GACGTAACAGACAAGCAAGTCATCATCGTCGGCGGCGGAGCCAGCGCCGTTGAAGCTCTCGAATTCGCCGTCAAG
CACAAGGCAGCACGGGTGACGGTGCTTTCGCGATCGGAGAAGTGGATTATTCCGCGACATGTCGTCGTTGACGCG
CTGCTGAGCTTCAACGTTCTCGGTCGCGAGACGCGCTTCTCGTGGGTGACGGAGTGGCTGCTTCGTCGTTTCTTC
TATGGGACTGAGCTGGAGGAGCTCTCGCCTCCTTCGGATAAGGGCTTCTTCACTGATACTCCCATGGTTAATTCG
GACTTGATGACACTTGTGCGGGACGGTCGAGCTCGCTGGCTGAGATGTGACATTGAGATGCTGACGGGACGATCT
GTCATCGTTAACCATCGTGTCAGGGGCGTGCCCAAGGGGGGACCGGGCCACGGCGAGAGTGTCGAGGCAGACGTC
GTCATCATGGCCACGGGCTTCCATCGGCCGTCGCTGTCGATGCTACCGGACGACTGCTTCGTTGAGCCCTATCAG
TGTCCCAACTGGTATCTGCAGACGTTCCCACCCCAGCACCCGTCCGTCTCGGCCATCAACTGCACATTTGTCAAC
GCCGTCGGCACCGTGGGCAACTGGCACATTGGCATCTACACGCGCATCCTGCTCATGTTCCTTCTCGATCCGTTG
ACGAGGCCCAGCCCCGTCTGGATGCGCCGCTGGATCGACATGACGCGCTTCCTCAAGCGTGGAGCGCCGACGGCT
GCCTTTGACTTCTTCACCTACCTCGAGCTGCTGTGGTGGTTCGTCTCCTGCATCTGCATCAACCCGTTTCGCTGG
AAGTGGGCCGTCTTCGTCTTCTTCGGTCTTGGTCTGCGTTTGCCCCGTGCCGTGGCCAGGCGGGAGGAGAGGCTG
CTGAACTCGGACGGCTATCGTCTTCGGGACCAGGGATCGAGCTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail