Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|5572
Gene name
LocationContig_559:10767..11661
Strand+
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 6.3E-10 56 273

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6292
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02242
Ophiocordyceps camponoti-rufipedis Ophun1|5572 (this protein)
Ophiocordyceps kimflemingae Ophio5|8239
Ophiocordyceps subramaniannii Hirsu2|8549

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|5572
MTLSRPALGSMPLRLVSFNIRYATTQPVADEKPWKVRCPKLCNQLRFITAGHESPFICLQEVLYSQLEDVQAQLG
RPWAHIGRGREQGEKDGEFSPIFYHADAWECIRNETRWLSPTPRVPSRGWDAALNRIVTIGLFRHRATGTRVVVM
STHFDHMGFKARANSARLLIEFAKEWSVGDPSAVLIGGDFNSPPDDEAYKVMTAYGSGMSDVASLVPEGRRYGNE
MTYTTFGEPNEVPMRIDFLFIREPRTAVVNTFGVLANRFDDKILLSDHRAVVADFEVRAQRTASGEEESRGD*
Coding >Ophun1|5572
ATGACGCTGTCGCGCCCTGCCCTCGGCTCCATGCCACTCCGCCTCGTCAGCTTCAACATCCGATACGCCACGACT
CAGCCAGTGGCAGACGAAAAGCCGTGGAAGGTTCGCTGCCCCAAGCTCTGCAATCAACTTCGTTTCATCACGGCG
GGCCACGAAAGCCCCTTTATCTGTCTCCAGGAGGTCCTATACTCCCAGCTCGAGGACGTACAAGCCCAGTTGGGT
CGCCCATGGGCGCACATCGGACGAGGGAGAGAACAGGGAGAAAAGGACGGCGAGTTCTCGCCAATCTTTTATCAT
GCCGACGCCTGGGAGTGTATCCGCAACGAGACGCGATGGCTCAGCCCGACGCCGCGCGTACCGTCTCGCGGATGG
GATGCCGCCCTCAACAGAATCGTCACCATCGGTCTCTTCCGTCACCGCGCGACGGGGACCCGCGTCGTCGTCATG
AGCACGCATTTCGATCACATGGGCTTCAAAGCCCGTGCCAATAGCGCCAGGCTGCTCATCGAGTTTGCCAAGGAG
TGGAGTGTCGGTGATCCGTCGGCGGTCCTGATCGGCGGCGACTTCAACAGCCCGCCCGACGACGAGGCCTACAAA
GTCATGACGGCGTACGGGTCGGGCATGTCGGATGTGGCCAGTCTGGTGCCGGAGGGCAGGAGATACGGCAATGAA
ATGACGTACACGACCTTTGGCGAACCCAACGAGGTGCCGATGCGGATCGACTTTTTATTCATTCGGGAACCGCGT
ACGGCGGTGGTCAACACTTTTGGAGTTTTGGCAAATCGGTTCGACGACAAGATTCTCTTATCAGACCACAGGGCT
GTCGTGGCCGACTTCGAAGTCAGGGCGCAGCGGACAGCGAGTGGCGAGGAAGAGTCAAGAGGAGACTAG
Transcript >Ophun1|5572
ATGACGCTGTCGCGCCCTGCCCTCGGCTCCATGCCACTCCGCCTCGTCAGCTTCAACATCCGATACGCCACGACT
CAGCCAGTGGCAGACGAAAAGCCGTGGAAGGTTCGCTGCCCCAAGCTCTGCAATCAACTTCGTTTCATCACGGCG
GGCCACGAAAGCCCCTTTATCTGTCTCCAGGAGGTCCTATACTCCCAGCTCGAGGACGTACAAGCCCAGTTGGGT
CGCCCATGGGCGCACATCGGACGAGGGAGAGAACAGGGAGAAAAGGACGGCGAGTTCTCGCCAATCTTTTATCAT
GCCGACGCCTGGGAGTGTATCCGCAACGAGACGCGATGGCTCAGCCCGACGCCGCGCGTACCGTCTCGCGGATGG
GATGCCGCCCTCAACAGAATCGTCACCATCGGTCTCTTCCGTCACCGCGCGACGGGGACCCGCGTCGTCGTCATG
AGCACGCATTTCGATCACATGGGCTTCAAAGCCCGTGCCAATAGCGCCAGGCTGCTCATCGAGTTTGCCAAGGAG
TGGAGTGTCGGTGATCCGTCGGCGGTCCTGATCGGCGGCGACTTCAACAGCCCGCCCGACGACGAGGCCTACAAA
GTCATGACGGCGTACGGGTCGGGCATGTCGGATGTGGCCAGTCTGGTGCCGGAGGGCAGGAGATACGGCAATGAA
ATGACGTACACGACCTTTGGCGAACCCAACGAGGTGCCGATGCGGATCGACTTTTTATTCATTCGGGAACCGCGT
ACGGCGGTGGTCAACACTTTTGGAGTTTTGGCAAATCGGTTCGACGACAAGATTCTCTTATCAGACCACAGGGCT
GTCGTGGCCGACTTCGAAGTCAGGGCGCAGCGGACAGCGAGTGGCGAGGAAGAGTCAAGAGGAGACTAG
Gene >Ophun1|5572
ATGACGCTGTCGCGCCCTGCCCTCGGCTCCATGCCACTCCGCCTCGTCAGCTTCAACATCCGATACGCCACGACT
CAGCCAGTGGCAGACGAAAAGCCGTGGAAGGTTCGCTGCCCCAAGCTCTGCAATCAACTTCGTTTCATCACGGCG
GGCCACGAAAGCCCCTTTATCTGTCTCCAGGAGGTCCTATACTCCCAGCTCGAGGACGTACAAGCCCAGTTGGGT
CGCCCATGGGCGCACATCGGACGAGGGAGAGAACAGGGAGAAAAGGACGGCGAGTTCTCGCCAATCTTTTATCAT
GCCGACGCCTGGGAGTGTATCCGCAACGAGACGCGATGGCTCAGCCCGACGCCGCGCGTACCGTCTCGCGGATGG
GATGCCGCCCTCAACAGAATCGTCACCATCGGTCTCTTCCGTCACCGCGCGACGGGGACCCGCGTCGTCGTCATG
AGCACGCATTTCGATCACATGGGCTTCAAAGCCCGTGCCAATAGCGCCAGGCTGCTCATCGAGTTTGCCAAGGAG
TGGAGTGTCGGTGATCCGTCGGCGGTCCTGATCGGCGGCGACTTCAACAGCCCGCCCGACGACGAGGCCTACAAA
GTCATGACGGCGTACGGGTCGGGCATGTCGGATGTGGCCAGTCTGGTGCCGGAGGGCAGGAGATACGGCAATGAA
ATGACGTACACGACCTTTGGCGAACCCAACGAGGTGCCGATGCGGATCGACTTTTTATTCATTCGGGAACCGCGT
ACGGCGGTGGTCAACACTTTTGGAGTTTTGGCAAATCGGTTCGACGACAAGATTCTCTTATCAGACCACAGGGCT
GTCGTGGCCGACTTCGAAGTCAGGGCGCAGCGGACAGCGAGTGGCGAGGAAGAGTCAAGAGGAGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail