Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5576
Gene name
LocationContig_56:7178..8321
Strand-
Gene length (bp)1143
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01571 GCV_T Aminomethyltransferase folate-binding domain 3.4E-06 54 149

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4R8F9|CAF17_MAGO7 Putative transferase CAF17, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CAF17 PE=3 SV=1 44 375 3.0E-114
sp|Q2H6N9|CAF17_CHAGB Putative transferase CAF17, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CAF17 PE=3 SV=1 16 375 6.0E-102
sp|Q7RYZ1|CAF17_NEUCR Putative transferase caf-17, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=caf-17 PE=3 SV=1 43 372 4.0E-99
sp|Q1DK38|CAF17_COCIM Putative transferase CAF17, mitochondrial OS=Coccidioides immitis (strain RS) GN=CAF17 PE=3 SV=1 43 372 1.0E-83
sp|Q2U664|CAF17_ASPOR Putative transferase caf17, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=caf17 PE=3 SV=1 40 372 5.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4R8F9|CAF17_MAGO7 Putative transferase CAF17, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CAF17 PE=3 SV=1 44 375 3.0E-114
sp|Q2H6N9|CAF17_CHAGB Putative transferase CAF17, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CAF17 PE=3 SV=1 16 375 6.0E-102
sp|Q7RYZ1|CAF17_NEUCR Putative transferase caf-17, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=caf-17 PE=3 SV=1 43 372 4.0E-99
sp|Q1DK38|CAF17_COCIM Putative transferase CAF17, mitochondrial OS=Coccidioides immitis (strain RS) GN=CAF17 PE=3 SV=1 43 372 1.0E-83
sp|Q2U664|CAF17_ASPOR Putative transferase caf17, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=caf17 PE=3 SV=1 40 372 5.0E-80
sp|A1CBI9|CAF17_ASPCL Putative transferase caf17, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=caf17 PE=3 SV=1 32 375 5.0E-79
sp|Q4WVK5|CAF17_ASPFU Putative transferase caf17, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=caf17 PE=3 SV=1 32 372 3.0E-77
sp|A2R472|CAF17_ASPNC Putative transferase caf17, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=caf17 PE=3 SV=1 43 375 3.0E-75
sp|A1DDV0|CAF17_NEOFI Putative transferase caf17, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=caf17 PE=3 SV=2 32 375 2.0E-74
sp|Q0UE25|CAF17_PHANO Putative transferase CAF17, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CAF17 PE=3 SV=1 42 371 9.0E-55
sp|Q4P7A4|CAF17_USTMA Putative transferase CAF17, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CAF17 PE=3 SV=1 45 329 4.0E-47
sp|Q09929|CAF17_SCHPO Putative transferase caf17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf17 PE=3 SV=1 49 331 3.0E-44
sp|P0CM52|CAF17_CRYNJ Putative transferase CAF17, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CAF17 PE=3 SV=1 45 330 8.0E-40
sp|P0CM53|CAF17_CRYNB Putative transferase CAF17, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CAF17 PE=3 SV=1 45 330 8.0E-40
sp|Q6C8Y7|CAF17_YARLI Putative transferase CAF17, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CAF17 PE=3 SV=1 50 296 2.0E-37
sp|B8JMH0|CAF17_DANRE Putative transferase CAF17 homolog, mitochondrial OS=Danio rerio GN=iba57 PE=3 SV=1 48 370 9.0E-36
sp|Q5T440|CAF17_HUMAN Putative transferase CAF17, mitochondrial OS=Homo sapiens GN=IBA57 PE=1 SV=1 25 325 2.0E-35
sp|Q8CAK1|CAF17_MOUSE Putative transferase CAF17 homolog, mitochondrial OS=Mus musculus GN=Iba57 PE=1 SV=1 48 370 2.0E-35
sp|Q54NS1|CAF17_DICDI Putative transferase caf17 homolog, mitochondrial OS=Dictyostelium discoideum GN=caf17 PE=3 SV=1 39 276 9.0E-35
sp|Q8L733|Y4121_ARATH Putative transferase At4g12130, mitochondrial OS=Arabidopsis thaliana GN=At4g12130 PE=1 SV=1 39 370 9.0E-35
sp|A3LNW4|CAF17_PICST Putative transferase CAF17, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CAF17 PE=3 SV=2 43 370 3.0E-24
sp|Q6BPW7|CAF17_DEBHA Putative transferase CAF17, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CAF17 PE=3 SV=2 43 278 6.0E-24
sp|Q5AEF0|CAF17_CANAL Putative transferase CAF17, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAF17 PE=3 SV=1 44 295 1.0E-23
sp|A5DQ50|CAF17_PICGU Putative transferase CAF17, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CAF17 PE=3 SV=2 44 370 2.0E-21
sp|A5DXC3|CAF17_LODEL Putative transferase CAF17, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CAF17 PE=3 SV=1 43 277 2.0E-16
sp|Q6CRA2|CAF17_KLULA Putative transferase CAF17, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAF17 PE=3 SV=1 52 327 3.0E-16
sp|P47158|CAF17_YEAST Putative transferase CAF17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IBA57 PE=1 SV=1 32 371 1.0E-15
sp|Q75D53|CAF17_ASHGO Putative transferase CAF17, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CAF17 PE=3 SV=1 48 286 2.0E-14
sp|Q6FSH5|CAF17_CANGA Putative transferase CAF17, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF17 PE=3 SV=1 45 334 1.0E-13
sp|B6EKN9|YGFZ_ALISL tRNA-modifying protein YgfZ OS=Aliivibrio salmonicida (strain LFI1238) GN=VSAL_I2535 PE=3 SV=1 24 269 5.0E-09
sp|A5F5F3|YGFZ_VIBC3 tRNA-modifying protein YgfZ OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=VC0395_A2049 PE=3 SV=1 35 328 1.0E-06
sp|C3LR15|YGFZ_VIBCM tRNA-modifying protein YgfZ OS=Vibrio cholerae serotype O1 (strain M66-2) GN=VCM66_2395 PE=3 SV=1 35 328 2.0E-06
sp|Q9KPA1|YGFZ_VIBCH tRNA-modifying protein YgfZ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_2472 PE=3 SV=1 35 328 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2080
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6860
Ophiocordyceps australis map64 (Brazil) OphauB2|6373
Ophiocordyceps camponoti-floridani Ophcf2|04974
Ophiocordyceps camponoti-rufipedis Ophun1|5576 (this protein)
Ophiocordyceps kimflemingae Ophio5|577
Ophiocordyceps subramaniannii Hirsu2|2407

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5576
MHRLVRRSHLLVRLPQRRWLSGPTMAPDPTPPGPEPLPEPAGSGFAALASRRLLWMEGPDAAKFLQGLITANVFG
SDGQPRRDAFYTGFLNATGRVLHDAFIYPTSGPFQAGSDGYLVEADAAHIVGLARYMRRYKLRARVQVRDLSPDE
ASVWQAWDDSGDGTATSTAAKSSGSLVLEDPRAPGLGHRIVKAGDASPTALPLERRSEGAYTLRRILAGVPEGQD
ELVSAQALPLESNMDVMNGIDFRKGCYVGQELTIRTRHRGVVRKRILPCVVYHGSEPMELAYEPDQSSDVPRDTS
IGRFGKKGRSAGKWLRGVGNVGLGLCRLEIMTDVVLPGEQAAATYRAGDEFVVEWGQGRSAKVKAFVPDWLRRAL
DEPRR*
Coding >Ophun1|5576
ATGCACCGGCTCGTGCGCCGGAGTCATCTCCTTGTTCGGCTGCCGCAGCGGCGGTGGCTTTCCGGTCCGACGATG
GCTCCGGATCCGACGCCGCCGGGGCCTGAGCCGTTACCGGAGCCGGCCGGGAGCGGGTTCGCCGCCCTGGCTTCG
CGCCGGCTGCTTTGGATGGAGGGGCCTGACGCTGCCAAATTCCTGCAGGGCCTCATCACGGCCAATGTCTTTGGG
TCTGACGGTCAGCCGCGACGCGACGCCTTCTATACCGGCTTCCTCAACGCTACGGGGCGCGTTCTCCACGACGCC
TTCATATATCCGACGAGCGGCCCGTTCCAGGCGGGTTCAGACGGATATTTGGTCGAGGCCGACGCCGCGCACATC
GTCGGATTGGCCCGATACATGCGGCGCTACAAGCTCAGGGCTCGCGTCCAAGTCCGCGACCTCTCGCCCGACGAG
GCATCGGTTTGGCAGGCCTGGGACGACAGCGGTGACGGAACAGCGACATCTACCGCTGCCAAGTCTTCCGGGTCC
CTCGTTCTCGAAGATCCACGCGCGCCCGGCCTCGGTCATCGTATCGTCAAGGCCGGTGACGCGTCGCCAACCGCG
CTGCCCCTCGAGCGTCGAAGCGAGGGAGCGTACACGCTGCGGCGCATCTTGGCGGGCGTACCCGAGGGTCAGGAT
GAACTGGTCTCGGCACAGGCACTGCCGCTGGAGAGCAACATGGACGTGATGAATGGCATCGACTTTCGCAAGGGC
TGCTACGTCGGCCAGGAGCTCACCATCCGCACGCGTCACCGCGGTGTCGTGCGCAAGCGCATTCTGCCGTGCGTC
GTCTATCATGGCTCCGAGCCGATGGAGCTCGCGTACGAGCCAGATCAGTCATCGGATGTGCCGCGTGACACGAGC
ATCGGTCGCTTCGGCAAAAAGGGCCGCAGCGCCGGAAAATGGCTCCGGGGCGTGGGCAACGTCGGCCTGGGCCTC
TGCCGGCTGGAGATTATGACGGACGTGGTGCTTCCGGGCGAGCAGGCGGCGGCCACCTACCGGGCGGGAGACGAG
TTCGTCGTCGAATGGGGCCAAGGCCGGAGCGCAAAGGTCAAGGCCTTTGTGCCGGACTGGTTGCGACGTGCGCTG
GATGAGCCACGGCGCTGA
Transcript >Ophun1|5576
ATGCACCGGCTCGTGCGCCGGAGTCATCTCCTTGTTCGGCTGCCGCAGCGGCGGTGGCTTTCCGGTCCGACGATG
GCTCCGGATCCGACGCCGCCGGGGCCTGAGCCGTTACCGGAGCCGGCCGGGAGCGGGTTCGCCGCCCTGGCTTCG
CGCCGGCTGCTTTGGATGGAGGGGCCTGACGCTGCCAAATTCCTGCAGGGCCTCATCACGGCCAATGTCTTTGGG
TCTGACGGTCAGCCGCGACGCGACGCCTTCTATACCGGCTTCCTCAACGCTACGGGGCGCGTTCTCCACGACGCC
TTCATATATCCGACGAGCGGCCCGTTCCAGGCGGGTTCAGACGGATATTTGGTCGAGGCCGACGCCGCGCACATC
GTCGGATTGGCCCGATACATGCGGCGCTACAAGCTCAGGGCTCGCGTCCAAGTCCGCGACCTCTCGCCCGACGAG
GCATCGGTTTGGCAGGCCTGGGACGACAGCGGTGACGGAACAGCGACATCTACCGCTGCCAAGTCTTCCGGGTCC
CTCGTTCTCGAAGATCCACGCGCGCCCGGCCTCGGTCATCGTATCGTCAAGGCCGGTGACGCGTCGCCAACCGCG
CTGCCCCTCGAGCGTCGAAGCGAGGGAGCGTACACGCTGCGGCGCATCTTGGCGGGCGTACCCGAGGGTCAGGAT
GAACTGGTCTCGGCACAGGCACTGCCGCTGGAGAGCAACATGGACGTGATGAATGGCATCGACTTTCGCAAGGGC
TGCTACGTCGGCCAGGAGCTCACCATCCGCACGCGTCACCGCGGTGTCGTGCGCAAGCGCATTCTGCCGTGCGTC
GTCTATCATGGCTCCGAGCCGATGGAGCTCGCGTACGAGCCAGATCAGTCATCGGATGTGCCGCGTGACACGAGC
ATCGGTCGCTTCGGCAAAAAGGGCCGCAGCGCCGGAAAATGGCTCCGGGGCGTGGGCAACGTCGGCCTGGGCCTC
TGCCGGCTGGAGATTATGACGGACGTGGTGCTTCCGGGCGAGCAGGCGGCGGCCACCTACCGGGCGGGAGACGAG
TTCGTCGTCGAATGGGGCCAAGGCCGGAGCGCAAAGGTCAAGGCCTTTGTGCCGGACTGGTTGCGACGTGCGCTG
GATGAGCCACGGCGCTGA
Gene >Ophun1|5576
ATGCACCGGCTCGTGCGCCGGAGTCATCTCCTTGTTCGGCTGCCGCAGCGGCGGTGGCTTTCCGGTCCGACGATG
GCTCCGGATCCGACGCCGCCGGGGCCTGAGCCGTTACCGGAGCCGGCCGGGAGCGGGTTCGCCGCCCTGGCTTCG
CGCCGGCTGCTTTGGATGGAGGGGCCTGACGCTGCCAAATTCCTGCAGGGCCTCATCACGGCCAATGTCTTTGGG
TCTGACGGTCAGCCGCGACGCGACGCCTTCTATACCGGCTTCCTCAACGCTACGGGGCGCGTTCTCCACGACGCC
TTCATATATCCGACGAGCGGCCCGTTCCAGGCGGGTTCAGACGGATATTTGGTCGAGGCCGACGCCGCGCACATC
GTCGGATTGGCCCGATACATGCGGCGCTACAAGCTCAGGGCTCGCGTCCAAGTCCGCGACCTCTCGCCCGACGAG
GCATCGGTTTGGCAGGCCTGGGACGACAGCGGTGACGGAACAGCGACATCTACCGCTGCCAAGTCTTCCGGGTCC
CTCGTTCTCGAAGATCCACGCGCGCCCGGCCTCGGTCATCGTATCGTCAAGGCCGGTGACGCGTCGCCAACCGCG
CTGCCCCTCGAGCGTCGAAGCGAGGGAGCGTACACGCTGCGGCGCATCTTGGCGGGCGTACCCGAGGGTCAGGAT
GAACTGGTCTCGGCACAGGCACTGCCGCTGGAGAGCAACATGGACGTGATGAATGGCATCGACTTTCGCAAGGGC
TGCTACGTCGGCCAGGAGCTCACCATCCGCACGCGTCACCGCGGTGTCGTGCGCAAGCGCATTCTGCCGTGCGTC
GTCTATCATGGCTCCGAGCCGATGGAGCTCGCGTACGAGCCAGATCAGTCATCGGATGTGCCGCGTGACACGAGC
ATCGGTCGCTTCGGCAAAAAGGGCCGCAGCGCCGGAAAATGGCTCCGGGGCGTGGGCAACGTCGGCCTGGGCCTC
TGCCGGCTGGAGATTATGACGGACGTGGTGCTTCCGGGCGAGCAGGCGGCGGCCACCTACCGGGCGGGAGACGAG
TTCGTCGTCGAATGGGGCCAAGGCCGGAGCGCAAAGGTCAAGGCCTTTGTGCCGGACTGGTTGCGACGTGCGCTG
GATGAGCCACGGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail