Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|558
Gene name
LocationContig_1172:1795..2962
Strand-
Gene length (bp)1167
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12516|SRF1_YEAST Regulator of phospholipase D SRF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRF1 PE=1 SV=1 194 357 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 217 239 22
2 254 273 19
3 292 314 22
4 329 351 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|558
MASSPNHDDGYDEPVSLGTESITVDGTPLRLRPARSLPPWIDSYEERYGPPTDEQLRLLKAPDRILHTQRNAVPQ
EPTRRVSKDGFVDWDDPRLGPAKDARSGVPHFLRYGRASKRGRRWDHLRTAEPVIISGHRPATSQLTPTWKEFLD
ASSWGHIPNEKSEVVDYDVLKKMQPSFDGLGPVLPFHAESKGSRRRKTLSFSKRLWIAMMRSPFSPLLFRLIVVI
TSILALGVASRIFQREEAVDRDGAERTQSLFAVAVDCLAIPYIGYMLYDEYTGKPVGLRSGVSKIRLILLDVLFI
IFKSASTALAFESIVYHRIDEFQAWQLSAVLGVFELVGLMSWTMNFVVNVFRTVERLGGGADLEGRLA*
Coding >Ophun1|558
ATGGCGTCTTCGCCCAACCATGACGATGGCTACGATGAGCCCGTCTCGCTCGGCACCGAGAGCATCACCGTCGAC
GGGACTCCGCTGCGGTTACGGCCTGCACGGTCACTGCCTCCCTGGATCGACTCGTACGAGGAACGATACGGCCCT
CCGACCGACGAACAGCTGCGTCTCCTCAAAGCCCCCGACCGCATCCTACATACCCAGCGCAACGCAGTCCCGCAA
GAACCCACGCGTCGCGTCTCAAAGGACGGCTTCGTCGACTGGGACGACCCTCGGCTAGGGCCAGCCAAGGATGCT
CGCTCCGGTGTTCCTCACTTCCTGCGATACGGCCGGGCCTCGAAGCGCGGTAGGAGATGGGATCATCTGCGCACA
GCCGAGCCCGTCATCATCAGCGGCCACCGTCCAGCGACATCGCAGCTTACGCCGACATGGAAAGAGTTCCTCGAC
GCCTCTTCATGGGGCCATATACCCAACGAAAAGTCCGAGGTTGTCGATTACGACGTTCTGAAGAAGATGCAACCA
TCCTTCGATGGACTCGGCCCCGTCCTTCCCTTCCACGCCGAATCCAAGGGCTCGCGTCGTCGTAAGACGCTGTCC
TTTTCCAAACGCCTCTGGATCGCCATGATGCGAAGCCCCTTTTCCCCTCTCCTCTTCCGTCTCATCGTCGTCATC
ACATCCATCCTCGCCCTCGGCGTCGCATCCCGCATCTTCCAGCGCGAAGAGGCCGTCGACCGAGACGGAGCCGAG
CGAACCCAGTCCCTATTTGCCGTCGCCGTCGACTGCCTCGCCATCCCGTACATCGGCTACATGCTGTACGACGAG
TACACGGGCAAGCCCGTCGGTCTCCGATCCGGCGTCTCCAAGATACGGCTCATCCTCCTCGACGTCTTATTCATC
ATCTTCAAGTCGGCCAGCACGGCACTGGCCTTTGAGAGCATCGTCTACCATCGCATCGACGAGTTTCAGGCCTGG
CAGCTTTCGGCCGTCCTGGGCGTCTTTGAGCTCGTCGGCCTCATGTCGTGGACCATGAACTTTGTCGTCAACGTC
TTCCGCACGGTGGAACGCCTGGGAGGCGGTGCCGATCTGGAGGGCAGGTTGGCATAG
Transcript >Ophun1|558
ATGGCGTCTTCGCCCAACCATGACGATGGCTACGATGAGCCCGTCTCGCTCGGCACCGAGAGCATCACCGTCGAC
GGGACTCCGCTGCGGTTACGGCCTGCACGGTCACTGCCTCCCTGGATCGACTCGTACGAGGAACGATACGGCCCT
CCGACCGACGAACAGCTGCGTCTCCTCAAAGCCCCCGACCGCATCCTACATACCCAGCGCAACGCAGTCCCGCAA
GAACCCACGCGTCGCGTCTCAAAGGACGGCTTCGTCGACTGGGACGACCCTCGGCTAGGGCCAGCCAAGGATGCT
CGCTCCGGTGTTCCTCACTTCCTGCGATACGGCCGGGCCTCGAAGCGCGGTAGGAGATGGGATCATCTGCGCACA
GCCGAGCCCGTCATCATCAGCGGCCACCGTCCAGCGACATCGCAGCTTACGCCGACATGGAAAGAGTTCCTCGAC
GCCTCTTCATGGGGCCATATACCCAACGAAAAGTCCGAGGTTGTCGATTACGACGTTCTGAAGAAGATGCAACCA
TCCTTCGATGGACTCGGCCCCGTCCTTCCCTTCCACGCCGAATCCAAGGGCTCGCGTCGTCGTAAGACGCTGTCC
TTTTCCAAACGCCTCTGGATCGCCATGATGCGAAGCCCCTTTTCCCCTCTCCTCTTCCGTCTCATCGTCGTCATC
ACATCCATCCTCGCCCTCGGCGTCGCATCCCGCATCTTCCAGCGCGAAGAGGCCGTCGACCGAGACGGAGCCGAG
CGAACCCAGTCCCTATTTGCCGTCGCCGTCGACTGCCTCGCCATCCCGTACATCGGCTACATGCTGTACGACGAG
TACACGGGCAAGCCCGTCGGTCTCCGATCCGGCGTCTCCAAGATACGGCTCATCCTCCTCGACGTCTTATTCATC
ATCTTCAAGTCGGCCAGCACGGCACTGGCCTTTGAGAGCATCGTCTACCATCGCATCGACGAGTTTCAGGCCTGG
CAGCTTTCGGCCGTCCTGGGCGTCTTTGAGCTCGTCGGCCTCATGTCGTGGACCATGAACTTTGTCGTCAACGTC
TTCCGCACGGTGGAACGCCTGGGAGGCGGTGCCGATCTGGAGGGCAGGTTGGCATAG
Gene >Ophun1|558
ATGGCGTCTTCGCCCAACCATGACGATGGCTACGATGAGCCCGTCTCGCTCGGCACCGAGAGCATCACCGTCGAC
GGGACTCCGCTGCGGTTACGGCCTGCACGGTCACTGCCTCGTACGCCCACCTCGTCGACTCTCACTTGGCTATGC
CCCCTTGGCTGACCATTTCGCCCAGCCTGGATCGACTCGTACGAGGAACGATACGGCCCTCCGACCGACGAACAG
CTGCGTCTCCTCAAAGCCCCCGACCGCATCCTACATACCCAGCGCAACGCAGTCCCGCAAGAACCCACGCGTCGC
GTCTCAAAGGACGGCTTCGTCGACTGGGACGACCCTCGGCTAGGGCCAGCCAAGGATGCTCGCTCCGGTGTTCCT
CACTTCCTGCGATACGGCCGGGCCTCGAAGCGCGGTAGGAGATGGGATCATCTGCGCACAGCCGAGCCCGTCATC
ATCAGCGGCCACCGTCCAGCGACATCGCAGCTTACGCCGACATGGAAAGAGTTCCTCGACGCCTCTTCATGGGGC
CATATACCCAACGAAAAGTCCGAGGTTGTCGATTACGACGTTCTGAAGAAGATGCAACCATCCTTCGATGGACTC
GGCCCCGTCCTTCCCTTCCACGCCGAATCCAAGGGCTCGCGTCGTCGTAAGACGCTGTCCTTTTCCAAACGCCTC
TGGATCGCCATGATGCGAAGCCCCTTTTCCCCTCTCCTCTTCCGTCTCATCGTCGTCATCACATCCATCCTCGCC
CTCGGCGTCGCATCCCGCATCTTCCAGCGCGAAGAGGCCGTCGACCGAGACGGAGCCGAGCGAACCCAGTCCCTA
TTTGCCGTCGCCGTCGACTGCCTCGCCATCCCGTACATCGGCTACATGCTGTACGACGAGTACACGGGCAAGCCC
GTCGGTCTCCGATCCGGCGTCTCCAAGATACGGCTCATCCTCCTCGACGTCTTATTCATCATCTTCAAGTCGGCC
AGCACGGCACTGGCCTTTGAGAGCATCGTCTACCATCGCATCGACGAGTTTCAGGCCTGGCAGCTTTCGGCCGTC
CTGGGCGTCTTTGAGCTCGTCGGCCTCATGTCGTGGACCATGAACTTTGTCGTCAACGTCTTCCGCACGGTGGAA
CGCCTGGGAGGCGGTGCCGATCTGGAGGGCAGGTTGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail