Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5586
Gene name
LocationContig_56:29873..30486
Strand+
Gene length (bp)613
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00410 Ribosomal_S8 Ribosomal protein S8 1.1E-21 7 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RV75|RS22_NEUCR 40S ribosomal protein S22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-27 PE=3 SV=1 1 130 6.0E-88
sp|Q6FMW9|RS22_CANGA 40S ribosomal protein S22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS22 PE=3 SV=3 1 130 1.0E-78
sp|Q6CW21|RS22_KLULA 40S ribosomal protein S22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS22 PE=1 SV=3 1 130 2.0E-78
sp|P0C0W1|RS22A_YEAST 40S ribosomal protein S22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22A PE=1 SV=2 1 130 3.0E-78
sp|P33953|RS22_KLUMA 40S ribosomal protein S22 OS=Kluyveromyces marxianus GN=RPS22 PE=3 SV=3 1 130 5.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RV75|RS22_NEUCR 40S ribosomal protein S22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-27 PE=3 SV=1 1 130 6.0E-88
sp|Q6FMW9|RS22_CANGA 40S ribosomal protein S22 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPS22 PE=3 SV=3 1 130 1.0E-78
sp|Q6CW21|RS22_KLULA 40S ribosomal protein S22 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RPS22 PE=1 SV=3 1 130 2.0E-78
sp|P0C0W1|RS22A_YEAST 40S ribosomal protein S22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22A PE=1 SV=2 1 130 3.0E-78
sp|P33953|RS22_KLUMA 40S ribosomal protein S22 OS=Kluyveromyces marxianus GN=RPS22 PE=3 SV=3 1 130 5.0E-78
sp|Q3E7Y3|RS22B_YEAST 40S ribosomal protein S22-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22B PE=1 SV=3 1 130 7.0E-78
sp|Q752J5|RS22_ASHGO 40S ribosomal protein S22 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPS22A PE=3 SV=3 1 130 4.0E-77
sp|Q96W54|RS22_CANAL 40S ribosomal protein S22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS22A PE=3 SV=3 1 130 7.0E-76
sp|Q9AT34|RS15A_DAUCA 40S ribosomal protein S15a OS=Daucus carota GN=RPS15A PE=2 SV=3 1 130 7.0E-71
sp|P42798|R15A1_ARATH 40S ribosomal protein S15a-1 OS=Arabidopsis thaliana GN=RPS15AA PE=2 SV=2 1 130 2.0E-70
sp|Q00332|RS15A_BRANA 40S ribosomal protein S15a OS=Brassica napus GN=RPS15A PE=2 SV=3 1 130 2.0E-70
sp|O80646|R15A3_ARATH 40S ribosomal protein S15a-3 OS=Arabidopsis thaliana GN=RPS15AC PE=2 SV=2 1 130 4.0E-70
sp|Q9LX88|R15A4_ARATH 40S ribosomal protein S15a-4 OS=Arabidopsis thaliana GN=RPS15AD PE=2 SV=3 1 130 3.0E-69
sp|P62246|RS15A_RAT 40S ribosomal protein S15a OS=Rattus norvegicus GN=Rps15a PE=1 SV=2 1 130 1.0E-68
sp|P62245|RS15A_MOUSE 40S ribosomal protein S15a OS=Mus musculus GN=Rps15a PE=1 SV=2 1 130 1.0E-68
sp|P62244|RS15A_HUMAN 40S ribosomal protein S15a OS=Homo sapiens GN=RPS15A PE=1 SV=2 1 130 1.0E-68
sp|Q76I82|RS15A_BOVIN 40S ribosomal protein S15a OS=Bos taurus GN=RPS15A PE=2 SV=1 1 130 1.0E-68
sp|Q6XIM8|RS15A_DROYA 40S ribosomal protein S15a OS=Drosophila yakuba GN=RpS15Aa PE=2 SV=3 1 130 1.0E-68
sp|P48149|RS15A_DROME 40S ribosomal protein S15Aa OS=Drosophila melanogaster GN=RpS15Aa PE=1 SV=2 1 130 1.0E-68
sp|Q5R938|RS15A_PONAB 40S ribosomal protein S15a OS=Pongo abelii GN=RPS15A PE=2 SV=1 1 130 4.0E-68
sp|Q7KR04|RS15B_DROME 40S ribosomal protein S15Ab OS=Drosophila melanogaster GN=RpS15Ab PE=2 SV=3 1 130 8.0E-67
sp|Q90YQ8|RS15A_ICTPU 40S ribosomal protein S15a OS=Ictalurus punctatus GN=rps15a PE=2 SV=3 1 130 1.0E-66
sp|P0CT59|RS22B_SCHPO 40S ribosomal protein S22-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2202 PE=3 SV=1 1 130 2.0E-66
sp|P0CT58|RS22A_SCHPO 40S ribosomal protein S22-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2201 PE=2 SV=1 1 130 2.0E-66
sp|P33095|RS15A_STRPU 40S ribosomal protein S15a OS=Strongylocentrotus purpuratus GN=RPS15A PE=2 SV=3 1 130 3.0E-66
sp|P50891|RS15A_PARLI 40S ribosomal protein S15a OS=Paracentrotus lividus GN=RPS15A PE=2 SV=2 1 130 1.0E-65
sp|P46792|RS22_AGABI 40S ribosomal protein S22 OS=Agaricus bisporus GN=rps22 PE=2 SV=1 1 130 2.0E-62
sp|P46793|RS15A_DICDI 40S ribosomal protein S15a OS=Dictyostelium discoideum GN=rps15a PE=2 SV=3 1 130 1.0E-61
sp|A8MAJ5|RS8_CALMQ 30S ribosomal protein S8 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps8 PE=3 SV=1 1 130 1.0E-41
sp|Q8U014|RS8_PYRFU 30S ribosomal protein S8 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps8 PE=1 SV=1 1 130 9.0E-41
sp|Q9V1V0|RS8_PYRAB 30S ribosomal protein S8 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps8 PE=3 SV=1 1 130 1.0E-40
sp|O59432|RS8_PYRHO 30S ribosomal protein S8 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps8 PE=3 SV=1 1 130 2.0E-40
sp|A0B9V5|RS8_METTP 30S ribosomal protein S8 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps8 PE=3 SV=1 7 130 3.0E-39
sp|A3CT12|RS8_METMJ 30S ribosomal protein S8 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps8 PE=3 SV=1 1 130 5.0E-39
sp|A2SPL7|RS8_METLZ 30S ribosomal protein S8 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps8 PE=3 SV=1 1 130 7.0E-39
sp|A3DNC2|RS8_STAMF 30S ribosomal protein S8 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps8 PE=3 SV=1 1 130 9.0E-39
sp|B8GKE8|RS8_METPE 30S ribosomal protein S8 OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rps8 PE=3 SV=1 1 130 1.0E-38
sp|C6A175|RS8_THESM 30S ribosomal protein S8 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps8 PE=3 SV=1 1 130 2.0E-38
sp|C5A270|RS8_THEGJ 30S ribosomal protein S8 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps8 PE=3 SV=1 1 130 3.0E-38
sp|B1Y8V5|RS8_PYRNV 30S ribosomal protein S8 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps8 PE=3 SV=1 1 130 8.0E-38
sp|Q46GB0|RS8_METBF 30S ribosomal protein S8 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps8 PE=3 SV=1 1 130 8.0E-38
sp|Q5JJG3|RS8_THEKO 30S ribosomal protein S8 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps8 PE=3 SV=1 1 130 1.0E-37
sp|A3MSJ6|RS8_PYRCJ 30S ribosomal protein S8 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps8 PE=3 SV=1 1 130 1.0E-37
sp|Q8PV35|RS8_METMA 30S ribosomal protein S8 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps8 PE=3 SV=1 1 130 2.0E-37
sp|Q8TRT2|RS8_METAC 30S ribosomal protein S8 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps8 PE=3 SV=1 1 130 2.0E-37
sp|Q977V0|RS8_METIG 30S ribosomal protein S8 OS=Methanotorris igneus GN=rps8 PE=3 SV=1 7 130 2.0E-37
sp|Q0W1X3|RS8_METAR 30S ribosomal protein S8 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps8 PE=3 SV=1 1 130 4.0E-37
sp|B6YSM9|RS8_THEON 30S ribosomal protein S8 OS=Thermococcus onnurineus (strain NA1) GN=rps8 PE=3 SV=1 1 130 4.0E-37
sp|Q9M0E0|R15A5_ARATH 40S ribosomal protein S15a-5 OS=Arabidopsis thaliana GN=RPS15AE PE=2 SV=1 6 130 6.0E-37
sp|Q12ZT6|RS8_METBU 30S ribosomal protein S8 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps8 PE=3 SV=1 1 130 1.0E-36
sp|Q8TW15|RS8_METKA 30S ribosomal protein S8 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps8 PE=3 SV=1 1 130 2.0E-36
sp|A1RVN1|RS8_PYRIL 30S ribosomal protein S8 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps8 PE=3 SV=1 1 130 2.0E-36
sp|B1L781|RS8_KORCO 30S ribosomal protein S8 OS=Korarchaeum cryptofilum (strain OPF8) GN=rps8 PE=3 SV=1 1 130 4.0E-36
sp|P54041|RS8_METJA 30S ribosomal protein S8 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps8 PE=1 SV=1 7 130 4.0E-36
sp|A4WMD9|RS8_PYRAR 30S ribosomal protein S8 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps8 PE=3 SV=1 1 130 4.0E-36
sp|A2BMD4|RS8_HYPBU 30S ribosomal protein S8 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps8 PE=3 SV=1 1 130 5.0E-36
sp|A7I5Q4|RS8_METB6 30S ribosomal protein S8 OS=Methanoregula boonei (strain 6A8) GN=rps8 PE=3 SV=1 1 130 7.0E-36
sp|A1RWS0|RS8_THEPD 30S ribosomal protein S8 OS=Thermofilum pendens (strain Hrk 5) GN=rps8 PE=3 SV=1 7 130 8.0E-36
sp|B8D5V5|RS8_DESK1 30S ribosomal protein S8 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rps8 PE=3 SV=1 1 130 2.0E-35
sp|Q975J5|RS8_SULTO 30S ribosomal protein S8 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps8 PE=3 SV=1 1 130 3.0E-35
sp|Q8ZVW0|RS8_PYRAE 30S ribosomal protein S8 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps8 PE=3 SV=1 1 130 3.0E-35
sp|A4YCY1|RS8_METS5 30S ribosomal protein S8 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps8 PE=3 SV=1 1 130 1.0E-34
sp|O26126|RS8_METTH 30S ribosomal protein S8 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps8 PE=3 SV=2 1 130 3.0E-34
sp|Q9HIS2|RS8_THEAC 30S ribosomal protein S8 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps8 PE=3 SV=1 2 130 7.0E-34
sp|Q9UX92|RS8_SULSO 30S ribosomal protein S8 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps8 PE=3 SV=1 1 130 7.0E-34
sp|O82205|R15A2_ARATH 40S ribosomal protein S15a-2 OS=Arabidopsis thaliana GN=RPS15AB PE=2 SV=1 6 130 1.0E-33
sp|Q97BW1|RS8_THEVO 30S ribosomal protein S8 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps8 PE=3 SV=1 2 130 1.0E-33
sp|C3NEF8|RS8_SULIY 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rps8 PE=3 SV=1 1 130 1.0E-33
sp|C3NH94|RS8_SULIN 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rps8 PE=3 SV=1 1 130 1.0E-33
sp|C3MVJ3|RS8_SULIM 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rps8 PE=3 SV=1 1 130 1.0E-33
sp|C3MQ74|RS8_SULIL 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rps8 PE=3 SV=1 1 130 1.0E-33
sp|C4KHH1|RS8_SULIK 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rps8 PE=3 SV=1 1 130 1.0E-33
sp|C3N5U2|RS8_SULIA 30S ribosomal protein S8 OS=Sulfolobus islandicus (strain M.16.27) GN=rps8 PE=3 SV=1 1 130 1.0E-33
sp|O05636|RS8_SULAC 30S ribosomal protein S8 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps8 PE=3 SV=1 1 130 2.0E-33
sp|A5UL73|RS8_METS3 30S ribosomal protein S8 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps8 PE=3 SV=1 7 130 5.0E-33
sp|Q977U8|RS8_METTL 30S ribosomal protein S8 OS=Methanothermococcus thermolithotrophicus GN=rps8 PE=3 SV=1 7 130 5.0E-33
sp|Q6LXD8|RS8_METMP 30S ribosomal protein S8 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps8 PE=3 SV=1 7 130 9.0E-33
sp|A4FWA6|RS8_METM5 30S ribosomal protein S8 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps8 PE=3 SV=1 7 130 9.0E-33
sp|A6UQ59|RS8_METVS 30S ribosomal protein S8 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps8 PE=3 SV=1 7 130 1.0E-32
sp|P14038|RS8_METVA 30S ribosomal protein S8 OS=Methanococcus vannielii GN=rps8 PE=3 SV=1 7 130 1.0E-32
sp|Q2FSG2|RS8_METHJ 30S ribosomal protein S8 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps8 PE=3 SV=1 1 130 2.0E-32
sp|A9A9P9|RS8_METM6 30S ribosomal protein S8 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps8 PE=3 SV=1 7 130 3.0E-32
sp|A6VH00|RS8_METM7 30S ribosomal protein S8 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps8 PE=3 SV=1 7 130 4.0E-32
sp|Q6L1B2|RS8_PICTO 30S ribosomal protein S8 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps8 PE=3 SV=1 7 130 6.0E-32
sp|Q977U9|RS8_METVO 30S ribosomal protein S8 OS=Methanococcus voltae GN=rps8 PE=3 SV=1 7 130 1.0E-31
sp|A6UWV3|RS8_META3 30S ribosomal protein S8 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps8 PE=3 SV=1 7 130 4.0E-31
sp|B9LSR2|RS8_HALLT 30S ribosomal protein S8 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rps8 PE=3 SV=1 1 130 4.0E-31
sp|Q18GG4|RS8_HALWD 30S ribosomal protein S8 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps8 PE=3 SV=1 1 130 8.0E-31
sp|A8ACD7|RS8_IGNH4 30S ribosomal protein S8 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps8 PE=3 SV=1 1 130 1.0E-30
sp|Q3IMX3|RS8_NATPD 30S ribosomal protein S8 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps8 PE=3 SV=1 1 130 2.0E-30
sp|Q2NFX2|RS8_METST 30S ribosomal protein S8 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps8 PE=3 SV=1 7 130 3.0E-30
sp|O28369|RS8_ARCFU 30S ribosomal protein S8 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps8 PE=3 SV=2 6 130 4.0E-30
sp|Q9HPB9|RS8_HALSA 30S ribosomal protein S8 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps8 PE=3 SV=2 1 130 5.0E-30
sp|B0R671|RS8_HALS3 30S ribosomal protein S8 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps8 PE=3 SV=1 1 130 5.0E-30
sp|P12742|RS8_HALMA 30S ribosomal protein S8 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps8 PE=1 SV=3 1 130 8.0E-30
sp|A9A5I0|RS8_NITMS 30S ribosomal protein S8 OS=Nitrosopumilus maritimus (strain SCM1) GN=rps8 PE=3 SV=1 1 130 4.0E-29
sp|Q9YF89|RS8_AERPE 30S ribosomal protein S8 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps8 PE=3 SV=2 1 130 6.0E-28
sp|A0RVY8|RS8_CENSY 30S ribosomal protein S8 OS=Cenarchaeum symbiosum (strain A) GN=rps8 PE=3 SV=1 1 130 4.0E-25
sp|Q74NG1|RS8_NANEQ 30S ribosomal protein S8 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps8 PE=3 SV=1 6 130 1.0E-22
sp|B2V7J9|RS8_SULSY 30S ribosomal protein S8 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsH PE=3 SV=1 4 130 5.0E-13
sp|B2A4F3|RS8_NATTJ 30S ribosomal protein S8 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsH PE=3 SV=1 1 130 3.0E-12
sp|A8YXL9|RS8_LACH4 30S ribosomal protein S8 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsH PE=3 SV=1 1 130 9.0E-12
sp|Q5FM77|RS8_LACAC 30S ribosomal protein S8 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpsH PE=3 SV=1 1 130 1.0E-11
sp|Q03ZN2|RS8_LEUMM 30S ribosomal protein S8 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsH PE=3 SV=1 1 130 5.0E-11
sp|Q04C01|RS8_LACDB 30S ribosomal protein S8 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsH PE=3 SV=1 1 130 1.0E-10
sp|Q1GBK4|RS8_LACDA 30S ribosomal protein S8 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsH PE=3 SV=1 1 130 1.0E-10
sp|A3DJI6|RS8_CLOTH 30S ribosomal protein S8 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsH PE=3 SV=1 1 130 3.0E-10
sp|Q046B2|RS8_LACGA 30S ribosomal protein S8 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsH PE=3 SV=1 1 130 3.0E-10
sp|Q74L76|RS8_LACJO 30S ribosomal protein S8 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsH PE=3 SV=1 1 130 4.0E-10
sp|B1I1K2|RS8_DESAP 30S ribosomal protein S8 OS=Desulforudis audaxviator (strain MP104C) GN=rpsH PE=3 SV=1 4 130 8.0E-10
sp|B3WAK4|RS8_LACCB 30S ribosomal protein S8 OS=Lactobacillus casei (strain BL23) GN=rpsH PE=3 SV=1 1 130 8.0E-10
sp|Q034Z7|RS8_LACC3 30S ribosomal protein S8 OS=Lactobacillus casei (strain ATCC 334) GN=rpsH PE=3 SV=1 1 130 8.0E-10
sp|C1CPA2|RS8_STRZT 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|C1CIB1|RS8_STRZP 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain P1031) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|C1CC20|RS8_STRZJ 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain JJA) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|P66633|RS8_STRR6 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|B2IS54|RS8_STRPS 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain CGSP14) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|P66632|RS8_STRPN 30S ribosomal protein S8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|B8ZKP4|RS8_STRPJ 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|B1I8L2|RS8_STRPI 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|C1CAM6|RS8_STRP7 30S ribosomal protein S8 OS=Streptococcus pneumoniae (strain 70585) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|Q04MM2|RS8_STRP2 30S ribosomal protein S8 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|B5E6G9|RS8_STRP4 30S ribosomal protein S8 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|Q67JV7|RS8_SYMTH 30S ribosomal protein S8 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|Q8R7W8|RS8_CALS4 30S ribosomal protein S8 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|Q03IG5|RS8_STRTD 30S ribosomal protein S8 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|Q5M2C7|RS8_STRT2 30S ribosomal protein S8 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|Q5LXS5|RS8_STRT1 30S ribosomal protein S8 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpsH PE=3 SV=1 1 130 2.0E-09
sp|B0K5Q7|RS8_THEPX 30S ribosomal protein S8 OS=Thermoanaerobacter sp. (strain X514) GN=rpsH PE=3 SV=1 1 130 3.0E-09
sp|B0KCL4|RS8_THEP3 30S ribosomal protein S8 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsH PE=3 SV=1 1 130 3.0E-09
sp|Q83FZ9|RS8_TROWT 30S ribosomal protein S8 OS=Tropheryma whipplei (strain Twist) GN=rpsH PE=3 SV=1 1 130 4.0E-09
sp|Q83I65|RS8_TROW8 30S ribosomal protein S8 OS=Tropheryma whipplei (strain TW08/27) GN=rpsH PE=3 SV=1 1 130 4.0E-09
sp|Q2RFR1|RS8_MOOTA 30S ribosomal protein S8 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsH PE=3 SV=1 4 130 4.0E-09
sp|C0MCC4|RS8_STRS7 30S ribosomal protein S8 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpsH PE=3 SV=1 1 130 4.0E-09
sp|B4U514|RS8_STREM 30S ribosomal protein S8 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rpsH PE=3 SV=1 1 130 4.0E-09
sp|C0MAG4|RS8_STRE4 30S ribosomal protein S8 OS=Streptococcus equi subsp. equi (strain 4047) GN=rpsH PE=3 SV=1 1 130 4.0E-09
sp|B1MW01|RS8_LEUCK 30S ribosomal protein S8 OS=Leuconostoc citreum (strain KM20) GN=rpsH PE=3 SV=1 1 130 4.0E-09
sp|B9DSW4|RS8_STRU0 30S ribosomal protein S8 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpsH PE=3 SV=1 1 130 5.0E-09
sp|Q5L409|RS8_GEOKA 30S ribosomal protein S8 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsH PE=3 SV=2 1 130 7.0E-09
sp|Q839F0|RS8_ENTFA 30S ribosomal protein S8 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsH PE=3 SV=1 1 130 7.0E-09
sp|A3CK77|RS8_STRSV 30S ribosomal protein S8 OS=Streptococcus sanguinis (strain SK36) GN=rpsH PE=3 SV=1 1 130 7.0E-09
sp|C5CGI8|RS8_KOSOT 30S ribosomal protein S8 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsH PE=3 SV=1 7 130 8.0E-09
sp|A8AZL1|RS8_STRGC 30S ribosomal protein S8 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsH PE=3 SV=1 1 130 8.0E-09
sp|Q1WSA4|RS8_LACS1 30S ribosomal protein S8 OS=Lactobacillus salivarius (strain UCC118) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|B4UBB3|RS8_ANASK 30S ribosomal protein S8 OS=Anaeromyxobacter sp. (strain K) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|B8J874|RS8_ANAD2 30S ribosomal protein S8 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|A9NEE7|RS8_ACHLI 30S ribosomal protein S8 OS=Acholeplasma laidlawii (strain PG-8A) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|Q0AUJ4|RS8_SYNWW 30S ribosomal protein S8 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsH PE=3 SV=1 1 130 1.0E-08
sp|C0QQN7|RS8_PERMH 30S ribosomal protein S8 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsH PE=3 SV=1 4 130 2.0E-08
sp|Q21M44|RS8_SACD2 30S ribosomal protein S8 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsH PE=3 SV=1 7 126 2.0E-08
sp|Q8YPJ2|RS8_NOSS1 30S ribosomal protein S8 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|A7HBN2|RS8_ANADF 30S ribosomal protein S8 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|Q82X77|RS8_NITEU 30S ribosomal protein S8 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpsH PE=3 SV=1 1 126 2.0E-08
sp|Q8E7S7|RS8_STRA3 30S ribosomal protein S8 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|Q3K3V5|RS8_STRA1 30S ribosomal protein S8 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpsH PE=3 SV=1 1 130 2.0E-08
sp|A9BG04|RS8_PETMO 30S ribosomal protein S8 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpsH PE=3 SV=1 7 130 2.0E-08
sp|Q3A9T0|RS8_CARHZ 30S ribosomal protein S8 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|A4IJK2|RS8_GEOTN 30S ribosomal protein S8 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|P0DF01|RS8_STRPQ 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q48VT5|RS8_STRPM 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|A2RC28|RS8_STRPG 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q1J8Z9|RS8_STRPF 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q1JJ48|RS8_STRPD 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q1JP03|RS8_STRPC 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q1JE45|RS8_STRPB 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|P66636|RS8_STRP8 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q5XEC1|RS8_STRP6 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|P0DF00|RS8_STRP3 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|P66634|RS8_STRP1 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M1 GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q2IJ72|RS8_ANADE 30S ribosomal protein S8 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q8E2C0|RS8_STRA5 30S ribosomal protein S8 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|B7GJ81|RS8_ANOFW 30S ribosomal protein S8 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsH PE=3 SV=1 1 130 3.0E-08
sp|Q98PZ6|RS8_MYCPU 30S ribosomal protein S8 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsH PE=3 SV=1 4 130 3.0E-08
sp|Q9Z9K0|RS8_BACHD 30S ribosomal protein S8 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsH PE=3 SV=3 1 130 4.0E-08
sp|Q65P93|RS8_BACLD 30S ribosomal protein S8 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsH PE=3 SV=1 1 130 4.0E-08
sp|A4SSZ2|RS8_AERS4 30S ribosomal protein S8 OS=Aeromonas salmonicida (strain A449) GN=rpsH PE=3 SV=1 7 128 4.0E-08
sp|B0V6V9|RS8_ACIBY 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain AYE) GN=rpsH PE=3 SV=1 6 128 4.0E-08
sp|A3M970|RS8_ACIBT 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsH PE=3 SV=2 6 128 4.0E-08
sp|B0VQT2|RS8_ACIBS 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain SDF) GN=rpsH PE=3 SV=1 6 128 4.0E-08
sp|B7IA25|RS8_ACIB5 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain AB0057) GN=rpsH PE=3 SV=1 6 128 4.0E-08
sp|B7GW16|RS8_ACIB3 30S ribosomal protein S8 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsH PE=3 SV=1 6 128 4.0E-08
sp|Q3MFA8|RS8_ANAVT 30S ribosomal protein S8 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsH PE=3 SV=1 1 130 4.0E-08
sp|C5D3T1|RS8_GEOSW 30S ribosomal protein S8 OS=Geobacillus sp. (strain WCH70) GN=rpsH PE=3 SV=1 1 130 5.0E-08
sp|Q3BWW9|RS8_XANC5 30S ribosomal protein S8 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsH PE=3 SV=1 1 128 5.0E-08
sp|A4J125|RS8_DESRM 30S ribosomal protein S8 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsH PE=3 SV=1 1 130 5.0E-08
sp|A4XLR6|RS8_CALS8 30S ribosomal protein S8 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsH PE=3 SV=1 7 130 5.0E-08
sp|B5XJ50|RS8_STRPZ 30S ribosomal protein S8 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=rpsH PE=3 SV=1 1 130 5.0E-08
sp|B1VAD4|RS8_PHYAS 30S ribosomal protein S8 OS=Phytoplasma australiense GN=rpsH PE=3 SV=1 1 130 5.0E-08
sp|A5D5G8|RS8_PELTS 30S ribosomal protein S8 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsH PE=3 SV=1 1 130 6.0E-08
sp|Q1D761|RS8_MYXXD 30S ribosomal protein S8 OS=Myxococcus xanthus (strain DK 1622) GN=rpsH PE=3 SV=1 9 130 6.0E-08
sp|A0KF35|RS8_AERHH 30S ribosomal protein S8 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsH PE=3 SV=1 7 128 7.0E-08
sp|C4KZN2|RS8_EXISA 30S ribosomal protein S8 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|A4VSG7|RS8_STRSY 30S ribosomal protein S8 OS=Streptococcus suis (strain 05ZYH33) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|A4VYQ6|RS8_STRS2 30S ribosomal protein S8 OS=Streptococcus suis (strain 98HAH33) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|Q2NIW8|RS8_AYWBP 30S ribosomal protein S8 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|C0ZIJ4|RS8_BREBN 30S ribosomal protein S8 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rpsH PE=3 SV=1 1 130 7.0E-08
sp|Q6YR08|RS8_ONYPE 30S ribosomal protein S8 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|Q8ETW9|RS8_OCEIH 30S ribosomal protein S8 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|B5YG33|RS8_THEYD 30S ribosomal protein S8 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsH PE=3 SV=1 4 130 1.0E-07
sp|A6LEH7|RS8_PARD8 30S ribosomal protein S8 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsH PE=3 SV=1 4 130 1.0E-07
sp|B9K8A0|RS8_THENN 30S ribosomal protein S8 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsH PE=3 SV=1 7 130 1.0E-07
sp|P12879|RS8_BACSU 30S ribosomal protein S8 OS=Bacillus subtilis (strain 168) GN=rpsH PE=1 SV=4 1 130 1.0E-07
sp|Q9ZAE5|RS8_THEMA 30S ribosomal protein S8 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsH PE=3 SV=2 7 130 1.0E-07
sp|B6YQ71|RS8_AZOPC 30S ribosomal protein S8 OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpsH PE=3 SV=1 4 130 1.0E-07
sp|B0JHZ0|RS8_MICAN 30S ribosomal protein S8 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|A0ALV4|RS8_LISW6 30S ribosomal protein S8 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|P66623|RS8_LISMO 30S ribosomal protein S8 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|B8DB22|RS8_LISMH 30S ribosomal protein S8 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|Q71WG0|RS8_LISMF 30S ribosomal protein S8 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|C1KZG6|RS8_LISMC 30S ribosomal protein S8 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|P66624|RS8_LISIN 30S ribosomal protein S8 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|B0TC70|RS8_HELMI 30S ribosomal protein S8 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|Q05HS7|RS8_XANOR 30S ribosomal protein S8 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsH PE=3 SV=1 1 128 1.0E-07
sp|Q2NZZ9|RS8_XANOM 30S ribosomal protein S8 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsH PE=3 SV=1 1 128 1.0E-07
sp|Q38US5|RS8_LACSS 30S ribosomal protein S8 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|Q0AII2|RS8_NITEC 30S ribosomal protein S8 OS=Nitrosomonas eutropha (strain C91) GN=rpsH PE=3 SV=1 1 126 1.0E-07
sp|A8F999|RS8_BACP2 30S ribosomal protein S8 OS=Bacillus pumilus (strain SAFR-032) GN=rpsH PE=3 SV=1 1 130 1.0E-07
sp|B2S2F0|RS8_TREPS 30S ribosomal protein S8 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsH PE=3 SV=1 9 126 1.0E-07
sp|O83233|RS8_TREPA 30S ribosomal protein S8 OS=Treponema pallidum (strain Nichols) GN=rpsH PE=3 SV=1 9 126 1.0E-07
sp|A7Z0Q2|RS8_BACMF 30S ribosomal protein S8 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsH PE=3 SV=1 1 130 2.0E-07
sp|Q1AU43|RS8_RUBXD 30S ribosomal protein S8 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsH PE=3 SV=1 7 130 2.0E-07
sp|B9JVQ1|RS8_AGRVS 30S ribosomal protein S8 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsH PE=3 SV=1 1 126 2.0E-07
sp|P56209|RS8_GEOSE 30S ribosomal protein S8 OS=Geobacillus stearothermophilus GN=rpsH PE=1 SV=2 1 128 2.0E-07
sp|Q04G72|RS8_OENOB 30S ribosomal protein S8 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsH PE=3 SV=1 1 130 3.0E-07
sp|B1LBM6|RS8_THESQ 30S ribosomal protein S8 OS=Thermotoga sp. (strain RQ2) GN=rpsH PE=3 SV=1 7 130 3.0E-07
sp|A5IM97|RS8_THEP1 30S ribosomal protein S8 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsH PE=3 SV=1 7 130 3.0E-07
sp|B1YGW4|RS8_EXIS2 30S ribosomal protein S8 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpsH PE=3 SV=1 1 130 3.0E-07
sp|Q6F7S6|RS8_ACIAD 30S ribosomal protein S8 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsH PE=3 SV=1 6 128 3.0E-07
sp|Q03PX1|RS8_LACBA 30S ribosomal protein S8 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsH PE=3 SV=1 1 130 4.0E-07
sp|Q8DS27|RS8_STRMU 30S ribosomal protein S8 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpsH PE=3 SV=1 1 130 4.0E-07
sp|B9MKG7|RS8_CALBD 30S ribosomal protein S8 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsH PE=3 SV=1 7 130 4.0E-07
sp|B3EUK9|RS8_AMOA5 30S ribosomal protein S8 OS=Amoebophilus asiaticus (strain 5a2) GN=rpsH PE=3 SV=1 4 130 5.0E-07
sp|B4SKX7|RS8_STRM5 30S ribosomal protein S8 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsH PE=3 SV=1 1 128 5.0E-07
sp|B2FQJ8|RS8_STRMK 30S ribosomal protein S8 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsH PE=3 SV=1 1 128 5.0E-07
sp|B3E7U9|RS8_GEOLS 30S ribosomal protein S8 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsH PE=3 SV=1 1 130 6.0E-07
sp|A8SED9|RR8_CERDE 30S ribosomal protein S8, chloroplastic OS=Ceratophyllum demersum GN=rps8 PE=3 SV=1 6 130 7.0E-07
sp|Q2W2K5|RS8_MAGSA 30S ribosomal protein S8 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsH PE=3 SV=1 1 126 7.0E-07
sp|B8HMR7|RS8_CYAP4 30S ribosomal protein S8 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rpsH PE=3 SV=1 1 130 8.0E-07
sp|Q605C6|RS8_METCA 30S ribosomal protein S8 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsH PE=3 SV=1 1 126 8.0E-07
sp|A7GK34|RS8_BACCN 30S ribosomal protein S8 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsH PE=3 SV=1 1 130 9.0E-07
sp|Q4AAF4|RS8_MYCHJ 30S ribosomal protein S8 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpsH PE=3 SV=1 4 130 9.0E-07
sp|Q4A8I5|RS8_MYCH7 30S ribosomal protein S8 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpsH PE=3 SV=1 4 130 9.0E-07
sp|Q601K0|RS8_MYCH2 30S ribosomal protein S8 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpsH PE=3 SV=2 4 130 9.0E-07
sp|Q890P9|RS8_CLOTE 30S ribosomal protein S8 OS=Clostridium tetani (strain Massachusetts / E88) GN=rpsH PE=3 SV=1 1 130 9.0E-07
sp|Q4G354|RR8_EMIHU 30S ribosomal protein S8, chloroplastic OS=Emiliania huxleyi GN=rps8 PE=3 SV=1 6 129 9.0E-07
sp|Q02W39|RS8_LACLS 30S ribosomal protein S8 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|A2RNN9|RS8_LACLM 30S ribosomal protein S8 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|Q11HR6|RS8_CHESB 30S ribosomal protein S8 OS=Chelativorans sp. (strain BNC1) GN=rpsH PE=3 SV=1 7 126 1.0E-06
sp|Q9CDX7|RS8_LACLA 30S ribosomal protein S8 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|A5N4R1|RS8_CLOK5 30S ribosomal protein S8 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|B9DYC3|RS8_CLOK1 30S ribosomal protein S8 OS=Clostridium kluyveri (strain NBRC 12016) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|Q03ED0|RS8_PEDPA 30S ribosomal protein S8 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|B3PMN3|RS8_MYCA5 30S ribosomal protein S8 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rpsH PE=3 SV=1 29 130 1.0E-06
sp|A1ALV5|RS8_PELPD 30S ribosomal protein S8 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsH PE=3 SV=1 1 130 1.0E-06
sp|B2VK82|RS8_ERWT9 30S ribosomal protein S8 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsH PE=3 SV=1 7 128 1.0E-06
sp|Q488Z9|RS8_COLP3 30S ribosomal protein S8 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsH PE=3 SV=1 4 128 1.0E-06
sp|A6LLM7|RS8_THEM4 30S ribosomal protein S8 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsH PE=3 SV=1 7 130 2.0E-06
sp|B7IHW0|RS8_THEAB 30S ribosomal protein S8 OS=Thermosipho africanus (strain TCF52B) GN=rpsH PE=3 SV=1 7 130 2.0E-06
sp|A0LIK4|RS8_SYNFM 30S ribosomal protein S8 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsH PE=3 SV=1 1 130 2.0E-06
sp|A5V5Y8|RS8_SPHWW 30S ribosomal protein S8 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsH PE=3 SV=1 1 130 2.0E-06
sp|A5IYX2|RS8_MYCAP 30S ribosomal protein S8 OS=Mycoplasma agalactiae (strain PG2) GN=rpsH PE=3 SV=1 1 130 2.0E-06
sp|Q2N9C5|RS8_ERYLH 30S ribosomal protein S8 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsH PE=3 SV=1 1 130 2.0E-06
sp|Q85FV0|RR8_CYAME 30S ribosomal protein S8, chloroplastic OS=Cyanidioschyzon merolae GN=rps8 PE=3 SV=1 7 130 2.0E-06
sp|O24702|RS8_SYNP6 30S ribosomal protein S8 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsH PE=3 SV=1 7 130 2.0E-06
sp|Q31L20|RS8_SYNE7 30S ribosomal protein S8 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsH PE=3 SV=1 7 130 2.0E-06
sp|A8MLF4|RS8_ALKOO 30S ribosomal protein S8 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsH PE=3 SV=1 1 130 2.0E-06
sp|B5ZB54|RS8_UREU1 30S ribosomal protein S8 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsH PE=3 SV=1 7 130 2.0E-06
sp|Q9PQP6|RS8_UREPA 30S ribosomal protein S8 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsH PE=3 SV=1 7 130 2.0E-06
sp|B1AIN4|RS8_UREP2 30S ribosomal protein S8 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsH PE=3 SV=1 7 130 2.0E-06
sp|A0T0J2|RR8_PHATC 30S ribosomal protein S8, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps8 PE=3 SV=1 7 130 2.0E-06
sp|Q2RQX4|RS8_RHORT 30S ribosomal protein S8 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsH PE=3 SV=1 1 126 2.0E-06
sp|B1HMW6|RS8_LYSSC 30S ribosomal protein S8 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsH PE=3 SV=1 1 130 2.0E-06
sp|A1KB13|RS8_AZOSB 30S ribosomal protein S8 OS=Azoarcus sp. (strain BH72) GN=rpsH PE=3 SV=1 1 126 2.0E-06
sp|A9KD17|RS8_COXBN 30S ribosomal protein S8 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsH PE=3 SV=1 7 129 2.0E-06
sp|Q6CZY4|RS8_PECAS 30S ribosomal protein S8 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsH PE=3 SV=1 7 128 3.0E-06
sp|A6LPS5|RS8_CLOB8 30S ribosomal protein S8 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q83ER2|RS8_COXBU 30S ribosomal protein S8 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsH PE=3 SV=1 7 129 3.0E-06
sp|A9NAY4|RS8_COXBR 30S ribosomal protein S8 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsH PE=3 SV=1 7 129 3.0E-06
sp|Q6HPP4|RS8_BACHK 30S ribosomal protein S8 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q63H76|RS8_BACCZ 30S ribosomal protein S8 OS=Bacillus cereus (strain ZK / E33L) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q81J28|RS8_BACCR 30S ribosomal protein S8 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B9IZK8|RS8_BACCQ 30S ribosomal protein S8 OS=Bacillus cereus (strain Q1) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B7HQV8|RS8_BACC7 30S ribosomal protein S8 OS=Bacillus cereus (strain AH187) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B7HJ62|RS8_BACC4 30S ribosomal protein S8 OS=Bacillus cereus (strain B4264) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|C1ET53|RS8_BACC3 30S ribosomal protein S8 OS=Bacillus cereus (strain 03BB102) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B7IT33|RS8_BACC2 30S ribosomal protein S8 OS=Bacillus cereus (strain G9842) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q73F82|RS8_BACC1 30S ribosomal protein S8 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B7JKD3|RS8_BACC0 30S ribosomal protein S8 OS=Bacillus cereus (strain AH820) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|Q81VR6|RS8_BACAN 30S ribosomal protein S8 OS=Bacillus anthracis GN=rpsH PE=1 SV=1 1 130 3.0E-06
sp|A0R8J4|RS8_BACAH 30S ribosomal protein S8 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsH PE=3 SV=2 1 130 3.0E-06
sp|C3LJ96|RS8_BACAC 30S ribosomal protein S8 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|C3P9R9|RS8_BACAA 30S ribosomal protein S8 OS=Bacillus anthracis (strain A0248) GN=rpsH PE=3 SV=1 1 130 3.0E-06
sp|B6IRS0|RS8_RHOCS 30S ribosomal protein S8 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpsH PE=3 SV=1 4 126 3.0E-06
sp|Q6XYX4|RS8_SPIKU 30S ribosomal protein S8 OS=Spiroplasma kunkelii GN=rpsH PE=3 SV=1 7 130 3.0E-06
sp|A0QSG3|RS8_MYCS2 30S ribosomal protein S8 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsH PE=1 SV=1 1 130 4.0E-06
sp|A0PM79|RS8_MYCUA 30S ribosomal protein S8 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsH PE=3 SV=1 1 130 4.0E-06
sp|B2HCT5|RS8_MYCMM 30S ribosomal protein S8 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsH PE=3 SV=1 1 130 4.0E-06
sp|C6DG60|RS8_PECCP 30S ribosomal protein S8 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpsH PE=3 SV=1 7 128 4.0E-06
sp|Q8DML9|RS8_THEEB 30S ribosomal protein S8 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsH PE=3 SV=1 1 130 5.0E-06
sp|A4GYU6|RR8_POPTR 30S ribosomal protein S8, chloroplastic OS=Populus trichocarpa GN=rps8 PE=3 SV=1 6 130 5.0E-06
sp|Q14FC2|RR8_POPAL 30S ribosomal protein S8, chloroplastic OS=Populus alba GN=rps8 PE=3 SV=1 6 130 5.0E-06
sp|Q73S95|RS8_MYCPA 30S ribosomal protein S8 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsH PE=3 SV=1 1 130 5.0E-06
sp|A0QKZ8|RS8_MYCA1 30S ribosomal protein S8 OS=Mycobacterium avium (strain 104) GN=rpsH PE=3 SV=2 1 130 5.0E-06
sp|Q47LK7|RS8_THEFY 30S ribosomal protein S8 OS=Thermobifida fusca (strain YX) GN=rpsH PE=3 SV=1 1 130 5.0E-06
sp|Q7UZV7|RS8_PROMP 30S ribosomal protein S8 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpsH PE=3 SV=1 7 130 5.0E-06
sp|Q4L8A0|RS8_STAHJ 30S ribosomal protein S8 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsH PE=3 SV=1 1 130 5.0E-06
sp|Q3YWV3|RS8_SHISS 30S ribosomal protein S8 OS=Shigella sonnei (strain Ss046) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|P0A7X2|RS8_SHIFL 30S ribosomal protein S8 OS=Shigella flexneri GN=rpsH PE=3 SV=2 7 128 6.0E-06
sp|Q0SZZ6|RS8_SHIF8 30S ribosomal protein S8 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|Q32B45|RS8_SHIDS 30S ribosomal protein S8 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|Q31VX0|RS8_SHIBS 30S ribosomal protein S8 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B2U2S4|RS8_SHIB3 30S ribosomal protein S8 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|P0A7X0|RS8_SALTY 30S ribosomal protein S8 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsH PE=3 SV=2 7 128 6.0E-06
sp|P0A7X1|RS8_SALTI 30S ribosomal protein S8 OS=Salmonella typhi GN=rpsH PE=3 SV=2 7 128 6.0E-06
sp|B4TXC8|RS8_SALSV 30S ribosomal protein S8 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B5BGX2|RS8_SALPK 30S ribosomal protein S8 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|A9MSY4|RS8_SALPB 30S ribosomal protein S8 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|Q5PIU7|RS8_SALPA 30S ribosomal protein S8 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsH PE=3 SV=3 7 128 6.0E-06
sp|B4SUS6|RS8_SALNS 30S ribosomal protein S8 OS=Salmonella newport (strain SL254) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B4TKK1|RS8_SALHS 30S ribosomal protein S8 OS=Salmonella heidelberg (strain SL476) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B5RH29|RS8_SALG2 30S ribosomal protein S8 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B5R1G3|RS8_SALEP 30S ribosomal protein S8 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B5FJK0|RS8_SALDC 30S ribosomal protein S8 OS=Salmonella dublin (strain CT_02021853) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|Q57J46|RS8_SALCH 30S ribosomal protein S8 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B5F7T1|RS8_SALA4 30S ribosomal protein S8 OS=Salmonella agona (strain SL483) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B7LRS2|RS8_ESCF3 30S ribosomal protein S8 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|Q1R622|RS8_ECOUT 30S ribosomal protein S8 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B1LHC0|RS8_ECOSM 30S ribosomal protein S8 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B6I220|RS8_ECOSE 30S ribosomal protein S8 OS=Escherichia coli (strain SE11) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B7NDS7|RS8_ECOLU 30S ribosomal protein S8 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|P0A7W7|RS8_ECOLI 30S ribosomal protein S8 OS=Escherichia coli (strain K12) GN=rpsH PE=1 SV=2 7 128 6.0E-06
sp|B1IPZ3|RS8_ECOLC 30S ribosomal protein S8 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|P0A7W8|RS8_ECOL6 30S ribosomal protein S8 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsH PE=3 SV=2 7 128 6.0E-06
sp|Q0TCF5|RS8_ECOL5 30S ribosomal protein S8 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|A1AGJ5|RS8_ECOK1 30S ribosomal protein S8 OS=Escherichia coli O1:K1 / APEC GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|A8A5B1|RS8_ECOHS 30S ribosomal protein S8 OS=Escherichia coli O9:H4 (strain HS) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B1X6F8|RS8_ECODH 30S ribosomal protein S8 OS=Escherichia coli (strain K12 / DH10B) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|C4ZUG1|RS8_ECOBW 30S ribosomal protein S8 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B7M1M0|RS8_ECO8A 30S ribosomal protein S8 OS=Escherichia coli O8 (strain IAI1) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B7N190|RS8_ECO81 30S ribosomal protein S8 OS=Escherichia coli O81 (strain ED1a) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B7NLM5|RS8_ECO7I 30S ribosomal protein S8 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B5YTM7|RS8_ECO5E 30S ribosomal protein S8 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|P0A7W9|RS8_ECO57 30S ribosomal protein S8 OS=Escherichia coli O157:H7 GN=rpsH PE=3 SV=2 7 128 6.0E-06
sp|B7L4J4|RS8_ECO55 30S ribosomal protein S8 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B7MCS1|RS8_ECO45 30S ribosomal protein S8 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|B7UK30|RS8_ECO27 30S ribosomal protein S8 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|A7ZSJ5|RS8_ECO24 30S ribosomal protein S8 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|A8AQK2|RS8_CITK8 30S ribosomal protein S8 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsH PE=3 SV=1 7 128 6.0E-06
sp|O32997|RS8_MYCLE 30S ribosomal protein S8 OS=Mycobacterium leprae (strain TN) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|B8ZSA5|RS8_MYCLB 30S ribosomal protein S8 OS=Mycobacterium leprae (strain Br4923) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|A6KYI1|RS8_BACV8 30S ribosomal protein S8 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsH PE=3 SV=1 4 130 6.0E-06
sp|Q318J7|RS8_PROM9 30S ribosomal protein S8 OS=Prochlorococcus marinus (strain MIT 9312) GN=rpsH PE=3 SV=1 7 130 6.0E-06
sp|Q8CRH4|RS8_STAES 30S ribosomal protein S8 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|Q5HM13|RS8_STAEQ 30S ribosomal protein S8 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|P9WH27|RS8_MYCTU 30S ribosomal protein S8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rpsH PE=1 SV=1 1 130 6.0E-06
sp|P9WH26|RS8_MYCTO 30S ribosomal protein S8 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|A5U0A4|RS8_MYCTA 30S ribosomal protein S8 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|C1AL52|RS8_MYCBT 30S ribosomal protein S8 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|A1KGJ9|RS8_MYCBP 30S ribosomal protein S8 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|P66626|RS8_MYCBO 30S ribosomal protein S8 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|B0RZS3|RS8_FINM2 30S ribosomal protein S8 OS=Finegoldia magna (strain ATCC 29328) GN=rpsH PE=3 SV=1 4 130 6.0E-06
sp|Q3A6N3|RS8_PELCD 30S ribosomal protein S8 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsH PE=3 SV=1 1 130 6.0E-06
sp|Q88XX2|RS8_LACPL 30S ribosomal protein S8 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsH PE=3 SV=1 4 130 8.0E-06
sp|Q2G8W6|RS8_NOVAD 30S ribosomal protein S8 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsH PE=3 SV=1 1 130 8.0E-06
sp|Q3SLN5|RS8_THIDA 30S ribosomal protein S8 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpsH PE=3 SV=1 1 128 8.0E-06
sp|A6H5L7|RR8_CYCTA 30S ribosomal protein S8, chloroplastic OS=Cycas taitungensis GN=rps8 PE=3 SV=1 6 128 9.0E-06
sp|Q250L8|RS8_DESHY 30S ribosomal protein S8 OS=Desulfitobacterium hafniense (strain Y51) GN=rpsH PE=3 SV=1 1 130 9.0E-06
sp|B8G1Y0|RS8_DESHD 30S ribosomal protein S8 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpsH PE=3 SV=1 1 130 9.0E-06
sp|Q5WLP8|RS8_BACSK 30S ribosomal protein S8 OS=Bacillus clausii (strain KSM-K16) GN=rpsH PE=3 SV=1 1 130 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup723
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3839
Ophiocordyceps australis map64 (Brazil) OphauB2|5681
Ophiocordyceps camponoti-floridani Ophcf2|04963
Ophiocordyceps camponoti-rufipedis Ophun1|5586 (this protein)
Ophiocordyceps kimflemingae Ophio5|6105
Ophiocordyceps subramaniannii Hirsu2|1715

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5586
MVRTSVLHDALNNINNAEKAGKRQVMIRPSSKVIIKFLQVMQRHGYIGEFEEVDDHRSGKIVVQLNGRLNKTGVI
SPRYNVRLADLEKWVVKLLPARQFGYVILTTSAGIMDHEEARRKHVAGKIIGFFY*
Coding >Ophun1|5586
ATGGTCCGCACTTCGGTTCTCCACGATGCCCTCAACAACATCAACAATGCCGAAAAGGCCGGCAAGCGCCAGGTC
ATGATCCGACCCAGCTCCAAGGTCATTATCAAGTTTCTGCAGGTGATGCAGCGCCACGGCTACATTGGCGAGTTT
GAAGAGGTGGATGATCACCGATCCGGCAAGATTGTTGTGCAGCTCAATGGTCGCCTCAACAAGACGGGCGTCATC
TCTCCCCGGTACAACGTCCGCCTGGCCGATCTGGAGAAATGGGTCGTCAAGCTGCTACCCGCTCGTCAGTTCGGA
TACGTCATCCTGACGACGTCGGCTGGCATCATGGACCACGAAGAGGCGCGTCGGAAGCATGTCGCCGGCAAGATT
ATTGGCTTCTTCTACTAG
Transcript >Ophun1|5586
ATGGTCCGCACTTCGGTTCTCCACGATGCCCTCAACAACATCAACAATGCCGAAAAGGCCGGCAAGCGCCAGGTC
ATGATCCGACCCAGCTCCAAGGTCATTATCAAGTTTCTGCAGGTGATGCAGCGCCACGGCTACATTGGCGAGTTT
GAAGAGGTGGATGATCACCGATCCGGCAAGATTGTTGTGCAGCTCAATGGTCGCCTCAACAAGACGGGCGTCATC
TCTCCCCGGTACAACGTCCGCCTGGCCGATCTGGAGAAATGGGTCGTCAAGCTGCTACCCGCTCGTCAGTTCGGA
TACGTCATCCTGACGACGTCGGCTGGCATCATGGACCACGAAGAGGCGCGTCGGAAGCATGTCGCCGGCAAGATT
ATTGGCTTCTTCTACTAG
Gene >Ophun1|5586
ATGGTCCGCACTTCGGTTCTCCACGATGCCCTCAACAACATCAACAATGCCGAAAAGGCCGGCAAGCGCCAGGTC
ATGATCCGACCCAGCTCCAAGGTCATTATCAAGTTTCTGCAGGTGATGCAGCGCCACGGTATGTGACGACTTTGT
CGGATTTGCTCTTCCTCGTCGCGTGGGTTCTGGCTCCTCCTTCGGCATGATAACTAGGGCGACGGTCTACATGCT
CCCACGACCCAGCTCTTATAAACTGCCGATAGATAGAATCCCTGCGATGGTCTCGAATTGGTTGATTCCACGCCA
GCCATCGTGACAACTCTCGAGCTCAGCGCAACACGCTAACACCATCCTTGCAGGCTACATTGGCGAGTTTGAAGA
GGTGGATGATCACCGATCCGGCAAGATTGTTGTGCAGCTCAATGGTCGCCTCAACAAGACGGGCGTCATCTCTCC
CCGGTACAACGTCCGCCTGGCCGATCTGGAGAAATGGGTCGTCAAGCTGCTACCCGCTCGTCAGTTCGGATACGT
CATCCTGACGACGTCGGCTGGCATCATGGACCACGAAGAGGCGCGTCGGAAGCATGTCGCCGGCAAGATTATTGG
CTTCTTCTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail