Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5580
Gene name
LocationContig_56:18489..20218
Strand+
Gene length (bp)1729
Transcript length (bp)1527
Coding sequence length (bp)1527
Protein length (aa) 509

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 4.0E-55 249 481
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.4E-29 249 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 206 499 1.0E-97
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 202 499 3.0E-97
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 210 499 3.0E-87
sp|Q24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster GN=Dsor1 PE=1 SV=2 188 504 5.0E-60
sp|Q91447|MP2K1_SERCA Dual specificity mitogen-activated protein kinase kinase 1 (Fragment) OS=Serinus canaria GN=MAP2K1 PE=2 SV=1 197 502 4.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 206 499 1.0E-97
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 202 499 3.0E-97
sp|Q9Y884|SKH1_SCHPO MAP kinase kinase skh1/pek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=skh1 PE=3 SV=1 210 499 3.0E-87
sp|Q24324|DSOR1_DROME Dual specificity mitogen-activated protein kinase kinase dSOR1 OS=Drosophila melanogaster GN=Dsor1 PE=1 SV=2 188 504 5.0E-60
sp|Q91447|MP2K1_SERCA Dual specificity mitogen-activated protein kinase kinase 1 (Fragment) OS=Serinus canaria GN=MAP2K1 PE=2 SV=1 197 502 4.0E-53
sp|P29678|MP2K1_RABIT Dual specificity mitogen-activated protein kinase kinase 1 OS=Oryctolagus cuniculus GN=MAP2K1 PE=1 SV=2 197 502 9.0E-53
sp|Q01986|MP2K1_RAT Dual specificity mitogen-activated protein kinase kinase 1 OS=Rattus norvegicus GN=Map2k1 PE=1 SV=2 197 502 2.0E-52
sp|P31938|MP2K1_MOUSE Dual specificity mitogen-activated protein kinase kinase 1 OS=Mus musculus GN=Map2k1 PE=1 SV=2 197 502 2.0E-52
sp|Q02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens GN=MAP2K1 PE=1 SV=2 197 502 3.0E-52
sp|Q90321|MP2K2_CYPCA Dual specificity mitogen-activated protein kinase kinase 2 OS=Cyprinus carpio GN=map2k2 PE=2 SV=1 188 501 4.0E-52
sp|Q90891|MP2K2_CHICK Dual specificity mitogen-activated protein kinase kinase 2 OS=Gallus gallus GN=MAP2K2 PE=2 SV=1 197 495 4.0E-52
sp|Q05116|MP2K1_XENLA Dual specificity mitogen-activated protein kinase kinase 1 OS=Xenopus laevis GN=map2k1 PE=1 SV=2 197 501 7.0E-52
sp|Q63932|MP2K2_MOUSE Dual specificity mitogen-activated protein kinase kinase 2 OS=Mus musculus GN=Map2k2 PE=1 SV=2 197 495 8.0E-52
sp|Q1HG70|MP2K2_CANLF Dual specificity mitogen-activated protein kinase kinase 2 OS=Canis lupus familiaris GN=MAP2K2 PE=2 SV=1 197 495 1.0E-51
sp|P36507|MP2K2_HUMAN Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens GN=MAP2K2 PE=1 SV=1 197 495 1.0E-51
sp|P10506|BYR1_SCHPO Protein kinase byr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr1 PE=1 SV=1 161 496 2.0E-51
sp|P36506|MP2K2_RAT Dual specificity mitogen-activated protein kinase kinase 2 OS=Rattus norvegicus GN=Map2k2 PE=1 SV=1 197 481 8.0E-51
sp|Q9XT09|MP2K1_PANTR Dual specificity mitogen-activated protein kinase kinase 1 OS=Pan troglodytes GN=MAP2K1 PE=2 SV=3 197 502 1.0E-50
sp|Q99078|FUZ7_USTMA Dual specificity protein kinase FUZ7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FUZ7 PE=3 SV=2 218 491 6.0E-50
sp|Q62862|MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus GN=Map2k5 PE=1 SV=1 234 492 9.0E-50
sp|Q9WVS7|MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus GN=Map2k5 PE=1 SV=1 234 484 3.0E-49
sp|Q13163|MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens GN=MAP2K5 PE=1 SV=2 234 484 3.0E-49
sp|Q63980|MP2K1_CRIGR Dual specificity mitogen-activated protein kinase kinase 1 OS=Cricetulus griseus GN=MAP2K1 PE=1 SV=1 229 502 2.0E-48
sp|Q10664|MEK2_CAEEL Dual specificity mitogen-activated protein kinase kinase mek-2 OS=Caenorhabditis elegans GN=mek-2 PE=1 SV=1 195 471 3.0E-48
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 234 496 9.0E-46
sp|P08018|PBS2_YEAST MAP kinase kinase PBS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBS2 PE=1 SV=4 252 496 9.0E-45
sp|P06784|STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE7 PE=1 SV=1 227 482 2.0E-43
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 233 491 2.0E-43
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 204 491 3.0E-43
sp|P0CY25|STE7_CANAX Serine/threonine-protein kinase STE7 homolog OS=Candida albicans GN=STE7 PE=3 SV=1 224 477 2.0E-42
sp|C4YLK8|STE7_CANAW Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain WO-1) GN=HST7 PE=3 SV=1 224 477 2.0E-42
sp|Q5A6T5|STE7_CANAL Serine/threonine-protein kinase STE7 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST7 PE=3 SV=1 224 477 6.0E-42
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 241 497 3.0E-41
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 230 481 4.0E-40
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 230 481 4.0E-40
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 230 481 8.0E-40
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 230 481 8.0E-40
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 230 481 1.0E-39
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 230 481 1.0E-39
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 230 481 1.0E-39
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 230 481 1.0E-39
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 230 481 1.0E-39
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 230 481 2.0E-39
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 230 481 2.0E-39
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 230 481 2.0E-39
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 230 481 6.0E-39
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 192 499 9.0E-39
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 230 482 1.0E-38
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 230 481 1.0E-38
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 236 495 2.0E-38
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 236 495 2.0E-38
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 230 481 3.0E-38
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 194 496 4.0E-38
sp|O09110|MP2K3_MOUSE Dual specificity mitogen-activated protein kinase kinase 3 OS=Mus musculus GN=Map2k3 PE=1 SV=2 227 503 4.0E-38
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 124 494 4.0E-38
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 230 481 5.0E-38
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 224 489 6.0E-38
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 230 481 6.0E-38
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 230 481 6.0E-38
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 230 481 6.0E-38
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 230 481 1.0E-37
sp|Q55CL6|MP2K1_DICDI Dual specificity mitogen-activated protein kinase kinase 1 OS=Dictyostelium discoideum GN=mekA PE=1 SV=1 233 415 7.0E-37
sp|P46734|MP2K3_HUMAN Dual specificity mitogen-activated protein kinase kinase 3 OS=Homo sapiens GN=MAP2K3 PE=1 SV=2 227 503 9.0E-37
sp|P45985|MP2K4_HUMAN Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens GN=MAP2K4 PE=1 SV=1 229 507 3.0E-36
sp|P47809|MP2K4_MOUSE Dual specificity mitogen-activated protein kinase kinase 4 OS=Mus musculus GN=Map2k4 PE=1 SV=2 229 507 3.0E-36
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 254 481 4.0E-36
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 232 481 8.0E-36
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 233 481 1.0E-35
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 232 481 2.0E-35
sp|Q07192|MP2K2_XENLA Dual specificity mitogen-activated protein kinase kinase 2 (Fragment) OS=Xenopus laevis GN=map2k2 PE=1 SV=1 229 495 2.0E-35
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 232 481 2.0E-35
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 226 498 2.0E-35
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 227 482 3.0E-35
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 226 498 4.0E-35
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 247 490 7.0E-35
sp|G5EDF7|SEK1_CAEEL Dual specificity mitogen-activated protein kinase kinase sek-1 OS=Caenorhabditis elegans GN=sek-1 PE=1 SV=1 212 496 9.0E-35
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 241 481 1.0E-34
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 241 489 2.0E-34
sp|Q9DGE0|MP2K6_DANRE Dual specificity mitogen-activated protein kinase kinase 6 OS=Danio rerio GN=map2k6 PE=1 SV=2 229 500 2.0E-34
sp|P70236|MP2K6_MOUSE Dual specificity mitogen-activated protein kinase kinase 6 OS=Mus musculus GN=Map2k6 PE=1 SV=1 272 500 3.0E-34
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 207 481 5.0E-34
sp|Q5E9X2|MP2K6_BOVIN Dual specificity mitogen-activated protein kinase kinase 6 OS=Bos taurus GN=MAP2K6 PE=2 SV=1 272 500 7.0E-34
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 226 481 9.0E-34
sp|P52564|MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens GN=MAP2K6 PE=1 SV=1 272 500 1.0E-33
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 251 486 1.0E-33
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 239 481 2.0E-33
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 236 495 2.0E-33
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 236 495 2.0E-33
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 254 481 3.0E-33
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 236 495 3.0E-33
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 226 488 3.0E-33
sp|Q9FX43|M2K9_ARATH Mitogen-activated protein kinase kinase 9 OS=Arabidopsis thaliana GN=MKK9 PE=1 SV=1 229 481 3.0E-33
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 254 486 4.0E-33
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 224 481 4.0E-33
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 230 481 5.0E-33
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 254 486 5.0E-33
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 230 481 7.0E-33
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 256 504 1.0E-32
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 256 501 1.0E-32
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 256 504 1.0E-32
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 220 504 1.0E-32
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 226 488 1.0E-32
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 220 504 2.0E-32
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 226 496 2.0E-32
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 216 481 3.0E-32
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 235 480 3.0E-32
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 262 482 5.0E-32
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 235 480 5.0E-32
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 218 493 5.0E-32
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 226 495 6.0E-32
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 234 481 7.0E-32
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 234 481 8.0E-32
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 255 499 9.0E-32
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 230 482 9.0E-32
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 234 478 1.0E-31
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 234 481 1.0E-31
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 225 481 2.0E-31
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 256 504 2.0E-31
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 215 482 2.0E-31
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 256 504 2.0E-31
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 234 481 2.0E-31
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 256 504 2.0E-31
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 215 482 2.0E-31
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 230 481 3.0E-31
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 249 481 3.0E-31
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 234 481 4.0E-31
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 230 482 4.0E-31
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 230 481 9.0E-31
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 241 495 9.0E-31
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 230 481 9.0E-31
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 225 481 1.0E-30
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 230 481 1.0E-30
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 241 478 2.0E-30
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 234 481 2.0E-30
sp|Q21307|MEK1_CAEEL Dual specificity mitogen-activated protein kinase kinase mek-1 OS=Caenorhabditis elegans GN=mek-1 PE=1 SV=2 268 500 3.0E-30
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 230 414 6.0E-30
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 251 495 7.0E-30
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 252 486 8.0E-30
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 260 495 2.0E-29
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 230 481 2.0E-29
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 225 481 2.0E-29
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 225 481 2.0E-29
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 232 495 2.0E-29
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 249 482 3.0E-29
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 249 482 3.0E-29
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 247 431 3.0E-29
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 228 482 4.0E-29
sp|G5EDT6|JKK1_CAEEL Dual specificity mitogen-activated protein kinase kinase jkk-1 OS=Caenorhabditis elegans GN=jkk-1 PE=1 SV=1 195 483 5.0E-29
sp|O14733|MP2K7_HUMAN Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens GN=MAP2K7 PE=1 SV=2 263 505 5.0E-29
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 224 485 6.0E-29
sp|Q4KSH7|MP2K7_RAT Dual specificity mitogen-activated protein kinase kinase 7 OS=Rattus norvegicus GN=Map2k7 PE=1 SV=1 252 505 6.0E-29
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 224 485 6.0E-29
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 224 485 7.0E-29
sp|Q8CE90|MP2K7_MOUSE Dual specificity mitogen-activated protein kinase kinase 7 OS=Mus musculus GN=Map2k7 PE=1 SV=1 217 505 7.0E-29
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 232 481 9.0E-29
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 224 495 1.0E-28
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 254 481 1.0E-28
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 247 469 1.0E-28
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 247 469 2.0E-28
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 247 469 2.0E-28
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 249 482 2.0E-28
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 235 507 2.0E-28
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 247 469 3.0E-28
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 247 469 6.0E-28
sp|Q9M8J5|M2K8_ARATH Mitogen-activated protein kinase kinase 8 OS=Arabidopsis thaliana GN=MKK8 PE=3 SV=2 207 482 6.0E-28
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 233 478 2.0E-27
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 224 485 2.0E-27
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 224 485 2.0E-27
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 247 469 2.0E-27
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 224 485 3.0E-27
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 224 485 3.0E-27
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 224 491 3.0E-27
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 227 481 3.0E-27
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 247 469 3.0E-27
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 229 484 4.0E-27
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 252 487 5.0E-27
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 252 487 5.0E-27
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 224 495 6.0E-27
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 224 481 7.0E-27
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 224 481 1.0E-26
sp|Q23977|HEP_DROME Dual specificity mitogen-activated protein kinase kinase hemipterous OS=Drosophila melanogaster GN=hep PE=1 SV=2 212 498 1.0E-26
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 255 481 2.0E-26
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 211 481 2.0E-26
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 211 481 2.0E-26
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 211 481 2.0E-26
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 224 495 2.0E-26
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 211 481 2.0E-26
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 211 481 2.0E-26
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 252 498 2.0E-26
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 254 495 2.0E-26
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 224 481 2.0E-26
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 211 481 3.0E-26
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 211 481 3.0E-26
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 253 495 4.0E-26
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 224 495 4.0E-26
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 230 491 4.0E-26
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 268 481 5.0E-26
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 253 495 5.0E-26
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 253 495 6.0E-26
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 253 495 6.0E-26
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 204 481 6.0E-26
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 204 481 6.0E-26
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 230 481 7.0E-26
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 229 481 7.0E-26
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 250 485 7.0E-26
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 211 481 1.0E-25
sp|Q20347|MKK4_CAEEL MAP kinase kinase mkk-4 OS=Caenorhabditis elegans GN=mkk-4 PE=3 SV=3 268 472 1.0E-25
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 211 481 1.0E-25
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 252 482 1.0E-25
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 254 486 1.0E-25
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 226 486 1.0E-25
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 217 481 2.0E-25
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 254 481 2.0E-25
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 220 481 3.0E-25
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 226 481 4.0E-25
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 249 489 4.0E-25
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 226 481 4.0E-25
sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 223 496 4.0E-25
sp|Q6YY75|NEK6_ORYSJ Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=3 SV=2 256 481 4.0E-25
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 249 482 4.0E-25
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 233 491 4.0E-25
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 247 484 4.0E-25
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 217 481 7.0E-25
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 254 486 7.0E-25
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 211 481 8.0E-25
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 232 481 8.0E-25
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 211 481 8.0E-25
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 211 481 8.0E-25
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 232 481 9.0E-25
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 227 481 1.0E-24
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 254 486 1.0E-24
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 221 481 1.0E-24
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 228 483 2.0E-24
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 230 482 2.0E-24
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 228 483 2.0E-24
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 251 481 2.0E-24
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 228 483 2.0E-24
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 267 490 2.0E-24
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 252 484 3.0E-24
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 253 496 3.0E-24
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 253 496 3.0E-24
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 268 486 3.0E-24
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 253 496 3.0E-24
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 251 499 4.0E-24
sp|Q2QMH1|NEK2_ORYSJ Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. japonica GN=NEK2 PE=2 SV=1 230 481 8.0E-24
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 233 412 9.0E-24
sp|A2ZMH2|NEK2_ORYSI Serine/threonine-protein kinase Nek2 OS=Oryza sativa subsp. indica GN=NEK2 PE=3 SV=1 230 481 9.0E-24
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 251 483 9.0E-24
sp|Q10GB1|NEK1_ORYSJ Serine/threonine-protein kinase Nek1 OS=Oryza sativa subsp. japonica GN=NEK1 PE=3 SV=1 230 481 1.0E-23
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 217 481 1.0E-23
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 241 484 1.0E-23
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 177 481 1.0E-23
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 223 496 2.0E-23
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 254 481 2.0E-23
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 233 481 2.0E-23
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 233 412 3.0E-23
sp|P10676|NINAC_DROME Neither inactivation nor afterpotential protein C OS=Drosophila melanogaster GN=ninaC PE=1 SV=2 284 484 4.0E-23
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 253 488 4.0E-23
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 251 484 4.0E-23
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 247 486 4.0E-23
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 252 481 5.0E-23
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 252 481 8.0E-23
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 252 481 9.0E-23
sp|Q8RXT4|NEK4_ARATH Serine/threonine-protein kinase Nek4 OS=Arabidopsis thaliana GN=NEK4 PE=2 SV=1 223 481 9.0E-23
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 251 487 1.0E-22
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 227 481 2.0E-22
sp|Q55DD4|PAKD_DICDI Serine/threonine-protein kinase pakD OS=Dictyostelium discoideum GN=pakD PE=3 SV=1 312 481 2.0E-22
sp|P11837|NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimA PE=1 SV=1 251 487 2.0E-22
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 250 486 2.0E-22
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 257 480 2.0E-22
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 254 482 2.0E-22
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 308 481 3.0E-22
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 253 489 3.0E-22
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 251 481 3.0E-22
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 268 481 3.0E-22
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 253 482 3.0E-22
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 282 486 3.0E-22
sp|Q0WPH8|NEK5_ARATH Serine/threonine-protein kinase Nek5 OS=Arabidopsis thaliana GN=NEK5 PE=1 SV=1 223 481 4.0E-22
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 308 481 4.0E-22
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 223 496 5.0E-22
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 251 414 5.0E-22
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 249 481 5.0E-22
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 239 481 6.0E-22
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 239 481 6.0E-22
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 250 487 6.0E-22
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 253 481 7.0E-22
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 250 482 7.0E-22
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 233 481 7.0E-22
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 252 481 7.0E-22
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 204 412 7.0E-22
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 202 412 8.0E-22
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 252 481 1.0E-21
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 251 481 1.0E-21
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 269 494 1.0E-21
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 250 481 1.0E-21
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 239 481 1.0E-21
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 204 412 1.0E-21
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 204 478 2.0E-21
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 204 478 2.0E-21
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 251 478 2.0E-21
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 247 481 2.0E-21
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 233 494 2.0E-21
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 233 481 2.0E-21
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 233 420 2.0E-21
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 132 478 2.0E-21
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 204 412 2.0E-21
sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=3 SV=1 230 481 2.0E-21
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 252 482 3.0E-21
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 257 481 3.0E-21
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 204 478 3.0E-21
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 257 494 3.0E-21
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 247 481 3.0E-21
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 204 412 3.0E-21
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 322 481 3.0E-21
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 257 476 4.0E-21
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 247 481 4.0E-21
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 250 482 4.0E-21
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 225 486 6.0E-21
sp|Q9SLI2|NEK1_ARATH Serine/threonine-protein kinase Nek1 OS=Arabidopsis thaliana GN=NEK1 PE=2 SV=2 230 491 6.0E-21
sp|P97756|KKCC1_RAT Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus GN=Camkk1 PE=1 SV=1 322 481 8.0E-21
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 250 482 8.0E-21
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 218 481 9.0E-21
sp|Q6ZEZ5|NEK3_ORYSJ Serine/threonine-protein kinase Nek3 OS=Oryza sativa subsp. japonica GN=NEK3 PE=2 SV=1 230 481 1.0E-20
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 233 481 1.0E-20
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 252 483 1.0E-20
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 252 481 1.0E-20
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 248 480 1.0E-20
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 267 481 1.0E-20
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 312 487 1.0E-20
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 269 481 1.0E-20
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 250 481 1.0E-20
sp|Q9LQM8|M2K10_ARATH Mitogen-activated protein kinase kinase 10 OS=Arabidopsis thaliana GN=MKK10 PE=1 SV=1 229 481 2.0E-20
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 158 491 2.0E-20
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 252 482 2.0E-20
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 250 482 3.0E-20
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 268 496 3.0E-20
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 249 485 3.0E-20
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 225 486 3.0E-20
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 230 487 3.0E-20
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 250 481 3.0E-20
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 249 481 3.0E-20
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 257 420 3.0E-20
sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 230 487 4.0E-20
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 267 483 4.0E-20
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 286 466 5.0E-20
sp|Q9ZUZ2|CAMK3_ARATH CDPK-related kinase 3 OS=Arabidopsis thaliana GN=CRK3 PE=1 SV=1 252 483 5.0E-20
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 249 481 6.0E-20
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 230 433 6.0E-20
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 254 503 6.0E-20
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 230 433 6.0E-20
sp|Q03428|NRKB_TRYBB Putative serine/threonine-protein kinase B OS=Trypanosoma brucei brucei GN=NRKB PE=2 SV=2 214 481 7.0E-20
sp|P48479|NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nim-1 PE=2 SV=2 251 488 7.0E-20
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 250 481 7.0E-20
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 251 481 9.0E-20
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 225 481 9.0E-20
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 230 433 1.0E-19
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 252 481 1.0E-19
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 233 481 1.0E-19
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 230 498 1.0E-19
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 247 481 1.0E-19
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 268 493 1.0E-19
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 247 481 1.0E-19
sp|A8X0C4|PAR4_CAEBR Serine/threonine-protein kinase par-4 OS=Caenorhabditis briggsae GN=par-4 PE=3 SV=2 253 481 1.0E-19
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 250 481 1.0E-19
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 205 422 2.0E-19
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 247 481 2.0E-19
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 247 439 2.0E-19
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 275 490 2.0E-19
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 276 483 2.0E-19
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 225 481 3.0E-19
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 214 481 3.0E-19
sp|Q63651|RK_RAT Rhodopsin kinase OS=Rattus norvegicus GN=Grk1 PE=1 SV=1 322 469 4.0E-19
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 254 481 5.0E-19
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 250 454 5.0E-19
sp|Q9WVL4|RK_MOUSE Rhodopsin kinase OS=Mus musculus GN=Grk1 PE=1 SV=1 322 469 5.0E-19
sp|Q12152|YP150_YEAST Putative serine/threonine-protein kinase YPL150W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL150W PE=1 SV=1 227 481 5.0E-19
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 233 508 5.0E-19
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 241 481 6.0E-19
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 252 481 6.0E-19
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 250 482 6.0E-19
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 252 481 8.0E-19
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 247 486 9.0E-19
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 249 486 1.0E-18
sp|Q5ZJB4|IKKA_CHICK Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Gallus gallus GN=CHUK PE=2 SV=1 286 412 1.0E-18
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 248 486 1.0E-18
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 269 416 1.0E-18
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 233 416 1.0E-18
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 235 481 1.0E-18
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 228 481 1.0E-18
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 251 412 1.0E-18
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 254 481 2.0E-18
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 268 469 2.0E-18
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 257 482 2.0E-18
sp|A8WRV1|KIN29_CAEBR Serine/threonine-protein kinase kin-29 OS=Caenorhabditis briggsae GN=kin-29 PE=3 SV=2 268 481 2.0E-18
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 255 483 2.0E-18
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 250 481 2.0E-18
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 269 418 2.0E-18
sp|Q9S2C0|PKSC_STRCO Serine/threonine-protein kinase PksC OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pksC PE=3 SV=1 286 415 2.0E-18
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 171 489 2.0E-18
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 228 481 2.0E-18
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 251 412 2.0E-18
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 252 481 2.0E-18
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 208 439 2.0E-18
sp|Q28DZ1|IKKA_XENTR Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus tropicalis GN=chuk PE=2 SV=1 286 421 2.0E-18
sp|Q93VK0|PPCK2_ARATH Phosphoenolpyruvate carboxylase kinase 2 OS=Arabidopsis thaliana GN=PPCK2 PE=1 SV=2 298 490 2.0E-18
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 284 484 2.0E-18
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 245 405 2.0E-18
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 240 419 3.0E-18
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 284 489 3.0E-18
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 286 415 4.0E-18
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 283 484 4.0E-18
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 209 439 4.0E-18
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 229 486 4.0E-18
sp|Q54VC0|Y9865_DICDI Probable serine/threonine-protein kinase DDB_G0280461 OS=Dictyostelium discoideum GN=DDB_G0280461 PE=3 SV=1 256 422 4.0E-18
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 284 415 4.0E-18
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 234 415 5.0E-18
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 269 426 5.0E-18
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 284 489 5.0E-18
sp|Q8LST2|WNK7_ARATH Probable serine/threonine-protein kinase WNK7 OS=Arabidopsis thaliana GN=WNK7 PE=2 SV=1 248 412 5.0E-18
sp|Q9XTR1|CDK4_CAEEL Cyclin-dependent kinase 4 homolog OS=Caenorhabditis elegans GN=cdk-4 PE=1 SV=2 226 481 5.0E-18
sp|Q6GM53|IKKA_XENLA Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Xenopus laevis GN=chuk PE=2 SV=1 286 421 5.0E-18
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 277 483 5.0E-18
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 243 479 6.0E-18
sp|Q9GN62|PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans GN=par-4 PE=1 SV=2 252 482 6.0E-18
sp|P19525|E2AK2_HUMAN Interferon-induced, double-stranded RNA-activated protein kinase OS=Homo sapiens GN=EIF2AK2 PE=1 SV=2 281 405 6.0E-18
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 248 481 6.0E-18
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 234 415 6.0E-18
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 234 415 6.0E-18
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 268 479 6.0E-18
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 235 481 6.0E-18
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 247 493 6.0E-18
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 269 414 6.0E-18
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 235 481 7.0E-18
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 230 434 7.0E-18
sp|Q9LHI7|NEK7_ARATH Serine/threonine-protein kinase Nek7 OS=Arabidopsis thaliana GN=NEK7 PE=2 SV=1 250 479 7.0E-18
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 248 482 7.0E-18
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 230 481 7.0E-18
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 250 428 7.0E-18
sp|Q6ICW6|WNK11_ARATH Probable serine/threonine-protein kinase WNK11 OS=Arabidopsis thaliana GN=WNK11 PE=2 SV=1 247 481 7.0E-18
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 230 481 8.0E-18
sp|Q62073|M3K7_MOUSE Mitogen-activated protein kinase kinase kinase 7 OS=Mus musculus GN=Map3k7 PE=1 SV=1 268 416 8.0E-18
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 269 482 8.0E-18
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 233 414 9.0E-18
sp|Q4G3H4|IKKA_DANRE Inhibitor of nuclear factor kappa-B kinase subunit alpha OS=Danio rerio GN=chuk PE=1 SV=1 286 412 9.0E-18
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 233 482 9.0E-18
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 250 489 9.0E-18
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 268 482 1.0E-17
sp|A2VDU3|M3K7_BOVIN Mitogen-activated protein kinase kinase kinase 7 OS=Bos taurus GN=MAP3K7 PE=2 SV=1 268 416 1.0E-17
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 284 483 1.0E-17
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 284 476 1.0E-17
sp|Q5RFL3|M3K7_PONAB Mitogen-activated protein kinase kinase kinase 7 OS=Pongo abelii GN=MAP3K7 PE=2 SV=1 268 416 1.0E-17
sp|O43318|M3K7_HUMAN Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens GN=MAP3K7 PE=1 SV=1 268 416 1.0E-17
sp|P0C8E4|M3K7_RAT Mitogen-activated protein kinase kinase kinase 7 OS=Rattus norvegicus GN=Map3k7 PE=1 SV=1 268 416 1.0E-17
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 230 481 1.0E-17
sp|Q9UU87|PPK34_SCHPO Serine/threonine-protein kinase ppk34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk34 PE=3 SV=2 216 483 1.0E-17
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 268 486 1.0E-17
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 252 481 1.0E-17
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 249 481 1.0E-17
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 250 415 1.0E-17
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 264 481 1.0E-17
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 284 482 1.0E-17
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 268 486 1.0E-17
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 243 479 1.0E-17
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 269 418 1.0E-17
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 220 454 1.0E-17
sp|Q9LET1|CAMK7_ARATH CDPK-related kinase 7 OS=Arabidopsis thaliana GN=CRK7 PE=1 SV=1 240 494 2.0E-17
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 283 484 2.0E-17
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 252 481 2.0E-17
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 248 412 2.0E-17
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 220 454 2.0E-17
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 226 481 2.0E-17
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 322 495 2.0E-17
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 230 481 2.0E-17
sp|Q90327|MK08A_CYPCA Mitogen-activated protein kinase 8A OS=Cyprinus carpio GN=mapk8a PE=2 SV=1 252 413 2.0E-17
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 233 471 2.0E-17
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 276 484 2.0E-17
sp|P23647|FUSED_DROME Serine/threonine-protein kinase fused OS=Drosophila melanogaster GN=fu PE=1 SV=2 307 481 2.0E-17
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 230 415 2.0E-17
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 250 482 2.0E-17
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 255 481 2.0E-17
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 284 486 2.0E-17
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 322 495 2.0E-17
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 284 415 2.0E-17
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 249 481 2.0E-17
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 284 481 3.0E-17
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 257 481 3.0E-17
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 229 485 3.0E-17
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 269 482 3.0E-17
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 203 481 3.0E-17
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 249 481 3.0E-17
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 257 482 3.0E-17
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 253 481 3.0E-17
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 249 481 3.0E-17
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 249 481 3.0E-17
sp|Q61831|MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus GN=Mapk10 PE=1 SV=2 225 413 3.0E-17
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 269 481 3.0E-17
sp|O80673|CAMK1_ARATH CDPK-related kinase 1 OS=Arabidopsis thaliana GN=CRK1 PE=1 SV=1 267 494 3.0E-17
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 283 484 3.0E-17
sp|Q95KV0|IKKB_BOVIN Inhibitor of nuclear factor kappa-B kinase subunit beta OS=Bos taurus GN=IKBKB PE=2 SV=1 286 412 3.0E-17
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 253 481 3.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5580
MADSTSSQPQATEPSSHQPPNTAPPAIPTSCMVPHLSSPAPLLRPAIPGGRNGGPRAPRLGLAIPSSPNAKPVGS
QPPRPPLPTLHLATPMGSQITPHEQVPSRSQGAQPGQSAGGGSESSAARSRSGSFGPLDGRTSNPTSADSQYSSF
ASKWGIPVARPKGTPDPGSAVGSMHSERSGGGVAMERDGSLHGLEALDQLSLDRARGADVEELDDEGWRIASMEK
RIVELGNLGEGAGGAVITTDPDPDVKKQIVRELGFNKDCASQHICRYYGAFVDPSTATISIAMEFCEGGSLDSIY
KEVRRLGGRTGEKVLGKIAEGVLSGLTYLHTRRIIHRDIKPSNILLCRDGAVKLCDFGVSGDFGTKGEANTFIGT
SYYMAPERITGQSYTITSDVWSTGVTLLEVAQHRFPFPADGTEMQPRAGMIDLLTYIVRQPVPKLKDEPEKDVYW
SDNFKYFIECCLEKQPNRRASPWKMMEHPWMVDMRQKRVNMVKYLSFVWGWDAKPAAV*
Coding >Ophun1|5580
ATGGCCGACTCGACCTCTTCTCAGCCACAGGCCACCGAGCCTTCTTCACACCAGCCACCCAATACTGCGCCGCCT
GCGATCCCGACCTCGTGCATGGTGCCTCATCTCTCTTCGCCCGCACCGCTGCTTCGTCCGGCTATCCCCGGAGGT
CGCAATGGCGGACCTCGCGCCCCGAGACTCGGCCTGGCTATTCCCTCATCACCCAACGCCAAGCCGGTCGGCAGT
CAGCCCCCTCGTCCGCCGCTTCCGACTTTGCACCTGGCCACGCCAATGGGCAGCCAGATTACACCGCACGAGCAG
GTTCCCTCGAGGTCCCAAGGTGCACAGCCCGGTCAGTCGGCCGGCGGAGGCAGCGAAAGCAGCGCAGCCCGTTCG
AGATCCGGCAGCTTTGGTCCTCTCGATGGCAGGACTAGCAACCCGACCTCGGCCGACTCTCAGTACTCGTCCTTC
GCCTCCAAATGGGGCATCCCCGTTGCACGACCCAAGGGGACCCCCGACCCGGGATCTGCCGTGGGCTCTATGCAT
TCCGAGAGGAGCGGCGGCGGCGTCGCCATGGAGAGAGACGGTAGCCTGCATGGACTCGAGGCTCTAGACCAACTG
AGCCTGGACAGGGCGCGAGGCGCTGACGTGGAAGAGCTGGACGACGAGGGCTGGAGAATCGCTAGTATGGAGAAG
AGGATCGTCGAGCTTGGCAACCTGGGAGAGGGAGCCGGAGGTGCCGTCATCACGACGGATCCCGATCCCGACGTC
AAGAAGCAGATCGTCCGAGAGCTGGGCTTCAACAAGGATTGCGCCTCGCAGCACATTTGCCGCTACTATGGCGCT
TTCGTCGATCCCTCGACGGCCACCATCTCGATTGCCATGGAATTCTGCGAGGGCGGATCCCTCGACAGCATTTAC
AAGGAAGTCAGGCGTCTGGGAGGCCGAACCGGCGAAAAGGTCCTGGGCAAAATCGCAGAGGGCGTCCTCAGCGGC
CTCACCTACCTTCACACGCGGCGCATCATCCACCGCGACATTAAGCCATCCAACATTCTCCTCTGCCGCGACGGG
GCCGTCAAGCTGTGCGACTTTGGCGTCTCGGGCGACTTTGGCACCAAGGGGGAGGCTAATACCTTCATCGGGACG
AGCTACTACATGGCTCCGGAGCGCATCACCGGCCAGTCTTACACCATAACATCGGACGTCTGGTCCACCGGCGTC
ACTCTTCTCGAGGTGGCACAACACCGCTTCCCGTTCCCGGCTGACGGCACGGAGATGCAGCCTCGGGCCGGCATG
ATCGATCTCCTGACGTACATTGTGCGCCAGCCGGTGCCCAAGCTCAAGGACGAGCCTGAAAAGGACGTGTACTGG
AGCGATAACTTCAAGTACTTTATCGAATGCTGCTTGGAGAAGCAACCGAACCGGAGGGCCAGCCCCTGGAAGATG
ATGGAGCATCCATGGATGGTCGACATGCGGCAGAAGCGCGTTAACATGGTCAAATACCTGTCCTTTGTCTGGGGC
TGGGACGCAAAGCCGGCCGCCGTCTAG
Transcript >Ophun1|5580
ATGGCCGACTCGACCTCTTCTCAGCCACAGGCCACCGAGCCTTCTTCACACCAGCCACCCAATACTGCGCCGCCT
GCGATCCCGACCTCGTGCATGGTGCCTCATCTCTCTTCGCCCGCACCGCTGCTTCGTCCGGCTATCCCCGGAGGT
CGCAATGGCGGACCTCGCGCCCCGAGACTCGGCCTGGCTATTCCCTCATCACCCAACGCCAAGCCGGTCGGCAGT
CAGCCCCCTCGTCCGCCGCTTCCGACTTTGCACCTGGCCACGCCAATGGGCAGCCAGATTACACCGCACGAGCAG
GTTCCCTCGAGGTCCCAAGGTGCACAGCCCGGTCAGTCGGCCGGCGGAGGCAGCGAAAGCAGCGCAGCCCGTTCG
AGATCCGGCAGCTTTGGTCCTCTCGATGGCAGGACTAGCAACCCGACCTCGGCCGACTCTCAGTACTCGTCCTTC
GCCTCCAAATGGGGCATCCCCGTTGCACGACCCAAGGGGACCCCCGACCCGGGATCTGCCGTGGGCTCTATGCAT
TCCGAGAGGAGCGGCGGCGGCGTCGCCATGGAGAGAGACGGTAGCCTGCATGGACTCGAGGCTCTAGACCAACTG
AGCCTGGACAGGGCGCGAGGCGCTGACGTGGAAGAGCTGGACGACGAGGGCTGGAGAATCGCTAGTATGGAGAAG
AGGATCGTCGAGCTTGGCAACCTGGGAGAGGGAGCCGGAGGTGCCGTCATCACGACGGATCCCGATCCCGACGTC
AAGAAGCAGATCGTCCGAGAGCTGGGCTTCAACAAGGATTGCGCCTCGCAGCACATTTGCCGCTACTATGGCGCT
TTCGTCGATCCCTCGACGGCCACCATCTCGATTGCCATGGAATTCTGCGAGGGCGGATCCCTCGACAGCATTTAC
AAGGAAGTCAGGCGTCTGGGAGGCCGAACCGGCGAAAAGGTCCTGGGCAAAATCGCAGAGGGCGTCCTCAGCGGC
CTCACCTACCTTCACACGCGGCGCATCATCCACCGCGACATTAAGCCATCCAACATTCTCCTCTGCCGCGACGGG
GCCGTCAAGCTGTGCGACTTTGGCGTCTCGGGCGACTTTGGCACCAAGGGGGAGGCTAATACCTTCATCGGGACG
AGCTACTACATGGCTCCGGAGCGCATCACCGGCCAGTCTTACACCATAACATCGGACGTCTGGTCCACCGGCGTC
ACTCTTCTCGAGGTGGCACAACACCGCTTCCCGTTCCCGGCTGACGGCACGGAGATGCAGCCTCGGGCCGGCATG
ATCGATCTCCTGACGTACATTGTGCGCCAGCCGGTGCCCAAGCTCAAGGACGAGCCTGAAAAGGACGTGTACTGG
AGCGATAACTTCAAGTACTTTATCGAATGCTGCTTGGAGAAGCAACCGAACCGGAGGGCCAGCCCCTGGAAGATG
ATGGAGCATCCATGGATGGTCGACATGCGGCAGAAGCGCGTTAACATGGTCAAATACCTGTCCTTTGTCTGGGGC
TGGGACGCAAAGCCGGCCGCCGTCTAG
Gene >Ophun1|5580
ATGGCCGACTCGACCTCTTCTCAGCCACAGGCCACCGAGCCTTCTTCACACCAGGTCAGTTTCGTCATAGCCCGT
CAACTCAGCTCCGCTCATACTCGCAGCCACCCAATACTGCGCCGCCTGCGATCCCGACCTCGTGCATGGTGCCTC
ATCTCTCTTCGCCCGCACCGCTGCTTCGTCCGGCTATCCCCGGAGGTCGCAATGGCGGACCTCGCGCCCCGAGAC
TCGGCCTGGCTATTCCCTCATCACCCAACGCCAAGCCGGTCGGCAGTCAGCCCCCTCGTCCGCCGCTTCCGACTT
TGCACCTGGCCACGCCAATGGGCAGCCAGATTACACCGCACGAGCAGGTTCCCTCGAGGTCCCAAGGTGCACAGC
CCGGTCAGTCGGCCGGCGGAGGCAGCGAAAGCAGCGCAGCCCGTTCGAGATCCGGCAGCTTTGGTCCTCTCGATG
GCAGGACTAGCAACCCGACCTCGGCCGACTCTCAGTACTCGTCCTTCGCCTCCAAATGGGGCATCCCCGTTGCAC
GACCCAAGGGGACCCCCGACCCGGGATCTGCCGTGGGCTCTATGCATTCCGAGAGGAGCGGCGGCGGCGTCGCCA
TGGAGAGAGACGGTAGCCTGCATGGACTCGAGGCTCTAGACCAACTGAGCCTGGACAGGGCGCGAGGCGCTGACG
TGGAAGAGCTGGACGACGAGGGCTGGAGAATCGCTAGTATGGAGAAGAGGATCGTCGAGCTTGGCAACCTGGGAG
AGGGAGCCGGAGGTGCCGTCACGAGGTGCATGCTCAAGGGCGGCAAGAAGATCTTTGCTCTCAAGGCGAGTTTGA
CCCTTTCCTGTCGTATTTGCGTGAGGCTGACAGGTTCTTCAGGTCATCACGACGGATCCCGATCCCGACGTCAAG
AAGCAGATCGTCCGAGAGCTGGGCTTCAACAAGGATTGCGCCTCGCAGCACATTTGCCGCTACTATGGCGCTTTC
GTCGATCCCTCGACGGCCACCATCTCGATTGCCATGGAATTCTGCGAGGGCGGATCCCTCGACAGCATTTACAAG
GAAGTCAGGCGTCTGGGAGGCCGAACCGGCGAAAAGGTCCTGGGCAAAATCGCAGAGGGCGTCCTCAGCGGCCTC
ACCTACCTTCACACGCGGCGCATCATCCACCGCGACATTAAGCCATCCAACATTCTCCTCTGCCGCGACGGGGCC
GTCAAGCTGTGCGACTTTGGCGTCTCGGGCGACTTTGGCACCAAGGGGGAGGCTAATACCTTCATCGGGACGAGC
TACTACATGGCTCCGGAGCGCATCACCGGCCAGTCTTACACCATAACATCGGACGTCTGGTCCACCGGCGTCACT
CTTCTCGAGGTGGCACAACACCGCTTCCCGTTCCCGGCTGACGGCACGGAGATGCAGCCTCGGGCCGGCATGATC
GATCTCCTGACGTACATTGTGCGCCAGCCGGTGCCCAAGCTCAAGGACGAGCCTGAAAAGGACGTGTACTGGAGC
GATAACTTCAAGTACTTTATCGAATGCTGGTACGTTCTCTTAGTCTGGGAATGAACCGATCGTGTGCTGACGTCC
GTTACGCAGCTTGGAGAAGCAACCGAACCGGAGGGCCAGCCCCTGGAAGATGATGGAGCATCCATGGATGGTCGA
CATGCGGCAGAAGCGCGTTAACATGGTCAAATACCTGTCCTTTGTCTGGGGCTGGGACGCAAAGCCGGCCGCCGT
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail