Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5581
Gene name
LocationContig_56:20684..25245
Strand-
Gene length (bp)4561
Transcript length (bp)3480
Coding sequence length (bp)3480
Protein length (aa) 1160

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01142 TruD tRNA pseudouridine synthase D (TruD) 3.1E-55 714 1145
PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A 5.2E-10 229 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08647|PUS7_YEAST Multisubstrate pseudouridine synthase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUS7 PE=1 SV=1 561 1146 8.0E-90
sp|O74343|YH2X_SCHPO Putative pseudouridine synthase C1A4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1A4.09 PE=3 SV=1 561 1146 6.0E-82
sp|Q08DI8|PUS7_BOVIN Pseudouridylate synthase 7 homolog OS=Bos taurus GN=PUS7 PE=2 SV=1 561 1146 7.0E-71
sp|Q96PZ0|PUS7_HUMAN Pseudouridylate synthase 7 homolog OS=Homo sapiens GN=PUS7 PE=1 SV=2 561 1146 9.0E-71
sp|Q8CE46|PUS7L_MOUSE Pseudouridylate synthase 7 homolog-like protein OS=Mus musculus GN=Pus7l PE=1 SV=1 608 1149 6.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08647|PUS7_YEAST Multisubstrate pseudouridine synthase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUS7 PE=1 SV=1 561 1146 8.0E-90
sp|O74343|YH2X_SCHPO Putative pseudouridine synthase C1A4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1A4.09 PE=3 SV=1 561 1146 6.0E-82
sp|Q08DI8|PUS7_BOVIN Pseudouridylate synthase 7 homolog OS=Bos taurus GN=PUS7 PE=2 SV=1 561 1146 7.0E-71
sp|Q96PZ0|PUS7_HUMAN Pseudouridylate synthase 7 homolog OS=Homo sapiens GN=PUS7 PE=1 SV=2 561 1146 9.0E-71
sp|Q8CE46|PUS7L_MOUSE Pseudouridylate synthase 7 homolog-like protein OS=Mus musculus GN=Pus7l PE=1 SV=1 608 1149 6.0E-49
sp|Q9H0K6|PUS7L_HUMAN Pseudouridylate synthase 7 homolog-like protein OS=Homo sapiens GN=PUS7L PE=1 SV=1 657 1146 6.0E-46
sp|Q1L8I0|PUS7L_DANRE Pseudouridylate synthase 7 homolog-like protein OS=Danio rerio GN=pus7l PE=2 SV=1 658 1146 2.0E-41
sp|Q17426|YQ4B_CAEEL Putative pseudouridine synthase B0024.11 OS=Caenorhabditis elegans GN=B0024.11 PE=3 SV=1 650 1147 4.0E-36
sp|A6UV17|TRUD_META3 Probable tRNA pseudouridine synthase D OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=truD PE=3 SV=1 719 996 2.0E-27
sp|Q8Q0M2|TRUD_METMA Probable tRNA pseudouridine synthase D OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=truD PE=1 SV=1 718 1146 7.0E-26
sp|Q466V2|TRUD_METBF Probable tRNA pseudouridine synthase D OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=truD PE=3 SV=1 718 1146 2.0E-25
sp|Q12WH6|TRUD_METBU Probable tRNA pseudouridine synthase D OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=truD PE=3 SV=1 718 1016 6.0E-25
sp|Q8TKX2|TRUD_METAC Probable tRNA pseudouridine synthase D OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=truD PE=3 SV=1 719 1146 7.0E-25
sp|O28596|TRUD_ARCFU Probable tRNA pseudouridine synthase D OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=truD PE=3 SV=1 718 1146 3.0E-24
sp|A4FYL2|TRUD_METM5 Probable tRNA pseudouridine synthase D OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=truD PE=3 SV=1 712 1001 1.0E-23
sp|Q58008|TRUD1_METJA Probable tRNA pseudouridine synthase D 1 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=truD1 PE=3 SV=2 719 1001 2.0E-23
sp|Q6LZL0|TRUD2_METMP Probable tRNA pseudouridine synthase D 2 OS=Methanococcus maripaludis (strain S2 / LL) GN=truD2 PE=3 SV=2 712 1001 8.0E-23
sp|Q8TXJ7|TRUD_METKA Probable tRNA pseudouridine synthase D OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=truD PE=3 SV=1 722 982 3.0E-21
sp|A6USB0|TRUD_METVS Probable tRNA pseudouridine synthase D OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=truD PE=3 SV=1 719 996 4.0E-21
sp|Q6L1R2|TRUD_PICTO Probable tRNA pseudouridine synthase D OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=truD PE=3 SV=1 730 1146 1.0E-20
sp|Q9HLL3|TRUD_THEAC Probable tRNA pseudouridine synthase D OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=truD PE=3 SV=1 730 987 5.0E-20
sp|C5A1W0|TRUD_THEGJ Probable tRNA pseudouridine synthase D OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=truD PE=3 SV=1 722 984 7.0E-20
sp|O27572|TRUD_METTH Probable tRNA pseudouridine synthase D OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=truD PE=3 SV=1 726 1018 1.0E-19
sp|Q5V1E6|TRUD_HALMA Probable tRNA pseudouridine synthase D OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=truD PE=3 SV=1 712 1001 3.0E-19
sp|C6A1K9|TRUD_THESM Probable tRNA pseudouridine synthase D OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=truD PE=3 SV=1 720 996 4.0E-19
sp|Q978K9|TRUD_THEVO Probable tRNA pseudouridine synthase D OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=truD PE=3 SV=1 730 1064 1.0E-18
sp|A1RRV7|TRUD_PYRIL Probable tRNA pseudouridine synthase D OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=truD PE=3 SV=1 709 1146 1.0E-17
sp|Q5JDB6|TRUD_THEKO Probable tRNA pseudouridine synthase D OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=truD PE=3 SV=1 718 984 2.0E-17
sp|B6YTE4|TRUD_THEON Probable tRNA pseudouridine synthase D OS=Thermococcus onnurineus (strain NA1) GN=truD PE=3 SV=1 718 997 2.0E-17
sp|O59207|TRUD_PYRHO Probable tRNA pseudouridine synthase D OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=truD PE=3 SV=1 722 984 2.0E-16
sp|A4WLG8|TRUD_PYRAR Probable tRNA pseudouridine synthase D OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=truD PE=3 SV=1 719 1144 1.0E-15
sp|Q8ZTR2|TRUD_PYRAE Probable tRNA pseudouridine synthase D OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=truD PE=3 SV=1 719 1146 2.0E-15
sp|Q8U0N1|TRUD_PYRFU Probable tRNA pseudouridine synthase D OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=truD PE=3 SV=1 722 984 1.0E-14
sp|Q3IMF3|TRUD_NATPD Probable tRNA pseudouridine synthase D OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=truD PE=3 SV=1 682 1005 3.0E-14
sp|Q9V107|TRUD_PYRAB Probable tRNA pseudouridine synthase D OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=truD PE=3 SV=1 722 997 3.0E-14
sp|Q3A6I8|TRUD_PELCD tRNA pseudouridine synthase D OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=truD PE=3 SV=1 718 1015 8.0E-14
sp|Q9HSG5|TRUD_HALSA Probable tRNA pseudouridine synthase D OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=truD PE=3 SV=2 713 982 2.0E-12
sp|B0R2Y4|TRUD_HALS3 Probable tRNA pseudouridine synthase D OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=truD PE=3 SV=1 713 982 2.0E-12
sp|B1Y9W7|TRUD_PYRNV Probable tRNA pseudouridine synthase D OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=truD PE=3 SV=1 719 1002 9.0E-12
sp|C6E4K4|TRUD_GEOSM tRNA pseudouridine synthase D OS=Geobacter sp. (strain M21) GN=truD PE=3 SV=1 718 1015 9.0E-12
sp|D4ALW9|MEP6_ARTBC Extracellular metalloprotease ARB_05317 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05317 PE=1 SV=1 32 337 4.0E-11
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 30 337 5.0E-11
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 32 337 6.0E-11
sp|Q6M1A3|TRUD1_METMP Probable tRNA pseudouridine synthase D 1 OS=Methanococcus maripaludis (strain S2 / LL) GN=truD1 PE=3 SV=1 719 978 6.0E-10
sp|O67616|TRUD_AQUAE tRNA pseudouridine synthase D OS=Aquifex aeolicus (strain VF5) GN=truD PE=3 SV=1 714 976 9.0E-10
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 86 342 2.0E-09
sp|A7H5G6|TRUD_CAMJD tRNA pseudouridine synthase D OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=truD PE=3 SV=1 717 859 3.0E-09
sp|B9M644|TRUD_GEODF tRNA pseudouridine synthase D OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=truD PE=3 SV=1 718 1000 4.0E-09
sp|E5QZI4|MEP7_ARTGP Extracellular metalloprotease MGYG_00389 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00389 PE=3 SV=1 41 344 5.0E-09
sp|E3QJV4|MEP1_COLGM Extracellular metalloprotease GLRG_06286 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06286 PE=3 SV=1 86 331 9.0E-09
sp|D4DIV0|MEP7_TRIVH Extracellular metalloprotease TRV_07111 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_07111 PE=3 SV=1 86 350 1.0E-08
sp|D4ATD1|MEP7_ARTBC Extracellular metalloprotease ARB_07495 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07495 PE=3 SV=1 86 350 1.0E-08
sp|Q5HSX3|TRUD_CAMJR tRNA pseudouridine synthase D OS=Campylobacter jejuni (strain RM1221) GN=truD PE=3 SV=1 717 859 1.0E-08
sp|Q9PMK3|TRUD_CAMJE tRNA pseudouridine synthase D OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=truD PE=3 SV=1 717 859 3.0E-08
sp|A1W165|TRUD_CAMJJ tRNA pseudouridine synthase D OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=truD PE=3 SV=1 717 859 3.0E-08
sp|A8FNC4|TRUD_CAMJ8 tRNA pseudouridine synthase D OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=truD PE=3 SV=1 717 859 3.0E-08
sp|Q30RS1|TRUD_SULDN tRNA pseudouridine synthase D OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=truD PE=3 SV=1 717 858 2.0E-07
sp|Q9ZKS5|TRUD_HELPJ tRNA pseudouridine synthase D OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=truD PE=3 SV=1 716 874 2.0E-07
sp|P59893|TRUD_WOLSU tRNA pseudouridine synthase D OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=truD PE=3 SV=1 717 870 2.0E-07
sp|A6Q2U7|TRUD_NITSB tRNA pseudouridine synthase D OS=Nitratiruptor sp. (strain SB155-2) GN=truD PE=3 SV=1 717 857 2.0E-07
sp|B5Z7T0|TRUD_HELPG tRNA pseudouridine synthase D OS=Helicobacter pylori (strain G27) GN=truD PE=3 SV=1 716 874 2.0E-07
sp|B6JME7|TRUD_HELP2 tRNA pseudouridine synthase D OS=Helicobacter pylori (strain P12) GN=truD PE=3 SV=1 716 874 3.0E-07
sp|P55985|TRUD_HELPY tRNA pseudouridine synthase D OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=truD PE=3 SV=1 716 874 4.0E-07
sp|Q4UTP6|TRUD_XANC8 tRNA pseudouridine synthase D OS=Xanthomonas campestris pv. campestris (strain 8004) GN=truD PE=3 SV=1 710 857 5.0E-07
sp|Q8P9Y9|TRUD_XANCP tRNA pseudouridine synthase D OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=truD PE=3 SV=1 710 857 5.0E-07
sp|B2AC45|MEP1_PODAN Extracellular metalloprotease PODANS_2_14170 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_14170 PE=3 SV=1 237 338 5.0E-07
sp|C9S5C6|MEP1_VERA1 Extracellular metalloprotease VDBG_01143 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01143 PE=3 SV=1 86 342 5.0E-07
sp|Q8EBR4|TRUD_SHEON tRNA pseudouridine synthase D OS=Shewanella oneidensis (strain MR-1) GN=truD PE=3 SV=1 715 874 5.0E-07
sp|B2UU74|TRUD_HELPS tRNA pseudouridine synthase D OS=Helicobacter pylori (strain Shi470) GN=truD PE=3 SV=1 716 874 5.0E-07
sp|Q980V2|TRUD_SULSO Probable tRNA pseudouridine synthase D OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=truD PE=3 SV=1 850 986 8.0E-07
sp|P60347|TRUD_GEOSL tRNA pseudouridine synthase D OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=truD PE=3 SV=1 718 1000 8.0E-07
sp|Q1CSU8|TRUD_HELPH tRNA pseudouridine synthase D OS=Helicobacter pylori (strain HPAG1) GN=truD PE=3 SV=1 716 874 1.0E-06
sp|Q871C5|MEP1_NEUCR Extracellular metalloprotease NCU07200 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8G12.220 PE=3 SV=1 237 331 2.0E-06
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 12 345 3.0E-06
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 237 331 3.0E-06
sp|P59892|TRUD_HELHP tRNA pseudouridine synthase D OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=truD PE=3 SV=1 712 857 3.0E-06
sp|Q17WX3|TRUD_HELAH tRNA pseudouridine synthase D OS=Helicobacter acinonychis (strain Sheeba) GN=truD PE=3 SV=1 717 874 4.0E-06
sp|Q72IG5|TRUD_THET2 tRNA pseudouridine synthase D OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=truD PE=3 SV=1 712 857 5.0E-06
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 86 342 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009451 RNA modification Yes
GO:0001522 pseudouridine synthesis Yes
GO:0009982 pseudouridine synthase activity Yes
GO:0003723 RNA binding Yes
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016853 isomerase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016866 intramolecular transferase activity No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1786
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7680
Ophiocordyceps australis map64 (Brazil) OphauB2|6369
Ophiocordyceps camponoti-floridani Ophcf2|04969
Ophiocordyceps camponoti-rufipedis Ophun1|5581 (this protein)
Ophiocordyceps kimflemingae Ophio5|570
Ophiocordyceps subramaniannii Hirsu2|1722

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5581
MVAISWAVAGIVASSAVSAGTLGERQDLFSCATPSRTHEERQAFKRALTSSALAKRQESKPDDGSVLPLKVNVDV
CCGGGQPCPPDEAVRQQFVDTNKHYAPAKISYEINQIKRSQDPSCASINLASAVAVSDILKKHFPQRDPSHLNVL
YVDLPAGSGIQGVANRPLKRSGIPGPDTPQADGAVLKTSVLPTHGSAGSQGPSGGDDNTINTRSLKQLRNFLFRR
QSQNDAFSSTKHTSHEIGHMLGLDHPFTGGPLPVPGASACGDGDEIPDTPAQQGPSMGCPKQSGAPFRRQVGDKT
SSCASNGPNGNVDNMMDYGTCPDSTQFTPGQIKHIREVAMYRLGQLKEFPGTPGENGEVGGAGPASQNGGSQGGP
PNGNQNPGGQQPPNGPAVPGGPQDGSAFPGGPQDNSVQPGGPQSQGNPFSGLPQNNQKNVIPQGSQTEINSQGGE
VSPISDDEIMSIINSLMSGGSPQKRDAKNVAHLGQERRSVETIPRAVEGEKTSNADFILDRRADGDKEPFTGMIL
DRRADGDKEPFTGMILDRRADGDKKPPALGTKFSDKMKYTDFQVNEISLDGQVVHLRQVGLTDEQKKQTAEKKER
TAPAAAEAVKPSRADQTIEPTADDVKLLSTLAGDGFAQKLVSLCKGGIVDDPSVKSEPIEDKSKRGQIHGEIRRI
FNSTIETNTDDTGAIIAFRASSNKGRRRNRGPRGPALDKPTAEYLHFTLYKDNHDTMHAVNLLSRKLQVKPVFFA
YAGTKDKRASTVQRCSLRYGKERALAATNNVLRHMATGDYEYRDEPIRLGDLLGNEFVIVLKNCRLVNDDSPSDE
KVEALLQTQAQASLDHMATQGWINYYGHQRFGTYRIGTHEIGKLILSQQWEEAVMALLDYDEDMATSDAPDDALQ
PDEYARHRACFLFRSGEPPEAAAKMMPPRFAAESSILRHLTRLGNASLKDYSGALTSITRGMRSMYLHAYQSYVW
NHAASKRWELYGSDVVEGDLILVDDTIQQPARSDDEDQDPDILPPPETESSQRARPLSADEARSGTYTIHDIVLP
SPGYNVTYPTNALGLFYQSFMALPENGSLDPHKMRRMRREFSLPGHYRTLLCRFLAPPSITFERYSDDEQQLHPT
DLDLVRLAKSAYATVALREIMGDVPESDAPEESI*
Coding >Ophun1|5581
ATGGTCGCCATCTCGTGGGCCGTGGCCGGCATCGTGGCCTCTTCCGCCGTCAGCGCCGGCACTCTTGGGGAGAGG
CAGGACCTCTTCTCTTGCGCAACGCCTTCTCGCACGCACGAGGAGCGTCAGGCCTTTAAGCGTGCTCTCACCAGC
AGTGCCCTCGCCAAGCGCCAGGAGTCGAAGCCGGATGACGGGTCTGTCCTCCCCTTGAAGGTCAATGTCGACGTC
TGTTGCGGAGGTGGTCAACCGTGTCCACCCGATGAAGCCGTCAGGCAGCAGTTCGTCGACACGAATAAGCATTAC
GCTCCGGCCAAGATCAGCTATGAGATCAACCAGATCAAGCGCTCGCAAGACCCCTCCTGTGCCAGTATCAACCTG
GCCAGTGCCGTCGCTGTCAGCGACATTCTGAAGAAACACTTCCCGCAGCGCGACCCGAGTCACCTCAACGTCCTC
TATGTCGACCTCCCCGCTGGCAGCGGCATCCAAGGTGTCGCCAATCGGCCTCTTAAAAGAAGCGGCATCCCGGGT
CCCGACACGCCGCAGGCTGACGGGGCAGTTCTCAAAACGAGCGTTCTGCCCACACATGGATCCGCCGGATCTCAG
GGGCCGTCTGGCGGCGACGATAACACCATCAACACCAGGTCCCTCAAACAGCTGCGAAACTTTCTCTTCCGTCGA
CAAAGCCAGAACGACGCTTTCAGCAGCACCAAGCACACCTCGCACGAAATCGGTCACATGCTCGGCCTCGACCAC
CCCTTCACCGGGGGTCCCCTTCCCGTTCCTGGCGCAAGCGCTTGCGGTGACGGTGATGAGATTCCCGACACGCCG
GCCCAGCAAGGGCCTTCCATGGGATGCCCTAAACAGTCCGGCGCTCCGTTCCGCAGGCAGGTGGGCGATAAGACG
TCGAGCTGCGCATCCAACGGGCCCAACGGAAATGTAGACAACATGATGGACTATGGTACCTGCCCCGACTCGACC
CAATTCACCCCGGGCCAGATCAAGCATATCAGGGAGGTAGCAATGTATCGCCTCGGCCAGCTCAAAGAGTTTCCT
GGAACGCCGGGCGAGAATGGCGAGGTCGGGGGCGCTGGTCCGGCATCGCAGAACGGCGGTTCACAGGGCGGACCT
CCAAATGGCAACCAGAATCCGGGAGGACAGCAGCCTCCGAACGGGCCCGCCGTCCCCGGAGGTCCGCAAGATGGC
TCTGCCTTCCCCGGTGGTCCGCAGGATAACTCCGTCCAACCCGGGGGTCCGCAGTCGCAAGGCAATCCCTTCTCA
GGCCTCCCGCAGAACAATCAGAAAAACGTCATCCCGCAAGGTTCCCAGACCGAGATCAATTCTCAGGGAGGCGAG
GTATCGCCGATCAGCGATGACGAGATCATGTCCATCATCAACAGCCTGATGTCCGGCGGCTCTCCCCAGAAACGG
GACGCCAAGAACGTGGCCCATCTCGGTCAGGAGCGCAGGAGTGTCGAGACGATTCCCAGGGCGGTCGAGGGCGAA
AAGACGTCGAACGCTGACTTCATTCTCGATCGCCGAGCTGACGGGGATAAGGAGCCGTTTACCGGCATGATTCTC
GATCGCCGAGCTGACGGTGATAAGGAGCCGTTCACCGGCATGATTCTCGATCGTCGAGCTGACGGGGACAAGAAG
CCACCGGCCCTGGGTACCAAGTTTAGCGACAAGATGAAGTACACCGACTTTCAAGTGAATGAGATTTCGCTCGAC
GGTCAAGTCGTCCATCTGCGCCAGGTGGGATTGACGGACGAGCAGAAGAAGCAGACCGCAGAGAAGAAAGAACGG
ACAGCACCCGCCGCGGCAGAGGCCGTGAAGCCCAGCAGGGCGGATCAGACGATAGAGCCGACGGCGGACGACGTC
AAGCTGCTCTCGACATTGGCCGGAGACGGCTTTGCTCAAAAGCTGGTGAGTCTGTGTAAGGGCGGCATCGTCGAC
GACCCCTCGGTCAAGTCGGAGCCCATCGAAGACAAGTCGAAACGCGGCCAGATCCACGGCGAGATCCGGCGCATC
TTCAACTCTACCATCGAGACCAACACGGACGACACGGGCGCCATCATCGCCTTCCGCGCATCTTCAAACAAGGGC
CGGAGGCGGAACCGAGGGCCGCGCGGTCCGGCTCTCGACAAGCCAACCGCCGAATACCTACACTTTACGCTCTAC
AAAGACAACCATGACACCATGCACGCCGTCAACCTCCTCTCGCGCAAGCTACAAGTCAAACCTGTCTTCTTTGCA
TACGCCGGCACCAAGGACAAGCGCGCGTCGACAGTCCAGCGCTGCTCTCTACGATACGGCAAGGAGCGAGCGCTG
GCGGCAACCAACAACGTGCTCCGGCACATGGCCACGGGCGACTACGAATACCGAGACGAGCCGATCCGACTGGGT
GACCTTTTAGGCAACGAGTTCGTCATCGTCCTCAAGAACTGCAGGCTCGTCAACGACGACAGCCCGTCAGACGAG
AAAGTCGAGGCACTGCTTCAGACGCAGGCCCAGGCATCACTCGATCACATGGCAACACAAGGCTGGATCAACTAC
TACGGCCACCAGCGGTTCGGCACCTACCGTATCGGAACGCACGAGATTGGCAAGCTCATCCTCAGCCAGCAGTGG
GAAGAAGCCGTCATGGCACTTCTAGATTACGACGAGGACATGGCCACCAGCGACGCCCCCGACGACGCCCTCCAG
CCGGATGAGTACGCACGTCACCGAGCCTGCTTCCTCTTCCGCTCCGGCGAACCCCCCGAAGCAGCCGCCAAGATG
ATGCCCCCCCGATTCGCCGCCGAGTCCTCCATCCTCCGCCACCTAACGCGCCTCGGCAACGCTTCCCTCAAGGAC
TACAGCGGCGCACTGACGTCCATCACCCGCGGCATGCGATCCATGTATCTTCACGCCTACCAGTCCTACGTCTGG
AACCACGCGGCCAGCAAGCGGTGGGAGCTATACGGCTCCGACGTTGTCGAAGGCGACCTCATTCTCGTCGACGAC
ACCATCCAGCAACCCGCACGAAGCGACGACGAAGACCAAGACCCAGATATCCTCCCCCCCCCCGAAACCGAATCC
TCCCAACGAGCCCGACCCCTATCCGCAGACGAAGCCCGCAGCGGCACCTACACAATCCACGACATCGTCCTCCCC
TCCCCAGGCTACAACGTAACCTACCCAACCAACGCCCTCGGCCTCTTCTACCAATCCTTCATGGCCCTCCCCGAA
AACGGCAGCCTAGACCCCCACAAGATGCGTCGCATGCGCCGCGAGTTCAGCCTACCGGGCCACTACCGCACCCTC
CTCTGCCGCTTCCTCGCGCCCCCCTCCATCACCTTCGAGCGATACTCGGACGACGAGCAGCAGCTCCACCCCACG
GATCTAGATCTCGTGAGGCTCGCGAAGAGTGCATACGCGACTGTCGCTCTGAGAGAGATCATGGGCGACGTCCCT
GAAAGCGACGCCCCGGAAGAGTCCATCTAA
Transcript >Ophun1|5581
ATGGTCGCCATCTCGTGGGCCGTGGCCGGCATCGTGGCCTCTTCCGCCGTCAGCGCCGGCACTCTTGGGGAGAGG
CAGGACCTCTTCTCTTGCGCAACGCCTTCTCGCACGCACGAGGAGCGTCAGGCCTTTAAGCGTGCTCTCACCAGC
AGTGCCCTCGCCAAGCGCCAGGAGTCGAAGCCGGATGACGGGTCTGTCCTCCCCTTGAAGGTCAATGTCGACGTC
TGTTGCGGAGGTGGTCAACCGTGTCCACCCGATGAAGCCGTCAGGCAGCAGTTCGTCGACACGAATAAGCATTAC
GCTCCGGCCAAGATCAGCTATGAGATCAACCAGATCAAGCGCTCGCAAGACCCCTCCTGTGCCAGTATCAACCTG
GCCAGTGCCGTCGCTGTCAGCGACATTCTGAAGAAACACTTCCCGCAGCGCGACCCGAGTCACCTCAACGTCCTC
TATGTCGACCTCCCCGCTGGCAGCGGCATCCAAGGTGTCGCCAATCGGCCTCTTAAAAGAAGCGGCATCCCGGGT
CCCGACACGCCGCAGGCTGACGGGGCAGTTCTCAAAACGAGCGTTCTGCCCACACATGGATCCGCCGGATCTCAG
GGGCCGTCTGGCGGCGACGATAACACCATCAACACCAGGTCCCTCAAACAGCTGCGAAACTTTCTCTTCCGTCGA
CAAAGCCAGAACGACGCTTTCAGCAGCACCAAGCACACCTCGCACGAAATCGGTCACATGCTCGGCCTCGACCAC
CCCTTCACCGGGGGTCCCCTTCCCGTTCCTGGCGCAAGCGCTTGCGGTGACGGTGATGAGATTCCCGACACGCCG
GCCCAGCAAGGGCCTTCCATGGGATGCCCTAAACAGTCCGGCGCTCCGTTCCGCAGGCAGGTGGGCGATAAGACG
TCGAGCTGCGCATCCAACGGGCCCAACGGAAATGTAGACAACATGATGGACTATGGTACCTGCCCCGACTCGACC
CAATTCACCCCGGGCCAGATCAAGCATATCAGGGAGGTAGCAATGTATCGCCTCGGCCAGCTCAAAGAGTTTCCT
GGAACGCCGGGCGAGAATGGCGAGGTCGGGGGCGCTGGTCCGGCATCGCAGAACGGCGGTTCACAGGGCGGACCT
CCAAATGGCAACCAGAATCCGGGAGGACAGCAGCCTCCGAACGGGCCCGCCGTCCCCGGAGGTCCGCAAGATGGC
TCTGCCTTCCCCGGTGGTCCGCAGGATAACTCCGTCCAACCCGGGGGTCCGCAGTCGCAAGGCAATCCCTTCTCA
GGCCTCCCGCAGAACAATCAGAAAAACGTCATCCCGCAAGGTTCCCAGACCGAGATCAATTCTCAGGGAGGCGAG
GTATCGCCGATCAGCGATGACGAGATCATGTCCATCATCAACAGCCTGATGTCCGGCGGCTCTCCCCAGAAACGG
GACGCCAAGAACGTGGCCCATCTCGGTCAGGAGCGCAGGAGTGTCGAGACGATTCCCAGGGCGGTCGAGGGCGAA
AAGACGTCGAACGCTGACTTCATTCTCGATCGCCGAGCTGACGGGGATAAGGAGCCGTTTACCGGCATGATTCTC
GATCGCCGAGCTGACGGTGATAAGGAGCCGTTCACCGGCATGATTCTCGATCGTCGAGCTGACGGGGACAAGAAG
CCACCGGCCCTGGGTACCAAGTTTAGCGACAAGATGAAGTACACCGACTTTCAAGTGAATGAGATTTCGCTCGAC
GGTCAAGTCGTCCATCTGCGCCAGGTGGGATTGACGGACGAGCAGAAGAAGCAGACCGCAGAGAAGAAAGAACGG
ACAGCACCCGCCGCGGCAGAGGCCGTGAAGCCCAGCAGGGCGGATCAGACGATAGAGCCGACGGCGGACGACGTC
AAGCTGCTCTCGACATTGGCCGGAGACGGCTTTGCTCAAAAGCTGGTGAGTCTGTGTAAGGGCGGCATCGTCGAC
GACCCCTCGGTCAAGTCGGAGCCCATCGAAGACAAGTCGAAACGCGGCCAGATCCACGGCGAGATCCGGCGCATC
TTCAACTCTACCATCGAGACCAACACGGACGACACGGGCGCCATCATCGCCTTCCGCGCATCTTCAAACAAGGGC
CGGAGGCGGAACCGAGGGCCGCGCGGTCCGGCTCTCGACAAGCCAACCGCCGAATACCTACACTTTACGCTCTAC
AAAGACAACCATGACACCATGCACGCCGTCAACCTCCTCTCGCGCAAGCTACAAGTCAAACCTGTCTTCTTTGCA
TACGCCGGCACCAAGGACAAGCGCGCGTCGACAGTCCAGCGCTGCTCTCTACGATACGGCAAGGAGCGAGCGCTG
GCGGCAACCAACAACGTGCTCCGGCACATGGCCACGGGCGACTACGAATACCGAGACGAGCCGATCCGACTGGGT
GACCTTTTAGGCAACGAGTTCGTCATCGTCCTCAAGAACTGCAGGCTCGTCAACGACGACAGCCCGTCAGACGAG
AAAGTCGAGGCACTGCTTCAGACGCAGGCCCAGGCATCACTCGATCACATGGCAACACAAGGCTGGATCAACTAC
TACGGCCACCAGCGGTTCGGCACCTACCGTATCGGAACGCACGAGATTGGCAAGCTCATCCTCAGCCAGCAGTGG
GAAGAAGCCGTCATGGCACTTCTAGATTACGACGAGGACATGGCCACCAGCGACGCCCCCGACGACGCCCTCCAG
CCGGATGAGTACGCACGTCACCGAGCCTGCTTCCTCTTCCGCTCCGGCGAACCCCCCGAAGCAGCCGCCAAGATG
ATGCCCCCCCGATTCGCCGCCGAGTCCTCCATCCTCCGCCACCTAACGCGCCTCGGCAACGCTTCCCTCAAGGAC
TACAGCGGCGCACTGACGTCCATCACCCGCGGCATGCGATCCATGTATCTTCACGCCTACCAGTCCTACGTCTGG
AACCACGCGGCCAGCAAGCGGTGGGAGCTATACGGCTCCGACGTTGTCGAAGGCGACCTCATTCTCGTCGACGAC
ACCATCCAGCAACCCGCACGAAGCGACGACGAAGACCAAGACCCAGATATCCTCCCCCCCCCCGAAACCGAATCC
TCCCAACGAGCCCGACCCCTATCCGCAGACGAAGCCCGCAGCGGCACCTACACAATCCACGACATCGTCCTCCCC
TCCCCAGGCTACAACGTAACCTACCCAACCAACGCCCTCGGCCTCTTCTACCAATCCTTCATGGCCCTCCCCGAA
AACGGCAGCCTAGACCCCCACAAGATGCGTCGCATGCGCCGCGAGTTCAGCCTACCGGGCCACTACCGCACCCTC
CTCTGCCGCTTCCTCGCGCCCCCCTCCATCACCTTCGAGCGATACTCGGACGACGAGCAGCAGCTCCACCCCACG
GATCTAGATCTCGTGAGGCTCGCGAAGAGTGCATACGCGACTGTCGCTCTGAGAGAGATCATGGGCGACGTCCCT
GAAAGCGACGCCCCGGAAGAGTCCATCTAA
Gene >Ophun1|5581
ATGGTCGCCATCTCGTGGGCCGTGGCCGGCATCGTGGCCTCTTCCGCCGTCAGCGCCGGCACTCTTGGGGAGAGG
CAGGACCTCTTCTCTTGCGCAACGCCTTCTCGCACGCACGAGGAGCGTCAGGCCTTTAAGCGTGCTCTCACCAGC
AGTGCCCTCGCCAAGCGCCAGGAGTCGAAGCCGGATGACGGGTCTGTCCTCCCCTTGAAGGTCAATGTCGACGTC
TGTTGCGGAGGTGGTCAACCGTGTCCACCCGATGTAAGTCTTCTGATTCCTCAAATCATGCCGCACATGTAGCTC
ATCTGTTTCGTCATAGGAAGCCGTCAGGCAGCAGTTCGTCGACACGAATAAGCATTACGCTCCGGCCAAGATCAG
CTATGAGATCAACCAGATCAAGCGCTCGCAAGACCCCTCCTGTGCCAGTATCAACCTGGCCAGTGCCGTCGCTGT
CAGCGACATTCTGAAGAAACACTTCCCGCAGCGCGACCCGAGTCACCTCAACGTCCTCTATGTCGACCTCCCCGC
TGGCAGCGGCATCCAAGGTGTCGCCAATCGGCCTCTTAAAAGAAGCGGCATCCCGGGTCCCGACACGCCGCAGGC
TGACGGGGCAGTTCTCAAAACGAGCGTTCTGCCCACACATGGATCCGCCGGATCTCAGGGGCCGTCTGGCGGCGA
CGATAACACCATCAACACCAGGTCCCTCAAACAGCTGCGAAACTTTCTCTTCCGTCGACAAAGCCAGAACGACGC
TTTCAGCAGCACCAAGCACACCTCGCACGAAATCGGTCACATGCTCGGCCTCGACCACCCCTTCACCGGGGGTCC
CCTTCCCGTTCCTGGCGCAAGCGCTTGCGGTGACGGTGATGAGATTCCCGACACGCCGGCCCAGCAAGGGCCTTC
CATGGGATGCCCTAAACAGTCCGGCGCTCCGTTCCGCAGGCAGGTGGGCGATAAGACGTCGAGCTGCGCATCCAA
CGGGCCCAACGGAAATGTAGACAACATGATGGACTATGGGTACGTCTTTTCCCTGTTGCAACGTAGTCTTCCGCT
GACCACTTTCTGCAGTACCTGCCCCGACTCGACCCAATTCACCCCGGGCCAGATCAAGCATATCAGGGAGGTAGC
AATGTATCGCCTCGGCCAGCTCAAAGAGTTTCCTGGAACGCCGGGCGAGAATGGCGAGGTCGGGGGCGCTGGTCC
GGCATCGCAGAACGGCGGTTCACAGGGCGGACCTCCAAATGGCAACCAGAATCCGGGAGGACAGCAGCCTCCGAA
CGGGCCCGCCGTCCCCGGAGGTCCGCAAGATGGCTCTGCCTTCCCCGGTGGTCCGCAGGATAACTCCGTCCAACC
CGGGGGTCCGCAGTCGCAAGGCAATCCCTTCTCAGGCCTCCCGCAGAACAATCAGAAAAACGTCATCCCGCAAGG
TTCCCAGACCGAGATCAATTCTCAGGGAGGCGAGGTATCGCCGATCAGCGATGACGAGATCATGTCCATCATCAA
CAGCCTGATGTCCGGCGGCTCTCCCCAGAAACGGGACGCCAAGAACGTGGCCCATCTCGGTCAGGAGCGCAGGAG
TGTCGAGACGATTCCCAGGGCGGTCGAGGGCGAAAAGACGTCGAACGCTGACTTCATTCTCGATCGCCGAGCTGA
CGGGGATAAGGAGCCGTTTACCGGCATGATTCTCGATCGCCGAGCTGACGGTGATAAGGAGCCGTTCACCGGCAT
GATTCTCGATCGTCGAGCTGACGGGGACAAGAAGCCGTACACCGGCTTGATCATCGATTGAGCCACCATGACAGA
AGAATGACTACCTCATCATTGTCGACACCAGAGCTTGCTTCGAGTAGACCGGCCCTGGGTACCAAGTTTAGCGAC
AAGATGAAGTCTGCTTCTCGCCGTCAGTGCTTTGGAGCTCAGATTGTTTGATGTTGTGACGTGTATATTTGTGTT
TGGTGTTTTGTACATTATCTTGTCAGTTTGAGGGAGTTCTTGAGGTCACATCGCGTAACATGACGTGATTTGCAG
ATGTTGGAACCAGATTGAAAACAAATGAGGAAATAGCAGGCAACAGACTGTACATACAAGATCGCAGAGAATAGA
TTGTTTGACGTTACTCGAGGGTTGTCAAGGTGGTGTTGAGAGTTTCCAATGAAGAGCAGCCTACCGTAGGGTAGT
TTCGAATGCAAGCCGCGAATCTTCTCACCGCCTTCGATGCCCACCGCTCTGAATCCCCACACTCACCGAGTACTG
CCGGCAAAAAAGACTGCTCCAAGCTTCATCATCTTCATCCATCAGCATCCACAAACACATCTCTTCTCCAAAGAC
GGCGCGTTATGAAGGGAAGAGCGAACCATGCCGTCCGCAGCGGTGCCTCCTATTCGCGGTCCATTGGCATCACGA
ATCGTTCCACGCCCTTGTCCCTGGCCTGGACAGGCGATCAAAGGGCCCGGTGATTTGCATTTCCTCGGCAGTCGA
TGGAGAAGCATCCGTCTAACTCTTGATCAGGTACACCGACTTTCAAGTGAATGAGATTTCGCTCGACGGTCAAGT
CGTCCATCTGCGCCAGGTGGGATTGACGGACGAGCAGAAGAAGCAGGTGAGAAAGCATCCAGATCGAATTGTCTG
TCCTTTGTCAGGCTTACACGTGCCGAAGGGTGAAAGGGCGTCTCAAAAGGCACCGACACAGACCGCAGAGAAGAA
AGAACGGACAGCACCCGCCGCGGCAGAGGCCGTGAAGCCCAGCAGGGCGGATCAGACGATAGAGCCGACGGCGGA
CGACGTCAAGCTGCTCTCGACATTGGCCGGAGACGGCTTTGCTCAAAAGCTGGTGAGTCTGTGTAAGGGCGGCAT
CGTCGACGACCCCTCGGTCAAGTCGGAGCCCATCGAAGACAAGTCGAAACGCGGCCAGATCCACGGCGAGATCCG
GCGCATCTTCAACTCTACCATCGAGACCAACACGGACGACACGGGCGCCATCATCGCCTTCCGCGCATCTTCAAA
CAAGGGCCGGAGGCGGAACCGAGGGCCGCGCGGTCCGGCTCTCGACAAGCCAACCGCCGAATACCTACACTTTAC
GCTCTACAAAGACAACCATGACACCATGCACGCCGTCAACCTCCTCTCGCGCAAGCTACAAGTCAAACCTGTCTT
CTTTGCATACGCCGGCACCAAGGACAAGCGCGCGTCGACAGTCCAGCGCTGCTCTCTACGATACGGCAAGGAGCG
AGCGCTGGCGGCAACCAACAACGTGCTCCGGCACATGGCCACGGGCGACTACGAATACCGAGACGAGCCGATCCG
ACTGGGTGACCTTTTAGGCAACGAGTTCGTCATCGTCCTCAAGAACTGCAGGCTCGTCAACGACGACAGCCCGTC
AGACGAGAAAGTCGAGGCACTGCTTCAGACGCAGGCCCAGGCATCACTCGATCACATGGCAACACAAGGCTGGAT
CAACTACTACGGCCACCAGCGGTTCGGCACCTACCGTATCGGAACGCACGAGATTGGCAAGCTCATCCTCAGCCA
GCAGTGGGAAGAAGCCGTCATGGCACTTCTAGATTACGACGAGGACATGGCCACCAGCGACGCCCCCGACGACGC
CCTCCAGCCGGATGAGTACGCACGTCACCGAGCCTGCTTCCTCTTCCGCTCCGGCGAACCCCCCGAAGCAGCCGC
CAAGATGATGCCCCCCCGATTCGCCGCCGAGTCCTCCATCCTCCGCCACCTAACGCGCCTCGGCAACGCTTCCCT
CAAGGACTACAGCGGCGCACTGACGTCCATCACCCGCGGCATGCGATCCATGTATCTTCACGCCTACCAGTCCTA
CGTCTGGAACCACGCGGCCAGCAAGCGGTGGGAGCTATACGGCTCCGACGTTGTCGAAGGCGACCTCATTCTCGT
CGACGACACCATCCAGCAACCCGCACGAAGCGACGACGAAGACCAAGACCCAGATATCCTCCCCCCCCCCGAAAC
CGAATCCTCCCAACGAGCCCGACCCCTATCCGCAGACGAAGCCCGCAGCGGCACCTACACAATCCACGACATCGT
CCTCCCCTCCCCAGGCTACAACGTAACCTACCCAACCAACGCCCTCGGCCTCTTCTACCAATCCTTCATGGCCCT
CCCCGAAAACGGCAGCCTAGACCCCCACAAGATGCGTCGCATGCGCCGCGAGTTCAGCCTACCGGGCCACTACCG
CACCCTCCTCTGCCGCTTCCTCGCGCCCCCCTCCATCACCTTCGAGCGATACTCGGACGACGAGCAGCAGCTCCA
CCCCACGGATCTAGATCTCGTGAGGGTAAAGTCTGCGTCTGGGGCGAAACGTCCTGCCGAGGTTGAGGGGGAGGC
CGTTGCGAGTAAGAAGATGAGGCTTGAGGAGGAGGCTGGTTCCAACCGTGATGTCGAGGTTGGATCTGGGCTTGA
TTCGCGGGGGGTGGGGAAGGATAGGATTGCAGCTGTGTTGAGAATGCAGCTCGCGAAGAGTGCATACGCGACTGT
CGCTCTGAGAGAGATCATGGGCGACGTCCCTGAAAGCGACGCCCCGGAAGAGTCCATCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail